BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003O01

Length=785
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011071940.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    220   2e-63   Sesamum indicum [beniseed]
ref|XP_004236255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    221   3e-63   Solanum lycopersicum
ref|XP_011071939.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    220   3e-63   Sesamum indicum [beniseed]
ref|XP_006344459.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    220   5e-63   Solanum tuberosum [potatoes]
ref|XP_006439905.1|  hypothetical protein CICLE_v10019394mg             213   1e-62   
ref|XP_009594348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    217   5e-62   Nicotiana tomentosiformis
ref|XP_009769444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    216   8e-62   Nicotiana sylvestris
gb|KDO69502.1|  hypothetical protein CISIN_1g013176mg                   212   8e-62   Citrus sinensis [apfelsine]
emb|CDP12744.1|  unnamed protein product                                213   9e-61   Coffea canephora [robusta coffee]
ref|XP_006439909.1|  hypothetical protein CICLE_v10019394mg             212   2e-60   Citrus clementina [clementine]
ref|XP_006476870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    212   3e-60   Citrus sinensis [apfelsine]
ref|XP_007155472.1|  hypothetical protein PHAVU_003G204200g             209   3e-59   Phaseolus vulgaris [French bean]
gb|AFW97645.1|  cold responsive DEAD-box RNA helicase                   207   7e-59   Chorispora bungeana
ref|XP_009112063.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    207   7e-59   Brassica rapa
emb|CDY16735.1|  BnaA09g06470D                                          207   7e-59   Brassica napus [oilseed rape]
emb|CDY48128.1|  BnaCnng15700D                                          207   9e-59   Brassica napus [oilseed rape]
gb|KHN34349.1|  DEAD-box ATP-dependent RNA helicase 30                  206   1e-58   Glycine soja [wild soybean]
ref|XP_006394312.1|  hypothetical protein EUTSA_v10003871mg             207   1e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010663104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    209   2e-58   Vitis vinifera
ref|XP_008239580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    207   2e-58   Prunus mume [ume]
gb|KDP31038.1|  hypothetical protein JCGZ_11414                         207   3e-58   Jatropha curcas
gb|KHN18420.1|  DEAD-box ATP-dependent RNA helicase 30                  205   3e-58   Glycine soja [wild soybean]
ref|XP_007210287.1|  hypothetical protein PRUPE_ppa002741mg             207   3e-58   Prunus persica
ref|XP_010678860.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    207   4e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002322195.2|  hypothetical protein POPTR_0015s09460g             206   4e-58   Populus trichocarpa [western balsam poplar]
ref|XP_006579582.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    206   5e-58   
ref|XP_002318665.2|  ethylene-responsive DEAD box RNA helicase fa...    204   9e-58   
ref|XP_010444189.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    204   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_011047813.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    205   1e-57   Populus euphratica
ref|XP_010484038.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    204   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010459851.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    204   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_007036326.1|  P-loop containing nucleoside triphosphate hy...    205   1e-57   
ref|XP_003549600.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    204   1e-57   Glycine max [soybeans]
ref|XP_006845267.1|  hypothetical protein AMTR_s00005p00263980          206   1e-57   Amborella trichopoda
ref|XP_011046220.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    204   3e-57   Populus euphratica
dbj|BAB10554.1|  ATP-dependent RNA helicase-like protein                203   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KEH31793.1|  DEAD-box ATP-dependent RNA helicase-like protein        204   3e-57   Medicago truncatula
gb|KFK25761.1|  hypothetical protein AALP_AA8G156100                    203   4e-57   Arabis alpina [alpine rockcress]
ref|NP_974985.1|  DEAD-box ATP-dependent RNA helicase 30                203   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280218.1|  hypothetical protein CARUB_v10026128mg             203   5e-57   Capsella rubella
gb|EYU22173.1|  hypothetical protein MIMGU_mgv1a003417mg                202   5e-57   Erythranthe guttata [common monkey flower]
ref|XP_004299135.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    202   8e-57   Fragaria vesca subsp. vesca
ref|XP_002866536.1|  hypothetical protein ARALYDRAFT_496494             202   1e-56   
ref|XP_010251083.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    203   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_004515873.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    201   3e-56   Cicer arietinum [garbanzo]
ref|XP_008365657.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    201   3e-56   
ref|XP_010550696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    200   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_010102487.1|  DEAD-box ATP-dependent RNA helicase 20             201   4e-56   Morus notabilis
ref|XP_008807455.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    201   5e-56   Phoenix dactylifera
ref|XP_009345779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    199   1e-55   Pyrus x bretschneideri [bai li]
emb|CAA09209.1|  RNA helicase                                           188   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009363040.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    199   2e-55   Pyrus x bretschneideri [bai li]
gb|KJB40103.1|  hypothetical protein B456_007G047000                    199   2e-55   Gossypium raimondii
ref|XP_010932245.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    199   3e-55   Elaeis guineensis
ref|XP_009412685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    199   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60527.1|  hypothetical protein M569_14276                         188   6e-55   Genlisea aurea
ref|XP_010027294.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    197   6e-55   Eucalyptus grandis [rose gum]
ref|XP_004138092.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    197   1e-54   Cucumis sativus [cucumbers]
ref|XP_008464517.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    197   1e-54   Cucumis melo [Oriental melon]
ref|XP_006385358.1|  DEAD box RNA helicase family protein               194   2e-54   
ref|XP_011000790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    193   6e-54   Populus euphratica
gb|KHN39300.1|  DEAD-box ATP-dependent RNA helicase 20                  191   1e-53   Glycine soja [wild soybean]
ref|XP_004486821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    192   2e-53   Cicer arietinum [garbanzo]
ref|XP_006392681.1|  hypothetical protein EUTSA_v10011413mg             190   2e-53   Eutrema salsugineum [saltwater cress]
gb|KDO65284.1|  hypothetical protein CISIN_1g010649mg                   191   2e-53   Citrus sinensis [apfelsine]
ref|XP_006426523.1|  hypothetical protein CICLE_v10025421mg             191   2e-53   
ref|XP_006583016.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   3e-53   Glycine max [soybeans]
gb|ABR16327.1|  unknown                                                 191   3e-53   Picea sitchensis
ref|XP_003529884.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   3e-53   Glycine max [soybeans]
ref|XP_006392683.1|  hypothetical protein EUTSA_v10011413mg             191   3e-53   Eutrema salsugineum [saltwater cress]
ref|XP_007135556.1|  hypothetical protein PHAVU_010G139400g             191   4e-53   Phaseolus vulgaris [French bean]
ref|XP_010542432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   4e-53   Tarenaya hassleriana [spider flower]
gb|KDO65287.1|  hypothetical protein CISIN_1g010649mg                   190   4e-53   Citrus sinensis [apfelsine]
gb|ACN39916.1|  unknown                                                 192   5e-53   Picea sitchensis
gb|KDO65286.1|  hypothetical protein CISIN_1g010649mg                   190   5e-53   Citrus sinensis [apfelsine]
ref|XP_006466042.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   5e-53   Citrus sinensis [apfelsine]
ref|XP_010686087.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   5e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006426526.1|  hypothetical protein CICLE_v10025421mg             190   5e-53   
ref|XP_006426525.1|  hypothetical protein CICLE_v10025421mg             190   6e-53   Citrus clementina [clementine]
ref|XP_006426524.1|  hypothetical protein CICLE_v10025421mg             190   6e-53   Citrus clementina [clementine]
ref|XP_006466041.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   6e-53   Citrus sinensis [apfelsine]
ref|XP_003531619.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   6e-53   Glycine max [soybeans]
ref|XP_004486820.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    191   6e-53   
ref|XP_002527412.1|  dead box ATP-dependent RNA helicase, putative      190   9e-53   Ricinus communis
ref|XP_010480030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   9e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010501121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   1e-52   Camelina sativa [gold-of-pleasure]
gb|KHG24204.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein    189   1e-52   Gossypium arboreum [tree cotton]
ref|XP_006858286.1|  hypothetical protein AMTR_s00064p00050700          189   1e-52   Amborella trichopoda
gb|KJB70270.1|  hypothetical protein B456_011G066000                    189   1e-52   Gossypium raimondii
gb|KCW53605.1|  hypothetical protein EUGRSUZ_J028691                    189   1e-52   Eucalyptus grandis [rose gum]
ref|XP_008447604.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   1e-52   Cucumis melo [Oriental melon]
ref|XP_010480028.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   1e-52   Camelina sativa [gold-of-pleasure]
gb|KHF98903.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein    189   2e-52   Gossypium arboreum [tree cotton]
gb|KDP40778.1|  hypothetical protein JCGZ_24777                         189   2e-52   Jatropha curcas
ref|XP_010462359.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004146825.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-52   Cucumis sativus [cucumbers]
ref|XP_008228305.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-52   Prunus mume [ume]
ref|XP_010033787.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-52   Eucalyptus grandis [rose gum]
ref|NP_001105241.1|  DEAD box RNA helicase1                             190   2e-52   
tpg|DAA56213.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    190   2e-52   
ref|XP_010462358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008228303.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-52   Prunus mume [ume]
ref|XP_008391321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-52   Malus domestica [apple tree]
ref|XP_004968530.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   3e-52   Setaria italica
gb|KJB56890.1|  hypothetical protein B456_009G140700                    188   3e-52   Gossypium raimondii
ref|XP_007215261.1|  hypothetical protein PRUPE_ppa004545mg             188   3e-52   Prunus persica
ref|NP_175911.1|  DEAD-box ATP-dependent RNA helicase 20                188   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009367550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_010106662.1|  DEAD-box ATP-dependent RNA helicase 20             188   3e-52   
gb|EEE54050.1|  hypothetical protein OsJ_00740                          187   3e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   4e-52   Oryza brachyantha
gb|EEC70110.1|  hypothetical protein OsI_00766                          187   4e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_006646592.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   4e-52   
gb|AFK42127.1|  unknown                                                 188   4e-52   Medicago truncatula
gb|AAG51573.1|AC027034_19  RNA helicase, 5' partial; 101954-101280      178   4e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KJB56888.1|  hypothetical protein B456_009G140700                    188   4e-52   Gossypium raimondii
ref|XP_003597619.1|  DEAD-box ATP-dependent RNA helicase                188   4e-52   Medicago truncatula
ref|XP_010262146.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010262147.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010242202.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010262145.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008805786.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   6e-52   Phoenix dactylifera
sp|Q5QMN3.2|RH20_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    187   6e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971011.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   6e-52   Setaria italica
ref|XP_007024450.1|  DEA(D/H)-box RNA helicase family protein           187   7e-52   
ref|XP_004297601.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   7e-52   Fragaria vesca subsp. vesca
ref|XP_004968529.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   7e-52   
ref|XP_002279117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   9e-52   Vitis vinifera
ref|XP_008805785.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   9e-52   Phoenix dactylifera
ref|XP_009380443.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   9e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004971010.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   1e-51   
ref|XP_002891814.1|  hypothetical protein ARALYDRAFT_474570             187   1e-51   
ref|XP_002458964.1|  hypothetical protein SORBIDRAFT_03g043450          188   1e-51   Sorghum bicolor [broomcorn]
ref|NP_001142117.1|  uncharacterized protein LOC100274281               186   2e-51   Zea mays [maize]
emb|CDO97919.1|  unnamed protein product                                186   2e-51   Coffea canephora [robusta coffee]
ref|XP_010314157.1|  PREDICTED: ethylene-responsive RNA helicase ...    186   2e-51   
ref|XP_009625322.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   3e-51   Nicotiana tomentosiformis
ref|XP_003564892.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   3e-51   Brachypodium distachyon [annual false brome]
emb|CDY02459.1|  BnaA08g00660D                                          186   3e-51   
ref|XP_009106904.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   3e-51   Brassica rapa
ref|XP_006366150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   3e-51   Solanum tuberosum [potatoes]
ref|XP_011072507.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   4e-51   Sesamum indicum [beniseed]
emb|CDY10596.1|  BnaC03g70180D                                          185   4e-51   Brassica napus [oilseed rape]
emb|CDM81540.1|  unnamed protein product                                185   5e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    185   6e-51   Brachypodium distachyon [annual false brome]
ref|XP_010534903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   6e-51   Tarenaya hassleriana [spider flower]
gb|KFK38698.1|  hypothetical protein AALP_AA3G148400                    184   8e-51   Arabis alpina [alpine rockcress]
gb|EMS66298.1|  DEAD-box ATP-dependent RNA helicase 30                  186   8e-51   Triticum urartu
emb|CDM85602.1|  unnamed protein product                                186   9e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010915213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   9e-51   Elaeis guineensis
ref|XP_001763089.1|  predicted protein                                  184   1e-50   
ref|XP_010534902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_006306418.1|  hypothetical protein CARUB_v10012355mg             184   1e-50   Capsella rubella
dbj|BAD82427.1|  putative DEAD box RNA helicase                         184   2e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009802114.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   3e-50   Nicotiana sylvestris
sp|Q5N7W4.2|RH30_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    185   4e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EYU21378.1|  hypothetical protein MIMGU_mgv1a004869mg                182   7e-50   Erythranthe guttata [common monkey flower]
gb|EMS55994.1|  DEAD-box ATP-dependent RNA helicase 20                  181   2e-49   Triticum urartu
gb|EMT09661.1|  DEAD-box ATP-dependent RNA helicase 20                  179   3e-49   
dbj|BAD73320.1|  putative ethylene-responsive RNA helicase              181   3e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005850349.1|  hypothetical protein CHLNCDRAFT_30080              181   3e-49   Chlorella variabilis
ref|NP_001234650.1|  ethylene-responsive RNA helicase                   177   4e-48   
ref|XP_002455005.1|  hypothetical protein SORBIDRAFT_03g002860          175   3e-47   
ref|XP_002987999.1|  hypothetical protein SELMODRAFT_269342             175   3e-47   
ref|XP_002972931.1|  hypothetical protein SELMODRAFT_98552              175   4e-47   
emb|CDI80731.1|  hypothetical protein, conserved                        166   1e-46   Eimeria acervulina
ref|XP_002776976.1|  helicase, putative                                 163   9e-46   Perkinsus marinus ATCC 50983
gb|KFG62415.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17               161   5e-45   Toxoplasma gondii RUB
ref|XP_002780686.1|  DEAD box ATP-dependent RNA helicase, putative      160   8e-45   Perkinsus marinus ATCC 50983
ref|XP_005650016.1|  DEAD-box RNA helicase                              167   1e-44   Coccomyxa subellipsoidea C-169
emb|CCF73942.1|  unnamed protein product                                168   1e-44   Babesia microti strain RI
emb|CAA09215.1|  RNA helicase                                           160   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_764197.1|  RNA helicase                                          166   2e-43   Theileria parva strain Muguga
ref|XP_004831007.1|  DEAD box ATP-dependent RNA helicase family m...    164   3e-43   Theileria equi strain WA
ref|XP_009692285.1|  DEAD-box family RNA-dependent helicase             165   3e-43   Theileria orientalis strain Shintoku
ref|XP_953213.1|  DEAD-box family RNA-dependent helicase                164   5e-43   Theileria annulata
ref|XP_001690022.1|  DEAD-box RNA helicase                              162   1e-42   Chlamydomonas reinhardtii
ref|XP_002777393.1|  RNA helicase, putative                             162   1e-42   Perkinsus marinus ATCC 50983
ref|XP_002777392.1|  RNA helicase, putative                             162   1e-42   Perkinsus marinus ATCC 50983
dbj|BAN64363.1|  p68-like protein                                       157   4e-42   Babesia bovis
ref|XP_004349647.1|  ATPdependent RNA helicase dbp2, putative           162   4e-42   Acanthamoeba castellanii str. Neff
ref|XP_002774608.1|  RNA helicase, putative                             161   5e-42   Perkinsus marinus ATCC 50983
ref|XP_003884670.1|  hypothetical protein NCLIV_050680                  161   6e-42   Neospora caninum Liverpool
gb|KIZ00407.1|  ATP-dependent RNA helicase DDX5/DBP2                    160   1e-41   Monoraphidium neglectum
ref|XP_008885470.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17          160   1e-41   
gb|EPR60274.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17               160   1e-41   Toxoplasma gondii GT1
ref|XP_002369028.1|  DEAD/DEAH box helicase, putative                   160   1e-41   Toxoplasma gondii ME49
ref|XP_002771918.1|  RNA helicase, putative                             160   1e-41   Perkinsus marinus ATCC 50983
gb|KHN25107.1|  DEAD-box ATP-dependent RNA helicase 20                  157   2e-41   Glycine soja [wild soybean]
emb|CDR95325.1|  p68-like protein, putative                             159   2e-41   Babesia bigemina
gb|KDP40781.1|  hypothetical protein JCGZ_24780                         156   3e-41   Jatropha curcas
emb|CDJ62108.1|  MGC53795 protein, related                              152   4e-41   Eimeria necatrix
ref|XP_002955411.1|  DEAD-box RNA helicase, ATP-dependent               158   5e-41   Volvox carteri f. nagariensis
ref|XP_736707.1|  helicase                                              149   7e-41   
ref|XP_744215.1|  helicase                                              150   8e-41   
ref|XP_003032253.1|  hypothetical protein SCHCODRAFT_82297              157   1e-40   Schizophyllum commune H4-8
gb|ETW56550.1|  hypothetical protein PFUGPA_01340                       150   1e-40   Plasmodium falciparum Palo Alto/Uganda
ref|XP_001609970.1|  p68-like protein                                   157   2e-40   Babesia bovis T2Bo
ref|XP_006521353.1|  PREDICTED: probable ATP-dependent RNA helica...    154   3e-40   Mus musculus [mouse]
ref|XP_678450.1|  helicase                                              148   4e-40   
ref|XP_729738.1|  hypothetical protein                                  148   7e-40   
gb|KJA13443.1|  hypothetical protein HYPSUDRAFT_73013                   154   8e-40   Hypholoma sublateritium FD-334 SS-4
gb|EGN99017.1|  hypothetical protein SERLA73DRAFT_137127                151   1e-39   Serpula lacrymans var. lacrymans S7.3
ref|XP_006958620.1|  p68 RNA helicase                                   154   1e-39   Wallemia mellicola CBS 633.66
gb|KIM84767.1|  hypothetical protein PILCRDRAFT_96565                   154   1e-39   Piloderma croceum F 1598
emb|CCM04686.1|  predicted protein                                      155   2e-39   Fibroporia radiculosa
ref|XP_006459201.1|  hypothetical protein AGABI2DRAFT_65810             153   2e-39   Agaricus bisporus var. bisporus H97
ref|XP_007330446.1|  hypothetical protein AGABI1DRAFT_100622            153   2e-39   Agaricus bisporus var. burnettii JB137-S8
gb|KDQ24573.1|  hypothetical protein PLEOSDRAFT_1090372                 153   2e-39   Pleurotus ostreatus PC15
gb|KIK57769.1|  hypothetical protein GYMLUDRAFT_45959                   153   3e-39   Gymnopus luxurians FD-317 M1
ref|XP_002140793.1|  DEAD/DEAH box helicase family protein              154   3e-39   Cryptosporidium muris RN66
ref|XP_008039863.1|  DEAD-domain-containing protein                     153   3e-39   Trametes versicolor FP-101664 SS1
ref|XP_007414813.1|  hypothetical protein MELLADRAFT_78893              153   3e-39   Melampsora larici-populina 98AG31
ref|XP_007008272.1|  hypothetical protein TREMEDRAFT_46029              153   3e-39   Tremella mesenterica DSM 1558
ref|XP_007370735.1|  DEAD-domain-containing protein                     152   4e-39   Dichomitus squalens LYAD-421 SS1
gb|EXX56938.1|  Dbp2p                                                   153   4e-39   Rhizophagus irregularis DAOM 197198w
gb|KIM24458.1|  hypothetical protein M408DRAFT_75932                    152   4e-39   Serendipita vermifera MAFF 305830
gb|KIM40445.1|  hypothetical protein M413DRAFT_73199                    152   5e-39   Hebeloma cylindrosporum h7
gb|KGB75854.1|  ATP-dependent RNA helicase DBP2-A                       153   5e-39   Cryptococcus gattii VGII R265
gb|EDM15798.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...    152   5e-39   Rattus norvegicus [brown rat]
gb|KIR99876.1|  ATP-dependent RNA helicase DBP2-A                       153   5e-39   Cryptococcus gattii VGII 2001/935-1
gb|EMS23120.1|  ATP-dependent rna helicase dbp2                         153   5e-39   Rhodotorula toruloides NP11
gb|KIR72047.1|  ATP-dependent RNA helicase DBP2-A                       153   5e-39   Cryptococcus gattii VGII CA1014
gb|KFP69316.1|  putative ATP-dependent RNA helicase DDX17               151   5e-39   Acanthisitta chloris
ref|NP_001082679.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17             153   6e-39   Xenopus laevis [clawed frog]
gb|KII89609.1|  hypothetical protein PLICRDRAFT_158683                  152   7e-39   Plicaturopsis crispa FD-325 SS-3
dbj|BAE87553.1|  unnamed protein product                                150   7e-39   Macaca fascicularis [crab eating macaque]
gb|EAW60248.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...    152   7e-39   Homo sapiens [man]
ref|XP_009436590.1|  PREDICTED: probable ATP-dependent RNA helica...    152   7e-39   
ref|XP_009073300.1|  PREDICTED: probable ATP-dependent RNA helica...    152   7e-39   Acanthisitta chloris
ref|XP_004563118.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   
ref|XP_004610567.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   Sorex araneus [Eurasian shrew]
ref|XP_004700310.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010565532.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   Haliaeetus leucocephalus
ref|XP_009880187.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   Charadrius vociferus
ref|XP_004311417.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   
ref|XP_006174954.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   
ref|XP_008067650.1|  PREDICTED: probable ATP-dependent RNA helica...    152   8e-39   Carlito syrichta
ref|XP_003745440.1|  PREDICTED: probable ATP-dependent RNA helica...    152   9e-39   Galendromus occidentalis
gb|EOB03912.1|  Putative ATP-dependent RNA helicase DDX17               152   9e-39   Anas platyrhynchos [duck]
ref|XP_009336746.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    143   9e-39   Pyrus x bretschneideri [bai li]
gb|KIK28896.1|  hypothetical protein PISMIDRAFT_90259                   151   1e-38   Pisolithus microcarpus 441
ref|XP_009566745.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Cuculus canorus
gb|ETE72827.1|  putative ATP-dependent RNA helicase DDX17               152   1e-38   Ophiophagus hannah
ref|XP_002769661.1|  RNA-dependent helicase, putative                   148   1e-38   Perkinsus marinus ATCC 50983
ref|XP_004563116.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_009481222.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Pelecanus crispus
ref|XP_010341891.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Saimiri boliviensis boliviensis
ref|XP_008634834.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_010145760.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Eurypyga helias
ref|XP_009805513.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Gavia stellata
ref|XP_009951301.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Leptosomus discolor
ref|XP_009584901.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Fulmarus glacialis
ref|XP_004563117.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_005737995.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
emb|CEJ03535.1|  Putative ATP-dependent RNA helicase dbp2 (Fragment)    144   1e-38   Rhizopus microsporus
ref|XP_010710490.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_005514775.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Columba livia [carrier pigeon]
ref|XP_005150407.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    152   1e-38   Melopsittacus undulatus
ref|XP_005488678.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_005488677.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Zonotrichia albicollis
ref|XP_008939400.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Merops nubicus
ref|XP_002195734.2|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Taeniopygia guttata
ref|XP_010013794.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Nestor notabilis
ref|XP_005940780.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Haplochromis burtoni
ref|XP_010132422.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Buceros rhinoceros silvestris
ref|XP_008565102.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Galeopterus variegatus [Malayan flying lemur]
ref|XP_416260.2|  PREDICTED: probable ATP-dependent RNA helicase ...    152   1e-38   Gallus gallus [bantam]
ref|XP_008565101.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Galeopterus variegatus [Malayan flying lemur]
ref|XP_009330949.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Pygoscelis adeliae
ref|XP_010185205.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Mesitornis unicolor
ref|XP_010126497.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Chlamydotis macqueenii
ref|XP_005354345.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Microtus ochrogaster [prairie voles]
ref|XP_005527672.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFO61287.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   Corvus brachyrhynchos
ref|XP_010288347.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Phaethon lepturus
ref|XP_005446839.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_006029913.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Alligator sinensis
ref|XP_008494759.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   Calypte anna
ref|XP_008142844.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_006865247.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|EJU04549.1|  DEAD-domain-containing protein                          151   1e-38   
gb|EMC76814.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|XP_005232953.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_008142845.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_006865246.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_006259008.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_010168247.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_009972429.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFQ42674.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
gb|KFQ18808.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|XP_010208864.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    152   1e-38   
ref|XP_006752810.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KIL67445.1|  hypothetical protein M378DRAFT_159266                   151   1e-38   
ref|XP_010225318.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_005737994.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFO81715.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|XP_010408888.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_005302557.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_010307626.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_004650369.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFW90864.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|XP_004650368.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KGL73587.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
gb|KFV68880.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|XP_009863069.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_009933308.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFZ49707.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|NP_001035277.1|  probable ATP-dependent RNA helicase DDX17 is...    152   1e-38   
ref|XP_003964460.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFP74117.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|XP_009085184.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_009502718.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|NP_951062.1|  probable ATP-dependent RNA helicase DDX17 isofo...    152   1e-38   
ref|XP_007939858.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_005040018.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_008929884.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_005567355.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFP10244.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
gb|KFZ60114.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|XP_005883260.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_007939857.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_005567354.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_003264799.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_006890184.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_009924066.1|  PREDICTED: probable ATP-dependent RNA helica...    151   1e-38   
ref|XP_005883259.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_006890183.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_004373916.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_009979992.1|  PREDICTED: probable ATP-dependent RNA helica...    151   1e-38   
ref|XP_007622847.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_007189120.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_006979214.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_007622846.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFO06156.1|  putative ATP-dependent RNA helicase DDX17               150   1e-38   
ref|XP_007189119.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
ref|XP_006979213.1|  PREDICTED: probable ATP-dependent RNA helica...    152   1e-38   
gb|KFO95968.1|  putative ATP-dependent RNA helicase DDX17               151   1e-38   
ref|XP_010004139.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_011476809.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_004675717.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_007441609.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_009646040.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_004675716.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_008255265.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
gb|KFQ23731.1|  putative ATP-dependent RNA helicase DDX17               150   2e-38   
ref|XP_007318616.1|  hypothetical protein SERLADRAFT_449372             151   2e-38   
gb|KFV75709.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
gb|KFP53210.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
ref|XP_007099364.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    152   2e-38   
ref|XP_003514725.2|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_008849476.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_003227208.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_007652929.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_006155420.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_009473564.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    152   2e-38   
ref|XP_010085938.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_008849475.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
gb|KFV00645.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
ref|XP_009900873.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_006155419.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_001092491.2|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_006102491.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_007910174.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_007519377.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_006914795.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_004883536.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_003821639.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
gb|KFP59950.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
gb|KFQ80585.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
ref|XP_007519378.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_008977411.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_004883535.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_004410825.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_005379316.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_005322311.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_003470541.2|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|NP_001095463.1|  probable ATP-dependent RNA helicase DDX17          152   2e-38   
ref|XP_005994328.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_008977406.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
gb|KGL90702.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
gb|KFQ57153.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
gb|AAP88874.1|  DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17, ...    152   2e-38   
ref|XP_010871155.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_003126098.2|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_005379315.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_005322310.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_005003904.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_004485165.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    152   2e-38   
ref|XP_003783252.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
gb|KFM02164.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
ref|XP_005994327.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_007111784.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
gb|KFV60123.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
gb|KFP37484.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
gb|KFR08900.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
ref|XP_006071393.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_004279534.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_007503261.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_004589558.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_006071392.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_005016061.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
gb|KFQ77919.1|  putative ATP-dependent RNA helicase DDX17               151   2e-38   
ref|NP_001016781.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17             151   2e-38   
ref|XP_004589559.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_008067649.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_008067648.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
gb|KFR10998.1|  putative ATP-dependent RNA helicase DDX17               150   2e-38   
ref|XP_008849477.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_001880766.1|  predicted protein                                  150   2e-38   
gb|KFO88513.1|  putative ATP-dependent RNA helicase DDX17               150   2e-38   
ref|XP_004224073.1|  helicase                                           150   2e-38   
ref|XP_010597633.1|  PREDICTED: probable ATP-dependent RNA helica...    150   2e-38   
ref|XP_005681228.1|  PREDICTED: probable ATP-dependent RNA helica...    152   2e-38   
ref|XP_005606692.1|  PREDICTED: probable ATP-dependent RNA helica...    150   2e-38   
ref|XP_774668.1|  hypothetical protein CNBF3470                         150   3e-38   
gb|AAD38874.1|AF110007_1  p68 RNA helicase                              151   3e-38   
ref|XP_571268.1|  p68-like protein                                      150   3e-38   
ref|NP_006377.2|  probable ATP-dependent RNA helicase DDX17 isofo...    152   3e-38   
ref|XP_774667.1|  hypothetical protein CNBF3470                         150   3e-38   
ref|XP_006675622.1|  hypothetical protein BATDEDRAFT_29115              150   3e-38   
gb|ELR53727.1|  Putative ATP-dependent RNA helicase DDX17               152   3e-38   
ref|NP_001091974.1|  probable ATP-dependent RNA helicase DDX17 is...    152   3e-38   
ref|XP_003771058.1|  PREDICTED: probable ATP-dependent RNA helica...    152   3e-38   
ref|XP_009288378.1|  PREDICTED: probable ATP-dependent RNA helica...    152   3e-38   
ref|XP_571269.1|  p68-like protein                                      150   3e-38   
gb|AFR96168.2|  ATP-dependent RNA helicase DBP2-A                       150   3e-38   
ref|XP_008509242.1|  PREDICTED: probable ATP-dependent RNA helica...    151   3e-38   
gb|EHH65839.1|  hypothetical protein EGM_02689                          152   3e-38   
dbj|BAD92832.1|  DEAD box polypeptide 17 isoform p82 variant            152   3e-38   
ref|XP_008509240.1|  PREDICTED: probable ATP-dependent RNA helica...    151   3e-38   
gb|KIJ66791.1|  hypothetical protein HYDPIDRAFT_180508                  150   3e-38   
ref|XP_003194936.1|  ATP-dependent RNA helicase DBP2 (p68-like pr...    150   3e-38   
gb|KIR86321.1|  ATP-dependent RNA helicase DBP2-A                       150   3e-38   
emb|CAF95263.1|  unnamed protein product                                150   3e-38   
gb|KIR63992.1|  ATP-dependent RNA helicase DBP2-A                       150   3e-38   
gb|KIR45452.1|  ATP-dependent RNA helicase DBP2-A                       150   3e-38   
ref|XP_003321253.2|  hypothetical protein PGTG_02295                    150   3e-38   
ref|XP_006119019.1|  PREDICTED: probable ATP-dependent RNA helica...    152   3e-38   
ref|XP_007069155.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    152   3e-38   
ref|XP_002914626.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    152   3e-38   
ref|XP_004007674.1|  PREDICTED: probable ATP-dependent RNA helica...    152   3e-38   
ref|XP_004743517.1|  PREDICTED: probable ATP-dependent RNA helica...    152   3e-38   
gb|EUC64866.1|  ATP-dependent RNA helicase DBP2                         150   4e-38   
gb|KIY52138.1|  DEAD-domain-containing protein                          150   4e-38   
ref|XP_008294587.1|  PREDICTED: probable ATP-dependent RNA helica...    150   4e-38   
ref|XP_001615932.1|  helicase                                           150   4e-38   
ref|XP_668411.1|  RNA-dependent helicase                                149   4e-38   
ref|XP_010746314.1|  PREDICTED: probable ATP-dependent RNA helica...    150   4e-38   
ref|XP_006798015.1|  PREDICTED: probable ATP-dependent RNA helica...    150   4e-38   
ref|XP_860668.3|  PREDICTED: probable ATP-dependent RNA helicase ...    152   5e-38   
ref|XP_010225455.1|  PREDICTED: probable ATP-dependent RNA helica...    142   5e-38   
gb|AAI34864.1|  LOC556764 protein                                       150   5e-38   
gb|AAI17661.1|  LOC556764 protein                                       150   5e-38   
ref|XP_010895018.1|  PREDICTED: probable ATP-dependent RNA helica...    150   5e-38   
ref|XP_006934164.2|  PREDICTED: probable ATP-dependent RNA helica...    152   5e-38   
ref|XP_009663625.1|  PREDICTED: probable ATP-dependent RNA helica...    151   5e-38   
ref|XP_010764560.1|  PREDICTED: probable ATP-dependent RNA helica...    150   5e-38   
gb|AAI54494.1|  LOC556764 protein                                       150   5e-38   
gb|AAD38876.1|AF110008_1  p68 RNA helicase                              150   5e-38   
ref|XP_003428757.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    152   6e-38   
gb|EMD33314.1|  hypothetical protein CERSUDRAFT_117934                  149   6e-38   
gb|KIY68841.1|  DEAD-domain-containing protein                          149   6e-38   
gb|EMP27021.1|  Putative ATP-dependent RNA helicase DDX17               152   7e-38   
gb|KDE07270.1|  ATP-dependent RNA helicase                              149   7e-38   
ref|XP_002260414.1|  helicase                                           149   7e-38   
ref|XP_007867458.1|  DEAD-domain-containing protein                     149   7e-38   
ref|NP_001267194.1|  probable ATP-dependent RNA helicase DDX17          150   7e-38   
ref|XP_010895017.1|  PREDICTED: probable ATP-dependent RNA helica...    150   8e-38   
ref|XP_006790684.1|  PREDICTED: probable ATP-dependent RNA helica...    149   8e-38   
gb|KGK38084.1|  hypothetical protein JL09_g2718                         147   8e-38   
emb|CCA74151.1|  probable RNA helicase dbp2 (DEAD box protein)          149   8e-38   
ref|XP_008814168.1|  hypothetical protein C922_00329                    149   8e-38   
ref|XP_007231410.1|  PREDICTED: probable ATP-dependent RNA helica...    150   8e-38   
ref|XP_005421988.1|  PREDICTED: probable ATP-dependent RNA helica...    151   8e-38   
ref|XP_005797285.1|  PREDICTED: probable ATP-dependent RNA helica...    150   9e-38   
ref|XP_004787459.1|  PREDICTED: probable ATP-dependent RNA helica...    152   9e-38   
gb|EPS96727.1|  hypothetical protein FOMPIDRAFT_1025306                 149   9e-38   
ref|XP_003321244.1|  hypothetical protein PGTG_02286                    149   9e-38   
ref|XP_008407161.1|  PREDICTED: probable ATP-dependent RNA helica...    150   9e-38   
ref|XP_008278145.1|  PREDICTED: probable ATP-dependent RNA helica...    149   1e-37   
ref|XP_007543657.1|  PREDICTED: probable ATP-dependent RNA helica...    150   1e-37   
ref|XP_001923830.1|  PREDICTED: probable ATP-dependent RNA helica...    150   1e-37   
dbj|GAA97124.1|  hypothetical protein E5Q_03800                         149   1e-37   
ref|XP_005925008.1|  PREDICTED: probable ATP-dependent RNA helica...    149   1e-37   
ref|XP_005468481.1|  PREDICTED: probable ATP-dependent RNA helica...    149   1e-37   
ref|XP_005735867.1|  PREDICTED: probable ATP-dependent RNA helica...    149   1e-37   
ref|XP_003453852.1|  PREDICTED: probable ATP-dependent RNA helica...    149   1e-37   
ref|XP_004538967.1|  PREDICTED: probable ATP-dependent RNA helica...    149   1e-37   
ref|XP_007393238.1|  hypothetical protein PHACADRAFT_251816             149   1e-37   
gb|KFO36677.1|  Putative ATP-dependent RNA helicase DDX17               152   1e-37   
emb|CDR15320.1|  helicase, putative                                     149   1e-37   
ref|XP_003443250.1|  PREDICTED: probable ATP-dependent RNA helica...    149   1e-37   
ref|XP_001348611.2|  helicase, putative                                 149   1e-37   
gb|ETW58420.1|  hypothetical protein PFMC_05521                         149   1e-37   
emb|CDO66924.1|  DEAD/DEAH box ATP-dependent RNA helicase, putative     149   1e-37   
ref|XP_001388195.1|  hypothetical protein                               149   1e-37   
ref|XP_009545234.1|  hypothetical protein HETIRDRAFT_439534             149   1e-37   
ref|XP_003972587.1|  PREDICTED: probable ATP-dependent RNA helica...    149   2e-37   
ref|XP_008315636.1|  PREDICTED: probable ATP-dependent RNA helica...    149   2e-37   



>ref|XP_011071940.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Sesamum indicum]
Length=600

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GS+I IFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL+EFK+GRSP+MIA
Sbjct  421  VMDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLAEFKTGRSPIMIA  480

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAF+FFTHGNAK+AR+L+
Sbjct  481  TDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTAFSFFTHGNAKYARDLI  540

Query  424  KILQQAGQIVPPQLSALA  371
            KILQQAGQ+VPPQL+ALA
Sbjct  541  KILQQAGQVVPPQLAALA  558



>ref|XP_004236255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Solanum lycopersicum]
Length=651

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL++FKSGRSP+MIA
Sbjct  472  VMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLADFKSGRSPIMIA  531

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAKF REL+
Sbjct  532  TDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKFTRELI  591

Query  424  KILQQAGQIVPPQLSALA  371
            KILQQAGQIVPPQLSALA
Sbjct  592  KILQQAGQIVPPQLSALA  609



>ref|XP_011071939.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Sesamum indicum]
Length=626

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GS+I IFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL+EFK+GRSP+MIA
Sbjct  447  VMDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLAEFKTGRSPIMIA  506

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAF+FFTHGNAK+AR+L+
Sbjct  507  TDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTAFSFFTHGNAKYARDLI  566

Query  424  KILQQAGQIVPPQLSALA  371
            KILQQAGQ+VPPQL+ALA
Sbjct  567  KILQQAGQVVPPQLAALA  584



>ref|XP_006344459.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Solanum tuberosum]
Length=648

 Score =   220 bits (560),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL++FK+GRSP+MIA
Sbjct  470  VMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLADFKTGRSPIMIA  529

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTA+TFFTH NAKF REL+
Sbjct  530  TDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAYTFFTHANAKFTRELI  589

Query  424  KILQQAGQIVPPQLSALA  371
            KILQQAGQIVPPQLSALA
Sbjct  590  KILQQAGQIVPPQLSALA  607



>ref|XP_006439905.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53145.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=389

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 157/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EF+SGRSP+M A
Sbjct  210  VMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTA  269

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+
Sbjct  270  TDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLI  329

Query  424  KILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQIV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  330  KILQEAGQIVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  389



>ref|XP_009594348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=646

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL+EFK+GRSP+MIA
Sbjct  470  MMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLAEFKNGRSPIMIA  529

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAK+ R+L+
Sbjct  530  TDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKYTRQLI  589

Query  424  KILQQAGQIVPPQLSALA  371
            KILQQAGQIVPPQLSALA
Sbjct  590  KILQQAGQIVPPQLSALA  607



>ref|XP_009769444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=646

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL+EFK+GRSP+MIA
Sbjct  470  MMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLAEFKNGRSPIMIA  529

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAK+ R+L+
Sbjct  530  TDVAARGLDVKDIKCVVNYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKYTRQLI  589

Query  424  KILQQAGQIVPPQLSALA  371
            KILQQAGQIVPPQLSALA
Sbjct  590  KILQQAGQIVPPQLSALA  607



>gb|KDO69502.1| hypothetical protein CISIN_1g013176mg [Citrus sinensis]
Length=448

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 157/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EF+SGRSP+M A
Sbjct  269  VMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTA  328

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+
Sbjct  329  TDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLI  388

Query  424  KILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQIV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  389  KILQEAGQIVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  448



>emb|CDP12744.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL++FKSGR+P+MIA
Sbjct  448  VMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLADFKSGRNPIMIA  507

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAFTFFTH NAKFAR+L+
Sbjct  508  TDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGATGTAFTFFTHANAKFARDLI  567

Query  424  KILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KIL+ AGQI+PP LSA+A     S+ G N       G      ISGSNT+PLGAK+ W
Sbjct  568  KILRDAGQIIPPDLSAMAR-STGSTMGGNNFRSRGRGGFGNRGISGSNTIPLGAKKPW  624



>ref|XP_006439909.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53149.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=599

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 157/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EF+SGRSP+M A
Sbjct  420  VMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTA  479

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+
Sbjct  480  TDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLI  539

Query  424  KILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQIV P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  540  KILQEAGQIVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  599



>ref|XP_006476870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Citrus sinensis]
Length=599

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 157/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EF+SGRSP+M A
Sbjct  420  VMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFRSGRSPIMTA  479

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+
Sbjct  480  TDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLI  539

Query  424  KILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQIV P LS LA      F   G NFRSRGRGGFG R SISGSNT+PLG+KR W
Sbjct  540  KILQEAGQIVSPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSISGSNTIPLGSKRLW  599



>ref|XP_007155472.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27466.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=603

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSR+ IF+ETKKGCDQ+TRQ+RMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  421  VMDGSRVLIFMETKKGCDQVTRQMRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  480

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTHGNAKFAR+L+
Sbjct  481  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHGNAKFARDLI  540

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ AGQ+V P LSAL
Sbjct  541  KILQDAGQVVSPALSAL  557



>gb|AFW97645.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
 gb|AHZ57094.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=595

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+M A
Sbjct  409  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLSEFKSGRSPIMTA  468

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+
Sbjct  469  TDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELI  528

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  529  KILQEAGQVVPPTLSAL  545



>ref|XP_009112063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Brassica rapa]
Length=591

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+M A
Sbjct  408  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQTERDRVLSEFKSGRSPIMTA  467

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+
Sbjct  468  TDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELI  527

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  528  KILQEAGQVVPPTLSAL  544



>emb|CDY16735.1| BnaA09g06470D [Brassica napus]
Length=591

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+M A
Sbjct  409  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQTERDRVLSEFKSGRSPIMTA  468

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+
Sbjct  469  TDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELI  528

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  529  KILQEAGQVVPPTLSAL  545



>emb|CDY48128.1| BnaCnng15700D [Brassica napus]
Length=594

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+M A
Sbjct  411  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQTERDRVLSEFKSGRSPIMTA  470

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+
Sbjct  471  TDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELI  530

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  531  KILQEAGQVVPPTLSAL  547



>gb|KHN34349.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQ+R+DGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  335  VMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  394

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+
Sbjct  395  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLI  454

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ AGQ+V P LSAL
Sbjct  455  KILQDAGQVVSPALSAL  471



>ref|XP_006394312.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
 gb|ESQ31598.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
Length=596

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VLSEFKSGRSP+M A
Sbjct  413  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQAERDRVLSEFKSGRSPIMTA  472

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+
Sbjct  473  TDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELI  532

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  533  KILQEAGQVVPPTLSAL  549



>ref|XP_010663104.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
Length=718

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQ+RMDGWP+LSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  538  VMDGSRILIFMETKKGCDQVTRQMRMDGWPSLSIHGDKNQAERDWVLAEFKSGRSPIMTA  597

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA TFFTH NAKFAR+L+
Sbjct  598  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAITFFTHSNAKFARDLI  657

Query  424  KILQQAGQIVPPQLSALA---CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRH  254
            KILQ+AGQ+V P LSA+A         SGGN       G FGNRG ISGSNT+PLGA+R 
Sbjct  658  KILQEAGQVVSPALSAMARSSGSAFGGSGGNFRSRGRGGSFGNRGLISGSNTIPLGARRP  717

Query  253  W  251
            W
Sbjct  718  W  718



>ref|XP_008239580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Prunus mume]
Length=609

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  775  GSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDV  596
            GSRI IFVETKKGCDQ+T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+M ATDV
Sbjct  435  GSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPIMTATDV  494

Query  595  AARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKIL  416
            AARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAREL+KIL
Sbjct  495  AARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARELIKIL  554

Query  415  QQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            Q+AGQ+V P L+A++   G   G          G G    ISGSNTVP+G KR W
Sbjct  555  QEAGQVVSPALAAMSRSSGSFGGSGGNFRNRGRGGGFGNRISGSNTVPIGYKRPW  609



>gb|KDP31038.1| hypothetical protein JCGZ_11414 [Jatropha curcas]
Length=627

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GS+I IF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVLSEFK GRSP+M A
Sbjct  449  VMDGSKILIFMETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLSEFKCGRSPIMTA  508

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDY+HRIGRTGRAGA+GTA TFFTH NAKFAR+L+
Sbjct  509  TDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAGARGTAITFFTHANAKFARDLI  568

Query  424  KILQQAGQIVPPQLSALA-CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+A QI+PP LSA+A   G     G NFRSRGRGGFGNR  ISGSNT+PLG++R W
Sbjct  569  KILQEARQILPPTLSAMARSAGTHGGSGGNFRSRGRGGFGNRSLISGSNTIPLGSRRPW  627



>gb|KHN18420.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQ+R+DGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  335  VMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  394

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+
Sbjct  395  TDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLI  454

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ AGQ V P L+AL
Sbjct  455  KILQDAGQTVSPALTAL  471



>ref|XP_007210287.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
 gb|EMJ11486.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
Length=638

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  775  GSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDV  596
            GSRI IFVETKKGCDQ+T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+M ATDV
Sbjct  464  GSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPIMTATDV  523

Query  595  AARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKIL  416
            AARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAREL+KIL
Sbjct  524  AARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARELIKIL  583

Query  415  QQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            Q+AGQ+V P L+A++   G   G          G G    ISGSNTVP+G KR W
Sbjct  584  QEAGQVVSPALAAMSRSSGSFGGSGGNFRNRGRGGGFGNRISGSNTVPIGYKRPW  638



>ref|XP_010678860.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=643

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+ S+I IFVETKKGCDQ+TRQLR+DGWPAL+IHG+K+Q ER WVLSEFKSGRSP+MIA
Sbjct  468  IMDRSKILIFVETKKGCDQVTRQLRVDGWPALAIHGDKDQSERDWVLSEFKSGRSPIMIA  527

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGAKGTA+TFFTH NAKF REL+
Sbjct  528  TDVAARGLDVKDIKCVINYDFPTSLEDYIHRIGRTGRAGAKGTAYTFFTHSNAKFTRELI  587

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ++PP LSA+A
Sbjct  588  KILREAGQMIPPALSAMA  605



>ref|XP_002322195.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
 gb|EEF06322.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
Length=609

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 156/178 (88%), Gaps = 2/178 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQLRMDGW ALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  434  VMDGSRILIFMETKKGCDQVTRQLRMDGWAALSIHGDKNQAERDWVLAEFKSGRSPIMTA  493

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA+GTA TFFT  NAKFAR+L+
Sbjct  494  TDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGARGTALTFFTESNAKFARDLI  553

Query  424  KILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQIVPP LSA+       S G NFRSRGRGGFGNRG ISGSNTVPLGA R W
Sbjct  554  KILQEAGQIVPPSLSAMT--RSAGSFGGNFRSRGRGGFGNRGMISGSNTVPLGAGRPW  609



>ref|XP_006579582.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=605

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQ+R+DGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  423  VMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  482

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+
Sbjct  483  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLI  542

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ AGQ+V P LSAL
Sbjct  543  KILQDAGQVVSPALSAL  559



>ref|XP_002318665.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
 gb|EEE96885.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
Length=543

 Score =   204 bits (518),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSR+ IF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRS +M A
Sbjct  364  VMDGSRLLIFMETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSAIMTA  423

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTAFTFFT  NAKFAR L+
Sbjct  424  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTAFTFFTDSNAKFARGLI  483

Query  424  KILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            +ILQ++GQIVPP LSALA        S GN       G FGNRGSISGSNTVPLGA+R W
Sbjct  484  RILQESGQIVPPALSALARSSGSFGGSAGNFRSRGRGGSFGNRGSISGSNTVPLGARRPW  543



>ref|XP_010444189.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=591

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VL+EFKSGRSP+M A
Sbjct  407  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLAEFKSGRSPIMTA  466

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+
Sbjct  467  TDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELI  526

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  527  KILQEAGQVVPPTLSAL  543



>ref|XP_011047813.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Populus euphratica]
Length=625

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRS +M A
Sbjct  446  VMDGSRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSAIMTA  505

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTAFTFFT  NAKFAR L+
Sbjct  506  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTAFTFFTDSNAKFARGLI  565

Query  424  KILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            +ILQ++GQIVPP LSALA        S GN       G FGNRGSISGSNTVPLGA+R W
Sbjct  566  RILQESGQIVPPALSALARSSGSFGGSAGNFRSRGRGGSFGNRGSISGSNTVPLGARRPW  625



>ref|XP_010484038.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=594

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VL+EFKSGRSP+M A
Sbjct  409  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLAEFKSGRSPIMTA  468

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+
Sbjct  469  TDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELI  528

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  529  KILQEAGQVVPPTLSAL  545



>ref|XP_010459851.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Camelina sativa]
Length=598

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VL+EFKSGRSP+M A
Sbjct  413  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLAEFKSGRSPIMTA  472

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+
Sbjct  473  TDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELI  532

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  533  KILQEAGQVVPPTLSAL  549



>ref|XP_007036326.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY20827.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=626

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+G+RI IF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  447  VMDGNRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKNQSERDWVLAEFKSGRSPIMTA  506

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR+L+
Sbjct  507  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYARDLI  566

Query  424  KILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            K+LQ AGQ+V P LS LA      F     NFRSRGRGG+GNR SISGSNT+PLGA+R W
Sbjct  567  KLLQDAGQVVSPALSTLARSAASSFGGSRGNFRSRGRGGYGNRSSISGSNTIPLGARRPW  626



>ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=602

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQ+R+DGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  420  VMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  479

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+
Sbjct  480  TDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLI  539

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ AGQ V P L+AL
Sbjct  540  KILQDAGQTVSPALTAL  556



>ref|XP_006845267.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
 gb|ERN06942.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
Length=670

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF+ETKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVL+EFK+GRSP+M A
Sbjct  493  IMDGSRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLAEFKNGRSPIMTA  552

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT+ NA+FAREL+
Sbjct  553  TDVAARGLDVKDIKCVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTNANARFARELI  612

Query  424  KILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQ V PQL+AL    G    G         G+GNR  ISGSNT+P+G KR W
Sbjct  613  KILQEAGQAVSPQLAALGRSSGGGGSGGGNFRSRGRGYGNRSLISGSNTIPIGGKRPW  670



>ref|XP_011046220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Populus 
euphratica]
Length=612

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 152/178 (85%), Gaps = 2/178 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQLRMDGW ALSIHG+KNQ ER WVL+EFKSGRS +M A
Sbjct  437  VMDGSRILIFMETKKGCDQVTRQLRMDGWAALSIHGDKNQAERDWVLAEFKSGRSAIMTA  496

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTA TFFT  NAKFAR+L+
Sbjct  497  TDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTALTFFTESNAKFARDLI  556

Query  424  KILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQIVPP LSA+       S G NFRSRGRGGF NR  ISGSNTVPLGA R W
Sbjct  557  KILQEAGQIVPPSLSAMT--RSAGSFGGNFRSRGRGGFSNRRMISGSNTVPLGAGRPW  612



>dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=564

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VL+EFKSGRSP+M A
Sbjct  380  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPIMTA  439

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFARELV
Sbjct  440  TDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELV  499

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  500  KILQEAGQVVPPTLSAL  516



>gb|KEH31793.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=625

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  443  VMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  502

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGAKGTA++FFT  NAK+AR+L+
Sbjct  503  TDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGAKGTAYSFFTSANAKYARDLI  562

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ AGQIV P LSAL
Sbjct  563  KILQDAGQIVSPALSAL  579



>gb|KFK25761.1| hypothetical protein AALP_AA8G156100 [Arabis alpina]
Length=582

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  778  NGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  599
            +GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VLSEFKSGRSP+M ATD
Sbjct  403  DGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLSEFKSGRSPIMTATD  462

Query  598  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  419
            VAARGLDVKDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KI
Sbjct  463  VAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKI  522

Query  418  LQQAGQIVPPQLSAL  374
            LQ+AGQ+VPP LSAL
Sbjct  523  LQEAGQVVPPTLSAL  537



>ref|NP_974985.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 sp|Q8W4R3.2|RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis 
thaliana]
 dbj|BAE98724.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AED97706.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=591

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VL+EFKSGRSP+M A
Sbjct  407  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPIMTA  466

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFARELV
Sbjct  467  TDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELV  526

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  527  KILQEAGQVVPPTLSAL  543



>ref|XP_006280218.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13116.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=594

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+KNQ ER  VL+EFKSGRSP+M A
Sbjct  408  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKNQSERDRVLAEFKSGRSPIMTA  467

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+
Sbjct  468  TDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELI  527

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ VPP LSAL
Sbjct  528  KILQEAGQAVPPTLSAL  544



>gb|EYU22173.1| hypothetical protein MIMGU_mgv1a003417mg [Erythranthe guttata]
Length=586

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+GS+I IFVETKKGCDQ+TRQLRMDGWPALSIHG+K+QDER WVL++FKSGRSP+MIAT
Sbjct  411  MDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKSQDERDWVLADFKSGRSPIMIAT  470

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAFTFFTH N K A  L+K
Sbjct  471  DVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGATGTAFTFFTHANVKSAGHLIK  530

Query  421  ILQQAGQIVPPQLSALA  371
            ILQQA Q VPPQL+ALA
Sbjct  531  ILQQARQAVPPQLAALA  547



>ref|XP_004299135.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=606

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  775  GSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDV  596
            GSRI IFVETKKGCD +T+QLRMDGWPALSIHG+KNQ ER WVLSEFKSGRSP+M ATDV
Sbjct  435  GSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLSEFKSGRSPIMTATDV  494

Query  595  AARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKIL  416
            AARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFT  N KFAREL+KIL
Sbjct  495  AARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTESNGKFARELIKIL  554

Query  415  QQAGQIVPPQLSALA  371
            Q+AGQ+V P LSA+A
Sbjct  555  QEAGQVVSPALSAMA  569



>ref|XP_002866536.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42795.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VL+EFKSGRSP+M A
Sbjct  404  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQPERDRVLAEFKSGRSPIMTA  463

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+
Sbjct  464  TDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELI  523

Query  424  KILQQAGQIVPPQLSAL  374
            KILQ+AGQ+VPP LSAL
Sbjct  524  KILQEAGQVVPPTLSAL  540



>ref|XP_010251083.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Nelumbo 
nucifera]
Length=719

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSR+ IF+ETKKGCDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  538  MMDGSRVLIFLETKKGCDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  597

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+G AFTFFTH NA+FAR+L+
Sbjct  598  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGNAFTFFTHANARFARDLI  657

Query  424  KILQQAGQIVPPQLSALA  371
            KILQ  GQ+V P L+A+A
Sbjct  658  KILQDCGQVVNPALAAMA  675



>ref|XP_004515873.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Cicer arietinum]
Length=622

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF ETKKGCDQ+T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  439  VMDGSRILIFTETKKGCDQVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  498

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFP+ LEDYVHRIGRTGRAGAKGTA++FFT  NAKFAR+L+
Sbjct  499  TDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAGAKGTAYSFFTRANAKFARDLI  558

Query  424  KILQQAGQIVPPQLSALA  371
            KILQ AGQ+V P LS L+
Sbjct  559  KILQDAGQVVSPALSELS  576



>ref|XP_008365657.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Malus 
domestica]
Length=643

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M GSRI IFVETKKGCD +T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+M AT
Sbjct  465  MVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPIMTAT  524

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKF R+L+K
Sbjct  525  DVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAAGTALTFFTHANAKFTRDLIK  584

Query  421  ILQQAGQIVPPQLSALA  371
            ILQ+AGQ+V P L+A+A
Sbjct  585  ILQEAGQVVSPALAAMA  601



>ref|XP_010550696.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Tarenaya hassleriana]
Length=576

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETKKGCDQ+T+QLRMDGWPAL+IHG+K Q ER  VLSEFKSGRSP+M A
Sbjct  401  LMDGSKILIFVETKKGCDQVTKQLRMDGWPALAIHGDKTQSERDRVLSEFKSGRSPIMTA  460

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NA+FAREL+
Sbjct  461  TDVAARGLDVKDIKCVINYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNARFARELI  520

Query  424  KILQQAGQIVPPQLSAL  374
            KIL +AGQ+VPP LS L
Sbjct  521  KILHEAGQVVPPSLSDL  537



>ref|XP_010102487.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXB93551.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=625

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 151/180 (84%), Gaps = 2/180 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +++  +I IF+ETKK CDQ+TRQLRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  446  MVDSGKILIFIETKKACDQVTRQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  505

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTA TFFTH NAKFAREL+
Sbjct  506  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTALTFFTHANAKFARELI  565

Query  424  KILQQAGQIVPPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQ+V P LSAL           G +FRSRGRGGFGNR   SGSNTVPLG KR W
Sbjct  566  KILQEAGQVVTPALSALVRSAGSSGGGSGGSFRSRGRGGFGNRALKSGSNTVPLGNKRSW  625



>ref|XP_008807455.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Phoenix 
dactylifera]
Length=683

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF+ETKKGCDQ+TRQLRMDGWPALSIHG+K Q ER WVL+EFKSG+SP+M A
Sbjct  508  LMDGSRILIFLETKKGCDQVTRQLRMDGWPALSIHGDKAQAERDWVLAEFKSGKSPIMTA  567

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA TFFTH NA+FAR+L+
Sbjct  568  TDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTALTFFTHANARFARDLI  627

Query  424  KILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AG+ V P L+++A       G          G+GNR  ISGSNTVPLG +R W
Sbjct  628  KILQEAGKSVTPALASMA--RSAGGGSVGNFRSRGRGYGNRSLISGSNTVPLGGRRAW  683



>ref|XP_009345779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=612

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M GSRI IFVETKKGCD +T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+M AT
Sbjct  434  MVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPIMTAT  493

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDIK VINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR+L+K
Sbjct  494  DVAARGLDVKDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARDLIK  553

Query  421  ILQQAGQIVPPQLSALA  371
            ILQ+AGQ+V P L+A+A
Sbjct  554  ILQEAGQVVSPALAAMA  570



>emb|CAA09209.1| RNA helicase [Arabidopsis thaliana]
Length=187

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  27   IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  86

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL 
Sbjct  87   TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELT  146

Query  424  KILQQAGQIVPPQLSALA  371
             ILQ+AGQ V P+L+++ 
Sbjct  147  NILQEAGQKVSPELASMG  164



>ref|XP_009363040.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Pyrus 
x bretschneideri]
Length=611

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M GSRI IFVETKKGCD +T+QLRMDGWPALSIHG+KNQ ER WVL+EFKSGR+P+M AT
Sbjct  433  MVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLAEFKSGRNPIMTAT  492

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDIK VINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR+L+K
Sbjct  493  DVAARGLDVKDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARDLIK  552

Query  421  ILQQAGQIVPPQLSALA  371
            ILQ+AGQ+V P L+A+A
Sbjct  553  ILQEAGQVVSPALAAMA  569



>gb|KJB40103.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=623

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+G+RI IF+ETKKGCDQ+TR LRMDGWPALSIHG+KNQ ER WVL+EFKSGRSP+M A
Sbjct  443  LMDGNRILIFMETKKGCDQVTRHLRMDGWPALSIHGDKNQAERDWVLAEFKSGRSPIMTA  502

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR+L+
Sbjct  503  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYARDLI  562

Query  424  KILQQAGQIVPPQLSALA  371
            K+LQ AGQ+V P LS LA
Sbjct  563  KLLQDAGQVVSPALSTLA  580



>ref|XP_010932245.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Elaeis 
guineensis]
Length=701

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F+ETKKGCDQ+TRQLRMDGWPALSIHG+K Q ER WVL+EFKSG SP+M A
Sbjct  526  LMDGSRILVFLETKKGCDQVTRQLRMDGWPALSIHGDKAQAERDWVLAEFKSGNSPIMTA  585

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+NYDFPT LEDYVHRIGRTGRAGAKGTAFTFFTH NA+FAR+L+
Sbjct  586  TDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAGAKGTAFTFFTHANARFARDLI  645

Query  424  KILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ+AGQ V P L+++A       G          G+GNR  +SGSN+VPLG +R W
Sbjct  646  KILQEAGQSVTPALASMA--RSAGGGSGGNFRSRGRGYGNRALMSGSNSVPLGGRRPW  701



>ref|XP_009412685.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 146/178 (82%), Gaps = 4/178 (2%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IF+ETKKGCDQ+TRQLRMDGWPALSIHG+K Q ER WVL+EFKSGRSP+M A
Sbjct  522  VMDGSRILIFLETKKGCDQVTRQLRMDGWPALSIHGDKAQSERDWVLAEFKSGRSPIMTA  581

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCV+N+DFPT LEDYVHRIGRTGRAGAKGTAFTFFT  N +FARELV
Sbjct  582  TDVAARGLDVKDIKCVVNFDFPTSLEDYVHRIGRTGRAGAKGTAFTFFTQANIRFARELV  641

Query  424  KILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  251
            KILQ AGQ V P L+++A     S GG+    R RG      SISGSNT+PLG +R W
Sbjct  642  KILQDAGQNVSPALASMA----RSGGGSGGNFRSRGRGNGNRSISGSNTIPLGGRRPW  695



>gb|EPS60527.1| hypothetical protein M569_14276, partial [Genlisea aurea]
Length=230

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF++G+SP+M A
Sbjct  68   IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRAGKSPIMTA  127

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NAKFA+EL+
Sbjct  128  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANAKFAKELI  187

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L A+ 
Sbjct  188  NILREAGQKVSPELVAMG  205



>ref|XP_010027294.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Eucalyptus 
grandis]
 gb|KCW83292.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=624

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IFVETKKGCDQ+T+QLRMDGWPALSIHG+K+Q ER WVL+EFKSGRS +M A
Sbjct  439  VMDGSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKSQSEREWVLAEFKSGRSLIMTA  498

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTAFTFFT  N++FA EL+
Sbjct  499  TDVAARGLDVKDIKCVINYDFPMTLEDYVHRIGRTGRAGAKGTAFTFFTDSNSRFAGELL  558

Query  424  KILQQAGQIVPPQLSALA  371
            KILQ AGQ+VPP LS LA
Sbjct  559  KILQDAGQVVPPALSDLA  576



>ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
 ref|XP_004168110.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
Length=622

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IFVETKKGCD++TRQLRMDGWPALSIHG+K Q ER  VLSEFKSGR+P+M A
Sbjct  443  VMDGSRILIFVETKKGCDKVTRQLRMDGWPALSIHGDKKQAERDLVLSEFKSGRNPIMTA  502

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVIN+DFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR+L+
Sbjct  503  TDVAARGLDVKDIKCVINFDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHARDLI  562

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQIV P LSALA
Sbjct  563  KILREAGQIVTPALSALA  580



>ref|XP_008464517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Cucumis melo]
Length=622

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GSRI IFVETKKGCD++TRQLRMDGWPALSIHG+K Q ER  VLSEFKSGR+P+M A
Sbjct  443  VMDGSRILIFVETKKGCDKVTRQLRMDGWPALSIHGDKKQAERDLVLSEFKSGRNPIMTA  502

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR+L+
Sbjct  503  TDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHARDLI  562

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQIV P LS LA
Sbjct  563  KILREAGQIVTPALSTLA  580



>ref|XP_006385358.1| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|ERP63155.1| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=497

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  333  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  392

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT GNA+FA+ELV
Sbjct  393  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAKELV  452

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+A
Sbjct  453  TILEEAGQKVSPELTAMA  470



>ref|XP_011000790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Populus euphratica]
Length=506

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  342  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  401

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  +EDYVHRIGRTGRAGAKGTA+TFFT GNA+FA+ELV
Sbjct  402  TDVAARGLDVKDVKYVINYDFPGSIEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAKELV  461

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+A
Sbjct  462  TILEEAGQKVSPELTAMA  479



>gb|KHN39300.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=433

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  269  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  328

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+
Sbjct  329  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELI  388

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  389  AILEEAGQKVSPELAAMG  406



>ref|XP_004486821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Cicer arietinum]
Length=501

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  339  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  398

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV
Sbjct  399  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELV  458

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  459  SILEEAGQRVSPELAAMG  476



>ref|XP_006392681.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 ref|XP_006392682.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29967.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29968.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=429

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  269  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  328

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  329  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELI  388

Query  424  KILQQAGQIVPPQLSALA  371
             ILQ+AGQ V P+LS++ 
Sbjct  389  SILQEAGQKVSPELSSMG  406



>gb|KDO65284.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=473

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  310  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  369

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  370  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  429

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  430  TILEEAGQKVSPELAAMG  447



>ref|XP_006426523.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39763.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=473

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  310  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  369

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  370  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  429

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  430  TILEEAGQKVSPELAAMG  447



>ref|XP_006583016.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Glycine max]
Length=496

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  343  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  402

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+
Sbjct  403  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELI  462

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  463  AILEEAGQKVSPELAAMG  480



>gb|ABR16327.1| unknown [Picea sitchensis]
Length=504

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSR+ IF+ETKKGCDQ+TR+LRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRLLIFLETKKGCDQVTRKLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP  +EDYVHRIGRTGRAGAKGTA+T+FT  NA+FAR+L+
Sbjct  401  TDVAARGLDVKDIKCVINYDFPGSMEDYVHRIGRTGRAGAKGTAYTYFTAANARFARDLI  460

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ + P L+ + 
Sbjct  461  KILEEAGQSISPSLAEMG  478



>ref|XP_003529884.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Glycine max]
Length=507

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  343  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  402

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+
Sbjct  403  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELI  462

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  463  AILEEAGQKVSPELAAMG  480



>ref|XP_006392683.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29969.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=501

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  341  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             ILQ+AGQ V P+LS++ 
Sbjct  461  SILQEAGQKVSPELSSMG  478



>ref|XP_007135556.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
 gb|ESW07550.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
Length=507

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  343  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  402

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  403  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  462

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  463  AILEEAGQKVSPELAAMG  480



>ref|XP_010542432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Tarenaya hassleriana]
Length=503

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  341  IMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSAL  374
             IL++AGQ V P+L+A+
Sbjct  461  SILEEAGQRVSPELAAM  477



>gb|KDO65287.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=491

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  328  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  387

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  388  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  447

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  448  TILEEAGQKVSPELAAMG  465



>gb|ACN39916.1| unknown [Picea sitchensis]
Length=593

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF+ETKKGCDQ+T+QLRMDGWPALSIHG+K+Q ER WVL EFK+G+SP+M A
Sbjct  412  IMDGSRILIFMETKKGCDQVTKQLRMDGWPALSIHGDKSQAERDWVLGEFKAGKSPIMTA  471

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  N +FARELV
Sbjct  472  TDVAARGLDVKDIKCVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANGRFARELV  531

Query  424  KILQQAGQIVPPQLSAL  374
             ILQ+AGQ V P+L+A+
Sbjct  532  GILQEAGQRVNPELAAM  548



>gb|KDO65286.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=498

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  335  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  394

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  395  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  454

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  455  TILEEAGQKVSPELAAMG  472



>ref|XP_006466042.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Citrus sinensis]
 gb|KDO65283.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=504

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  TILEEAGQKVSPELAAMG  478



>ref|XP_010686087.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  340  IMDGSRILVFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  399

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA+EL+
Sbjct  400  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGATGTAYTFFTAANARFAKELI  459

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  460  AILEEAGQKVNPELAAMG  477



>ref|XP_006426526.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39766.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=495

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  332  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  391

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  392  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  451

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  452  TILEEAGQKVSPELAAMG  469



>ref|XP_006426525.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39765.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=505

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  TILEEAGQKVSPELAAMG  478



>ref|XP_006426524.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39764.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=504

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  TILEEAGQKVSPELAAMG  478



>ref|XP_006466041.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Citrus sinensis]
 gb|KDO65282.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=505

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  TILEEAGQKVSPELAAMG  478



>ref|XP_003531619.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Glycine 
max]
 gb|KHN11290.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=507

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  343  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  402

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K V+NYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+
Sbjct  403  TDVAARGLDVKDVKYVVNYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELI  462

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  463  AILEEAGQKVSPELAAMG  480



>ref|XP_004486820.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Cicer arietinum]
Length=546

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  339  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  398

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV
Sbjct  399  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELV  458

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  459  SILEEAGQRVSPELAAMG  476



>ref|XP_002527412.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF34978.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=505

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  SILEEAGQKVSPELAAMG  478



>ref|XP_010480030.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Camelina sativa]
Length=464

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  304  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  363

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  364  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELI  423

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+++ 
Sbjct  424  NILEEAGQKVSPELASMG  441



>ref|XP_010501121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Camelina 
sativa]
Length=502

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  342  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  401

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  402  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELI  461

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+++ 
Sbjct  462  NILEEAGQKVSPELASMG  479



>gb|KHG24204.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=505

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  AILEEAGQKVSPELAAMG  478



>ref|XP_006858286.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
 gb|ERN19753.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
Length=501

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  337  IMDGSRILIFIDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  396

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  N +FA+EL+
Sbjct  397  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANGRFAKELI  456

Query  424  KILQQAGQIVPPQLSAL  374
             ILQ+AGQ V P+L+A+
Sbjct  457  SILQEAGQKVSPELAAM  473



>gb|KJB70270.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
 gb|KJB70271.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
Length=505

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  AILKEAGQKVSPELAAMG  478



>gb|KCW53605.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
 gb|KCW53606.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
Length=485

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P L+A+ 
Sbjct  461  SILEEAGQKVSPDLAAMG  478



>ref|XP_008447604.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Cucumis melo]
Length=505

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  GILEEAGQKVSPELAAMG  478



>ref|XP_010480028.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Camelina sativa]
Length=502

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  342  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  401

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  402  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELI  461

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+++ 
Sbjct  462  NILEEAGQKVSPELASMG  479



>gb|KHF98903.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=519

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  AILKEAGQKVSPELAAMG  478



>gb|KDP40778.1| hypothetical protein JCGZ_24777 [Jatropha curcas]
Length=503

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALS+HG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  340  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSLHGDKSQAERDWVLSEFKAGKSPIMTA  399

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  400  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAKELI  459

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  460  TILEEAGQKVSPELAAMG  477



>ref|XP_010462359.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Camelina sativa]
Length=464

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  304  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  363

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  364  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELM  423

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+++ 
Sbjct  424  NILEEAGQKVSPELASMG  441



>ref|XP_004146825.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 ref|XP_004154799.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 gb|KGN59824.1| hypothetical protein Csa_3G848820 [Cucumis sativus]
Length=505

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  GILEEAGQKVSPELAAMG  478



>ref|XP_008228305.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X3 
[Prunus mume]
Length=504

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  340  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  399

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  400  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  459

Query  424  KILQQAGQIVPPQLSALA  371
             +L++AGQ V P+L+A+ 
Sbjct  460  ALLEEAGQKVSPELAAMG  477



>ref|XP_010033787.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
 ref|XP_010033788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
Length=504

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P L+A+ 
Sbjct  461  SILEEAGQKVSPDLAAMG  478



>ref|NP_001105241.1| DEAD box RNA helicase1 [Zea mays]
 gb|AAR29370.1| DEAD box RNA helicase [Zea mays]
Length=566

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+M A
Sbjct  392  LMDGSRILIFLQTKKDCDKITRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPIMAA  451

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LV
Sbjct  452  TDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLV  511

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ+V P L +++
Sbjct  512  KILREAGQVVNPALESMS  529



>tpg|DAA56213.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=571

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+M A
Sbjct  395  LMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPIMAA  454

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LV
Sbjct  455  TDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLV  514

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ+V P L +++
Sbjct  515  KILREAGQVVNPALESMS  532



>ref|XP_010462358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Camelina sativa]
Length=502

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  342  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  401

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  402  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELM  461

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+++ 
Sbjct  462  NILEEAGQKVSPELASMG  479



>ref|XP_008228303.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Prunus mume]
Length=504

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  340  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  399

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  400  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  459

Query  424  KILQQAGQIVPPQLSALA  371
             +L++AGQ V P+L+A+ 
Sbjct  460  ALLEEAGQKVSPELAAMG  477



>ref|XP_008391321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Malus domestica]
Length=505

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             +L++AGQ V P+L+A+ 
Sbjct  461  ALLEEAGQKVSPELAAMG  478



>ref|XP_004968530.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Setaria italica]
Length=492

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  331  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  390

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  391  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  450

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+A+ 
Sbjct  451  NILEEAGQKVSSELAAMG  468



>gb|KJB56890.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=487

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWP LSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  AILEEAGQKVSPELAAMG  478



>ref|XP_007215261.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
 gb|EMJ16460.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
Length=504

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  340  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  399

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  400  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  459

Query  424  KILQQAGQIVPPQLSALA  371
             +L++AGQ V P+L+A+ 
Sbjct  460  ALLEEAGQKVSPELAAMG  477



>ref|NP_175911.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
 sp|Q9C718.1|RH20_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis 
thaliana]
 gb|AAG50841.1|AC073944_8 ethylene-responsive RNA helicase, putative [Arabidopsis thaliana]
 gb|AAL32823.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91186.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33192.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
Length=501

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  341  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL 
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELT  460

Query  424  KILQQAGQIVPPQLSALA  371
             ILQ+AGQ V P+L+++ 
Sbjct  461  NILQEAGQKVSPELASMG  478



>ref|XP_009367550.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Pyrus x bretschneideri]
Length=505

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             +L++AGQ V P+L+A+ 
Sbjct  461  ALLEEAGQKVSPELAAMG  478



>ref|XP_010106662.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXC11111.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=494

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  336  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  395

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  396  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  455

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  456  TILEEAGQKVSPELAAMG  473



>gb|EEE54050.1| hypothetical protein OsJ_00740 [Oryza sativa Japonica Group]
Length=468

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  307  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  366

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  367  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  426

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+ + 
Sbjct  427  NILEEAGQKVSPELANMG  444



>ref|XP_006645603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Oryza 
brachyantha]
Length=485

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  324  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  383

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  384  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  443

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+ + 
Sbjct  444  NILEEAGQKVSPELANMG  461



>gb|EEC70110.1| hypothetical protein OsI_00766 [Oryza sativa Indica Group]
Length=470

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  309  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  368

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  369  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  428

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+ + 
Sbjct  429  NILEEAGQKVSPELANMG  446



>ref|XP_006646592.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Oryza 
brachyantha]
Length=547

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+M A
Sbjct  374  LMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPIMAA  433

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LV
Sbjct  434  TDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHSNAKFSRNLV  493

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ+V P L ++A
Sbjct  494  KILREAGQVVNPALESMA  511



>gb|AFK42127.1| unknown [Medicago truncatula]
Length=499

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  337  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  396

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIG+TGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  397  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGKTGRAGAKGTAYTFFTAANARFAKELI  456

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+A+ 
Sbjct  457  SILEEAGQRVSSELAAMG  474



>gb|AAG51573.1|AC027034_19 RNA helicase, 5' partial; 101954-101280 [Arabidopsis thaliana]
Length=155

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  766  IXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVAAR  587
            I +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M ATDVAAR
Sbjct  1    ILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAAR  60

Query  586  GLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQA  407
            GLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  ILQ+A
Sbjct  61   GLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEA  120

Query  406  GQIVPPQLSALA  371
            GQ V P+L+++ 
Sbjct  121  GQKVSPELASMG  132



>gb|KJB56888.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
 gb|KJB56891.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=505

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWP LSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  AILEEAGQKVSPELAAMG  478



>ref|XP_003597619.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 ref|XP_003636418.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|ABN08415.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES67870.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=499

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  337  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  396

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  397  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  456

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+A+ 
Sbjct  457  SILEEAGQRVSSELAAMG  474



>ref|XP_010262146.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Nelumbo nucifera]
Length=511

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  348  IMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  407

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  408  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  467

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  468  TILEEAGQKVSPELAAMG  485



>ref|XP_010262147.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X3 [Nelumbo nucifera]
Length=505

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  342  IMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  401

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  402  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  461

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  462  TILEEAGQKVSPELAAMG  479



>ref|XP_010242202.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nelumbo nucifera]
Length=512

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  348  IMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  407

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  408  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  467

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  468  TILEEAGQKVSPELAAMG  485



>ref|XP_010262145.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Nelumbo nucifera]
Length=512

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  349  IMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  408

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  409  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  468

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  469  TILEEAGQKVSPELAAMG  486



>ref|XP_008805786.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Phoenix dactylifera]
Length=498

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLR DGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  334  IMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  393

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  394  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  453

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  454  NILEEAGQKVSPELAAMG  471



>sp|Q5QMN3.2|RH20_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Oryza sativa 
Japonica Group]
Length=494

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  333  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  392

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  393  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  452

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+ + 
Sbjct  453  NILEEAGQKVSPELANMG  470



>ref|XP_004971011.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Setaria italica]
Length=569

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+M A
Sbjct  393  LMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKAQSERDYVLAEFKSGKSPIMAA  452

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LV
Sbjct  453  TDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLV  512

Query  424  KILQQAGQIVPPQL  383
            KIL++AGQ+V P L
Sbjct  513  KILREAGQVVNPAL  526



>ref|XP_007024450.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
 gb|EOY27072.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
Length=505

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITR+LRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRRLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  461  VILEEAGQKVSPELAAMG  478



>ref|XP_004297601.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  341  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA TFFT  NA+FA+EL+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAHTFFTAANARFAKELI  460

Query  424  KILQQAGQIVPPQLSALA  371
             +L++AGQ V P L+A+ 
Sbjct  461  GLLEEAGQKVSPDLAAMG  478



>ref|XP_004968529.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Setaria italica]
Length=517

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  331  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  390

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  391  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  450

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+A+ 
Sbjct  451  NILEEAGQKVSSELAAMG  468



>ref|XP_002279117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
 emb|CBI35942.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+G RI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  342  IMDGGRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  401

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  402  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  461

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  462  TILEEAGQRVAPELAAMG  479



>ref|XP_008805785.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Phoenix dactylifera]
Length=530

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLR DGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  366  IMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  425

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  426  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  485

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+A+ 
Sbjct  486  NILEEAGQKVSPELAAMG  503



>ref|XP_009380443.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLR DGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  337  IMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  396

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  397  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  456

Query  424  KILQQAGQIVPPQLSAL  374
            KIL++AGQ V P+L+ +
Sbjct  457  KILEEAGQKVNPELAKM  473



>ref|XP_004971010.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Setaria italica]
Length=596

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+M A
Sbjct  393  LMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKAQSERDYVLAEFKSGKSPIMAA  452

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LV
Sbjct  453  TDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLV  512

Query  424  KILQQAGQIVPPQL  383
            KIL++AGQ+V P L
Sbjct  513  KILREAGQVVNPAL  526



>ref|XP_002891814.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68073.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  341  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL 
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELS  460

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L+++ 
Sbjct  461  NILEEAGQKVSPELASMG  478



>ref|XP_002458964.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
 gb|EES04084.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
Length=578

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD+ITRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+M A
Sbjct  401  LMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPIMAA  460

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LV
Sbjct  461  TDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLV  520

Query  424  KILQQAGQIVPPQLSAL  374
            KIL++AGQ V P L ++
Sbjct  521  KILREAGQAVNPALESM  537



>ref|NP_001142117.1| uncharacterized protein LOC100274281 [Zea mays]
 gb|ACF86539.1| unknown [Zea mays]
 gb|ACF87679.1| unknown [Zea mays]
 tpg|DAA52978.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=494

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ TRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  333  IMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  392

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+
Sbjct  393  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELI  452

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+A+ 
Sbjct  453  NILEEAGQKVSSELAAMG  470



>emb|CDO97919.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G++P+M A
Sbjct  340  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKNPIMTA  399

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  400  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKDLI  459

Query  424  KILQQAGQIVPPQLSALA  371
             ILQ+AGQ V P+L+++ 
Sbjct  460  NILQEAGQKVSPELASMG  477



>ref|XP_010314157.1| PREDICTED: ethylene-responsive RNA helicase isoform X1 [Solanum 
lycopersicum]
Length=501

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  338  IMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  397

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV
Sbjct  398  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLV  457

Query  424  KILQQAGQIVPPQLSAL  374
             IL++AGQ V P+L+ +
Sbjct  458  NILEEAGQKVSPELAKM  474



>ref|XP_009625322.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=501

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  338  IMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  397

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+T+FT  NA+FA++L+
Sbjct  398  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTYFTAANARFAKDLI  457

Query  424  KILQQAGQIVPPQLSAL  374
             IL++AGQ V P+L+ +
Sbjct  458  NILEEAGQKVSPELAKM  474



>ref|XP_003564892.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Brachypodium 
distachyon]
Length=571

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VLSEFKSG+SP+M A
Sbjct  399  LMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKAQSERDYVLSEFKSGKSPIMAA  458

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH N+K++R LV
Sbjct  459  TDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNSKYSRNLV  518

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ+V P L A++
Sbjct  519  KILREAGQVVNPALEAMS  536



>emb|CDY02459.1| BnaA08g00660D [Brassica napus]
Length=499

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  339  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  398

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+ELV
Sbjct  399  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELV  458

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+++ 
Sbjct  459  SILEEAGQKVSHELASMG  476



>ref|XP_009106904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brassica rapa]
Length=499

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  339  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  398

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+ELV
Sbjct  399  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELV  458

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+++ 
Sbjct  459  SILEEAGQKVSHELASMG  476



>ref|XP_006366150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366151.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Solanum tuberosum]
Length=501

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  338  IMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  397

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV
Sbjct  398  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLV  457

Query  424  KILQQAGQIVPPQLSAL  374
             IL++AGQ V P+L+ +
Sbjct  458  NILEEAGQKVGPELAKM  474



>ref|XP_011072507.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Sesamum indicum]
Length=507

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF++G+SP+M A
Sbjct  344  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRAGKSPIMTA  403

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  404  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  463

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V P+L A+ 
Sbjct  464  NILEEAGQKVSPELVAMG  481



>emb|CDY10596.1| BnaC03g70180D [Brassica napus]
Length=499

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  339  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  398

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+EL+
Sbjct  399  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELI  458

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+++ 
Sbjct  459  SILEEAGQKVSHELASMG  476



>emb|CDM81540.1| unnamed protein product [Triticum aestivum]
Length=496

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  335  IMDGSRILVFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  394

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA++FFT  NA+FA++L+
Sbjct  395  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYSFFTAANARFAKDLI  454

Query  424  KILQQAGQIVPPQLSALA  371
             IL +AGQ V P+L+ + 
Sbjct  455  SILVEAGQKVSPELANMG  472



>ref|XP_003564953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brachypodium 
distachyon]
Length=496

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  335  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  394

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++L+
Sbjct  395  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYTFFTAANARFAKDLI  454

Query  424  KILQQAGQIVPPQLSALA  371
             IL +AGQ V P+L+ + 
Sbjct  455  NILVEAGQKVSPELANMG  472



>ref|XP_010534903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  269  IMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  328

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+F ++L+
Sbjct  329  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFVKDLI  388

Query  424  KILQQAGQIVPPQLSAL  374
             IL++A Q V P+L+A+
Sbjct  389  NILEEAEQRVSPELAAM  405



>gb|KFK38698.1| hypothetical protein AALP_AA3G148400 [Arabis alpina]
Length=499

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  339  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  398

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+  VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV
Sbjct  399  TDVAARGLDVKDVMYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELV  458

Query  424  KILQQAGQIVPPQLSALA  371
             ILQ+AGQ V  +L+++ 
Sbjct  459  NILQEAGQKVSSELASMG  476



>gb|EMS66298.1| DEAD-box ATP-dependent RNA helicase 30 [Triticum urartu]
Length=587

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFK+G+SP+M A
Sbjct  396  LMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKAQSERDYVLAEFKNGKSPIMAA  455

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R LV
Sbjct  456  TDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSRNLV  515

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ+V P L A++
Sbjct  516  KILREAGQVVNPALEAMS  533



>emb|CDM85602.1| unnamed protein product [Triticum aestivum]
Length=574

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFK+G+SP+M A
Sbjct  396  LMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKAQSERDYVLAEFKNGKSPIMAA  455

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R LV
Sbjct  456  TDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSRNLV  515

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ+V P L A++
Sbjct  516  KILREAGQVVNPALEAMS  533



>ref|XP_010915213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Elaeis guineensis]
Length=498

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLR DGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  334  IMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  393

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  394  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  453

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+A+ 
Sbjct  454  NILEEAGQKVSSELAAMG  471



>ref|XP_001763089.1| predicted protein [Physcomitrella patens]
 gb|EDQ71966.1| predicted protein [Physcomitrella patens]
Length=514

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSR+ +F+ETK+GCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  336  IMDGSRLLVFMETKRGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  395

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVINYDFP   EDYVHRIGRTGRAGAKG A+TFFT  NAK A+ELV
Sbjct  396  TDVAARGLDVKDIKCVINYDFPGSCEDYVHRIGRTGRAGAKGAAYTFFTAANAKHAKELV  455

Query  424  KILQQAGQIVPPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKR  257
             IL +AGQ V  QL A+        GG   R RG GG G     SGSNT+PLG +R
Sbjct  456  SILVEAGQPVSSQLQAMVGSSRGGGGGGFHRGRGFGGRGFGVQQSGSNTIPLGGQR  511



>ref|XP_010534902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Tarenaya hassleriana]
Length=504

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF+SG+SP+M A
Sbjct  341  IMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTA  400

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+F ++L+
Sbjct  401  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFVKDLI  460

Query  424  KILQQAGQIVPPQLSAL  374
             IL++A Q V P+L+A+
Sbjct  461  NILEEAEQRVSPELAAM  477



>ref|XP_006306418.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
 gb|EOA39316.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
Length=499

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI +F++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVL+EF+SG+SP+M A
Sbjct  339  IMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLAEFRSGKSPIMTA  398

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV
Sbjct  399  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELV  458

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+++ 
Sbjct  459  NILEEAGQKVSHELASMG  476



>dbj|BAD82427.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82339.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 gb|EEE55863.1| hypothetical protein OsJ_04500 [Oryza sativa Japonica Group]
Length=571

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+M A
Sbjct  398  LMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPIMAA  457

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R LV
Sbjct  458  TDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLV  517

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ+V P L ++A
Sbjct  518  KILREAGQVVNPALESMA  535



>ref|XP_009802114.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=501

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQ+TR LRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  338  IMDGSRILIFMDTKKGCDQVTRLLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  397

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+T+FT  NA+FA++L+
Sbjct  398  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTYFTAANARFAKDLI  457

Query  424  KILQQAGQIVPPQLSAL  374
             IL++AGQ V P+L+ +
Sbjct  458  NILEEAGQKVSPELAKM  474



>sp|Q5N7W4.2|RH30_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Oryza sativa 
Japonica Group]
Length=666

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF +TKK CD++TRQLRMDGWPALSIHG+K Q ER +VL+EFKSG+SP+M A
Sbjct  493  LMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLAEFKSGKSPIMAA  552

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R LV
Sbjct  553  TDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLV  612

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++AGQ+V P L ++A
Sbjct  613  KILREAGQVVNPALESMA  630



>gb|EYU21378.1| hypothetical protein MIMGU_mgv1a004869mg [Erythranthe guttata]
Length=506

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEF++G+SP+M A
Sbjct  345  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRAGKSPIMTA  404

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA++L+
Sbjct  405  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTVANARFAKDLI  464

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L A+ 
Sbjct  465  NILEEAGQKVSSELVAMG  482



>gb|EMS55994.1| DEAD-box ATP-dependent RNA helicase 20 [Triticum urartu]
Length=491

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  335  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  394

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA++FFT  NA+FA++L+
Sbjct  395  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYSFFTAANARFAKDLI  454

Query  424  KILQQAGQIV  395
             IL +AGQ V
Sbjct  455  SILVEAGQKV  464



>gb|EMT09661.1| DEAD-box ATP-dependent RNA helicase 20 [Aegilops tauschii]
Length=431

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  269  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  328

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA++FFT  NA+FA++L+
Sbjct  329  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYSFFTAANARFAKDLI  388

Query  424  KILQQAGQIV  395
             IL +AGQ V
Sbjct  389  SILVEAGQKV  398



>dbj|BAD73320.1| putative ethylene-responsive RNA helicase [Oryza sativa Japonica 
Group]
Length=521

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  307  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  366

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+
Sbjct  367  TDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLI  426

Query  424  KILQQAGQ  401
             IL++AGQ
Sbjct  427  NILEEAGQ  434



>ref|XP_005850349.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
 gb|EFN58247.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
Length=551

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+G RI IF+ETKKGCD +TRQLRMDGWPALSIHG+K+Q ER WVL+EFK+G+ P+MIAT
Sbjct  371  MDGRRILIFLETKKGCDAVTRQLRMDGWPALSIHGDKSQHERDWVLAEFKAGKHPIMIAT  430

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDIK VINYD P+C EDYVHRIGRTGRAGA G A++FFT  N + AR+LV+
Sbjct  431  DVAARGLDVKDIKMVINYDMPSCAEDYVHRIGRTGRAGASGAAYSFFTAANGRMARQLVQ  490

Query  421  ILQQAGQIVPPQLSALA  371
            IL++A Q VPP+L   A
Sbjct  491  ILEEASQAVPPELRQFA  507



>ref|NP_001234650.1| ethylene-responsive RNA helicase [Solanum lycopersicum]
 gb|AAD46404.1|AF096248_1 ethylene-responsive RNA helicase [Solanum lycopersicum]
Length=474

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF  T KGCDQ+TRQLRMDGWPALSIHG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  312  IMDGSRILIF-RTLKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTA  370

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV
Sbjct  371  TDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLV  430

Query  424  KILQQAGQIVPPQLSAL  374
             IL++AGQ V P+L+ +
Sbjct  431  NILEEAGQKVSPELAKM  447



>ref|XP_002455005.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
 gb|EES00125.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
Length=488

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 4/138 (3%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF++TKKGCDQITRQLRMDGWPALSIHG+K+Q ER WVLSEFKSG+SP+M A
Sbjct  333  IMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTA  392

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGL    +K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+EL+
Sbjct  393  TDVAARGL----VKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELI  448

Query  424  KILQQAGQIVPPQLSALA  371
             IL++AGQ V  +L+A+ 
Sbjct  449  SILEEAGQKVSSELAAMG  466



>ref|XP_002987999.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
 gb|EFJ10791.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
Length=505

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+G +I IF+ETK+GCDQ+T+QLRM+GWPALSIHG+K+Q ER WVLSEFK+G+SP+M AT
Sbjct  328  MDGGKILIFMETKRGCDQVTKQLRMEGWPALSIHGDKSQAERDWVLSEFKTGKSPIMTAT  387

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDI+ VINYDFP   EDYVHRIGRTGRAGAKGTA+TFFT  NAK ARELV 
Sbjct  388  DVAARGLDVKDIRYVINYDFPGSCEDYVHRIGRTGRAGAKGTAYTFFTVSNAKHARELVS  447

Query  421  ILQQAGQIVPPQLSAL  374
            IL +AGQ + P+L ++
Sbjct  448  ILSEAGQRITPELQSM  463



>ref|XP_002972931.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
 gb|EFJ26152.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
Length=534

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+G +I IF+ETK+GCDQ+T+QLRM+GWPALSIHG+K+Q ER WVLSEFK+G+SP+M AT
Sbjct  333  MDGGKILIFMETKRGCDQVTKQLRMEGWPALSIHGDKSQAERDWVLSEFKTGKSPIMTAT  392

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDI+ VINYDFP   EDYVHRIGRTGRAGAKGTA+TFFT  NAK ARELV 
Sbjct  393  DVAARGLDVKDIRYVINYDFPGSCEDYVHRIGRTGRAGAKGTAYTFFTVSNAKHARELVS  452

Query  421  ILQQAGQIVPPQLSAL  374
            IL +AGQ + P+L ++
Sbjct  453  ILSEAGQRITPELQSM  468



>emb|CDI80731.1| hypothetical protein, conserved [Eimeria acervulina]
Length=199

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I +F ETK+G D +TR LRM+GWPALS+HG+K Q+ER WVL EFK GR+P+M+A
Sbjct  17   IMDGSKILVFAETKRGADNLTRDLRMEGWPALSLHGDKKQEERTWVLDEFKQGRNPIMVA  76

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKDI+ VIN+D P  +EDYVHRIGRTGRAGAKG A+TFFT    + AR+LV
Sbjct  77   TDVASRGLDVKDIRHVINFDMPNQIEDYVHRIGRTGRAGAKGNAYTFFTTDKQRLARDLV  136

Query  424  KILQQAGQIVPPQLSAL  374
            ++L++A Q VPP+L AL
Sbjct  137  RVLKEANQTVPPELEAL  153



>ref|XP_002776976.1| helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER08792.1| helicase, putative [Perkinsus marinus ATCC 50983]
Length=181

 Score =   163 bits (412),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+GS+I IF +TK+  D +TR LRMDGWPALSIHG+K Q+ER WVL EFKSG+SP+MIAT
Sbjct  1    MDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKKQEERDWVLQEFKSGKSPIMIAT  60

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVA+RGLDVKD++ VINYDFP  +EDYVHRIGRTGRAGAKG+A++FFT    K A++L+ 
Sbjct  61   DVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAGAKGSAYSFFTPDKYKLAKDLIG  120

Query  421  ILQQAGQIVPPQLSALA  371
            +L++A Q VPP+L  +A
Sbjct  121  VLREAEQAVPPELEKIA  137



>gb|KFG62415.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, partial [Toxoplasma 
gondii RUB]
Length=193

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+M+A
Sbjct  15   IMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPIMVA  74

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT    + ARELV
Sbjct  75   TDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKPRLARELV  134

Query  424  KILQQAGQIVPPQLSALAC  368
            ++L+ A Q VPP+L +L  
Sbjct  135  RVLRGANQPVPPELESLGM  153



>ref|XP_002780686.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER12481.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
Length=166

 Score =   160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+GS++ IF +TK+G D +TR LRMDGWPAL IHG+K Q+ER WVL EFKSG+SP+MIAT
Sbjct  1    MDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKKQEERDWVLHEFKSGKSPIMIAT  60

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVA+RGLDVKDI+ V+NYDFP  +EDYVHRIGRTGRAG KG A+TFFT    K AR LV+
Sbjct  61   DVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAGCKGNAYTFFTADKIKMARGLVQ  120

Query  421  ILQQAGQIVPPQLSALA  371
            IL++A Q V P+L  L+
Sbjct  121  ILREANQTVSPELERLS  137



>ref|XP_005650016.1| DEAD-box RNA helicase [Coccomyxa subellipsoidea C-169]
 gb|EIE25472.1| DEAD-box RNA helicase [Coccomyxa subellipsoidea C-169]
Length=461

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+GSR+ IF ETK+GCD +TRQLR +GWPALSIHG+K+Q ER WVL+EFK+G+SP+M+AT
Sbjct  286  MDGSRLLIFCETKRGCDAVTRQLRTEGWPALSIHGDKSQQERDWVLAEFKAGKSPIMLAT  345

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDIK V+NYD P   EDYVHRIGRT RAGA G A +FFT  N + AR++V 
Sbjct  346  DVAARGLDVKDIKMVVNYDMPNTAEDYVHRIGRTARAGASGLAVSFFTSANGRMARQIVD  405

Query  421  ILQQAGQIVPPQLSALAC  368
            IL +A Q VP QL   A 
Sbjct  406  ILSEAHQTVPDQLRQYAS  423



>emb|CCF73942.1| unnamed protein product [Babesia microti strain RI]
Length=530

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF +TKKG D +TR+LRMDGWPALSIHG+K QDER WVL+EFKSG+ P+MIA
Sbjct  363  LMDGSKIIIFADTKKGADILTRELRMDGWPALSIHGDKKQDERTWVLNEFKSGKHPIMIA  422

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKD++ VINYDFP  +EDYVHRIGRTGRAG KG A+TF T    K A++LV
Sbjct  423  TDVASRGLDVKDVRFVINYDFPNQIEDYVHRIGRTGRAGTKGVAYTFLTPDKHKVAKDLV  482

Query  424  KILQQAGQIVPPQLSALA  371
            KIL++A Q + P+LS +A
Sbjct  483  KILREANQPISPELSRIA  500



>emb|CAA09215.1| RNA helicase [Arabidopsis thaliana]
Length=263

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IFVETK+GCDQ+TRQLRMDGWPAL+IHG+K Q ER  VL+EFKSGRSP+M A
Sbjct  151  LMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPIMTA  210

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVH  515
            TDVAARGLDVKDIKCV+NYDFP  LEDY+H
Sbjct  211  TDVAARGLDVKDIKCVVNYDFPNTLEDYIH  240



>ref|XP_764197.1| RNA helicase [Theileria parva strain Muguga]
 gb|EAN31914.1| RNA helicase, putative [Theileria parva]
Length=635

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+G +I IF ETKKG D +TR+LR+DGWPAL IHG+K Q+ER WVL+EFKSG+ P+MIAT
Sbjct  454  MDGGKILIFSETKKGADTLTRELRLDGWPALCIHGDKKQEERTWVLNEFKSGKHPIMIAT  513

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVA+RGLDV+D+K VINYDFP  +EDYVHRIGRTGRAG KG+++TF T    K ARELVK
Sbjct  514  DVASRGLDVRDVKYVINYDFPGQIEDYVHRIGRTGRAGMKGSSYTFLTPDKFKSARELVK  573

Query  421  ILQQAGQIVPPQLSALA  371
            ++++A Q +PP+L  LA
Sbjct  574  LMREANQEIPPELQKLA  590



>ref|XP_004831007.1| DEAD box ATP-dependent RNA helicase family member protein [Babesia 
equi]
 gb|AFZ81341.1| DEAD box ATP-dependent RNA helicase family member protein [Babesia 
equi strain WA]
Length=518

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF ETKKG D +TR+LR+DGWPALSIHG+K Q+ER WVL+EFK G+ P+MIA
Sbjct  346  LMDGSKILIFTETKKGADSLTRELRLDGWPALSIHGDKKQEERNWVLNEFKLGKHPIMIA  405

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDV D+K VINYDFP  +EDYVHRIGRTGRAG KG ++TF T    + AR+LV
Sbjct  406  TDVASRGLDVHDVKYVINYDFPNQIEDYVHRIGRTGRAGTKGASYTFLTPDKNRIARDLV  465

Query  424  KILQQAGQIVPPQLSALAC  368
            ++L++A Q V P+LS LA 
Sbjct  466  RVLREANQPVSPELSRLAS  484



>ref|XP_009692285.1| DEAD-box family RNA-dependent helicase [Theileria orientalis 
strain Shintoku]
 dbj|BAM41984.1| DEAD-box family RNA-dependent helicase [Theileria orientalis 
strain Shintoku]
Length=587

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+GS+I IF ETKKG D +TR+LR+DGWPAL IHG+K Q+ER WVLSEFK+G+ P+MIAT
Sbjct  394  MDGSKILIFAETKKGADTLTRELRLDGWPALCIHGDKKQEERSWVLSEFKAGKHPIMIAT  453

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVA+RGLDV D+K VINYDFP  +EDYVHRIGRTGRAG KG+++TF T    K AR+LVK
Sbjct  454  DVASRGLDVHDVKYVINYDFPAQIEDYVHRIGRTGRAGMKGSSYTFLTADKFKVARDLVK  513

Query  421  ILQQAGQIVPPQLSALA  371
            +L++A Q VP +L  LA
Sbjct  514  LLREANQPVPEELQKLA  530



>ref|XP_953213.1| DEAD-box family RNA-dependent helicase [Theileria annulata strain 
Ankara]
 emb|CAI76588.1| DEAD-box family RNA-dependent helicase, putative [Theileria annulata]
Length=616

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+G +I IF ETKKG D +TR+LR+DGWPAL IHG+K Q+ER WVL+EFK+G+ P+MIAT
Sbjct  435  MDGGKILIFSETKKGADTLTRELRLDGWPALCIHGDKKQEERTWVLNEFKTGKHPIMIAT  494

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVA+RGLDV+D+K VINYDFP  +EDYVHRIGRTGRAG KG+++TF T    K ARELVK
Sbjct  495  DVASRGLDVRDVKYVINYDFPGQIEDYVHRIGRTGRAGMKGSSYTFLTPDKFKSARELVK  554

Query  421  ILQQAGQIVPPQLSALA  371
            ++++A Q +PP+L  LA
Sbjct  555  LMREANQEIPPELLKLA  571



>ref|XP_001690022.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP09760.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
Length=513

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+G RI IFVETK+GCD++ RQLR DG+PAL +HG+K+Q ER WVL EFK+G  P+M+AT
Sbjct  352  MDGRRILIFVETKRGCDELVRQLRTDGYPALGLHGDKSQQERDWVLQEFKNGTHPIMLAT  411

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDIK V+NYD P   EDYVHRIGRTGRAGA GTA++FFT+G+A+ AR++V 
Sbjct  412  DVAARGLDVKDIKVVVNYDMPKTAEDYVHRIGRTGRAGATGTAYSFFTNGDARLARQVVD  471

Query  421  ILQQAGQIVPPQL  383
            ++Q+AGQ  PP+L
Sbjct  472  VMQEAGQQPPPEL  484



>ref|XP_002777393.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER09209.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=515

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF +TK+  D +TR LRMDGWPALSIHG+K Q+ER WVL EFKSG+SP+MIA
Sbjct  344  IMDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKKQEERDWVLQEFKSGKSPIMIA  403

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKD++ VINYDFP  +EDYVHRIGRTGRAGAKG+A++FFT    K A++L+
Sbjct  404  TDVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAGAKGSAYSFFTPDKYKLAKDLI  463

Query  424  KILQQAGQIVPPQLSALA  371
             +L++A Q VPP+L  +A
Sbjct  464  GVLREAEQAVPPELEKIA  481



>ref|XP_002777392.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER09208.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=531

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF +TK+  D +TR LRMDGWPALSIHG+K Q+ER WVL EFKSG+SP+MIA
Sbjct  360  IMDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKKQEERDWVLQEFKSGKSPIMIA  419

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKD++ VINYDFP  +EDYVHRIGRTGRAGAKG+A++FFT    K A++L+
Sbjct  420  TDVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAGAKGSAYSFFTPDKYKLAKDLI  479

Query  424  KILQQAGQIVPPQLSALA  371
             +L++A Q VPP+L  +A
Sbjct  480  GVLREAEQAVPPELEKIA  497



>dbj|BAN64363.1| p68-like protein [Babesia bovis]
Length=305

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -2

Query  775  GSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDV  596
            G++I IF +TKK  D IT++LR+DGWPALSIHG+K Q+ER WVL+EFKSG+ P+M+ATDV
Sbjct  130  GTKILIFTDTKKTADSITKELRLDGWPALSIHGDKKQEERNWVLNEFKSGKHPIMVATDV  189

Query  595  AARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKIL  416
            A+RGLDV+D+K VIN+DFP  +EDYVHRIGRTGR G KG ++TF T    + ARELVK++
Sbjct  190  ASRGLDVRDVKVVINFDFPNQIEDYVHRIGRTGRGGNKGASYTFLTPDKNRVARELVKLM  249

Query  415  QQAGQIVPPQLSALA  371
            ++A Q + P+LS LA
Sbjct  250  REAKQQISPELSKLA  264



>ref|XP_004349647.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22559.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
Length=706

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+G RI IF +TKKG DQ+ R LR +GWPAL+IHG+K Q ER   L+EF+SGRSP+M+A
Sbjct  444  IMDGGRILIFTQTKKGADQLQRALRGEGWPALAIHGDKTQQERDATLAEFRSGRSPIMVA  503

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVAARGLDVKD++ VINYDF +  EDYVHRIGRTGRAGA GTA++FFT G+ K A+ L+
Sbjct  504  TDVAARGLDVKDVRYVINYDFASTAEDYVHRIGRTGRAGATGTAYSFFTSGDFKLAKRLI  563

Query  424  KILQQAGQIVPPQLSALAC  368
            K+L +AGQ VPPQL   A 
Sbjct  564  KVLSEAGQEVPPQLHQFAV  582



>ref|XP_002774608.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER06424.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=520

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GS++ IF +TK+G D +TR LRMDGWPAL IHG+K Q+ER WVL EFKSG+SP+MIA
Sbjct  354  VMDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKKQEERDWVLHEFKSGKSPIMIA  413

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKDI+ V+NYDFP  +EDYVHRIGRTGRAG KG A+TFFT    K AR+LV
Sbjct  414  TDVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAGCKGNAYTFFTPDKIKMARDLV  473

Query  424  KILQQAGQIVPPQLSALA  371
            +IL++A Q V P+L  L+
Sbjct  474  QILREANQTVSPELERLS  491



>ref|XP_003884670.1| hypothetical protein NCLIV_050680 [Neospora caninum Liverpool]
 emb|CBZ54640.1| hypothetical protein NCLIV_050680 [Neospora caninum Liverpool]
Length=578

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+M+A
Sbjct  400  IMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPIMVA  459

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT   ++ ARELV
Sbjct  460  TDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKSRLARELV  519

Query  424  KILQQAGQIVPPQLSALA  371
            ++L+ A Q VPP+L +L 
Sbjct  520  RVLRGANQPVPPELESLG  537



>gb|KIZ00407.1| ATP-dependent RNA helicase DDX5/DBP2 [Monoraphidium neglectum]
Length=552

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -2

Query  775  GSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDV  596
            GS++ IF ETK+GCD++TR LR +GWPAL++HG+K Q ER WVL+EFKSG+ P+M+ATDV
Sbjct  389  GSKVLIFCETKRGCDEVTRSLRAEGWPALALHGDKQQRERDWVLAEFKSGKHPLMLATDV  448

Query  595  AARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKIL  416
            AARGLDVKDIK V+N+D P   EDYVHRIGRTGRAGA GTA++FFT  N + ARE++KI+
Sbjct  449  AARGLDVKDIKVVVNFDMPNNAEDYVHRIGRTGRAGATGTAYSFFTAANGRLAREIIKIM  508

Query  415  QQAGQIVPPQLSALAC  368
             +A Q+VP +L ++A 
Sbjct  509  NEANQVVPTELQSIAS  524



>ref|XP_008885470.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Hammondia hammondi]
 gb|KEP63938.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Hammondia hammondi]
Length=550

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+M+A
Sbjct  372  IMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPIMVA  431

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT    + ARELV
Sbjct  432  TDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKPRLARELV  491

Query  424  KILQQAGQIVPPQLSALA  371
            ++L+ A Q VPP+L +L 
Sbjct  492  RVLRGANQPVPPELESLG  509



>gb|EPR60274.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
GT1]
 gb|ESS30986.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
VEG]
 gb|KFG36774.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
p89]
 gb|KFG44036.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
FOU]
 gb|KFH07497.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
VAND]
Length=550

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+M+A
Sbjct  372  IMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPIMVA  431

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT    + ARELV
Sbjct  432  TDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKPRLARELV  491

Query  424  KILQQAGQIVPPQLSALA  371
            ++L+ A Q VPP+L +L 
Sbjct  492  RVLRGANQPVPPELESLG  509



>ref|XP_002369028.1| DEAD/DEAH box helicase, putative [Toxoplasma gondii ME49]
 gb|EPT26653.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
ME49]
 gb|KFG31703.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
GAB2-2007-GAL-DOM2]
 gb|KFH16252.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
MAS]
Length=550

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GS+I IF ETK+G D +TR +R++GWPALS+HG+K Q+ER WVL EFK+GR+P+M+A
Sbjct  372  IMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWVLDEFKNGRNPIMVA  431

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKDI+ VINYD P  +EDY+HRIGRTGRAGAKG A+TFFT    + ARELV
Sbjct  432  TDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYTFFTPDKPRLARELV  491

Query  424  KILQQAGQIVPPQLSALA  371
            ++L+ A Q VPP+L +L 
Sbjct  492  RVLRGANQPVPPELESLG  509



>ref|XP_002771918.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03734.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=521

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            VM+GS++ IF +TK+G D +TR LRMDGWPAL IHG+K Q+ER WVL EFKSG+SP+MIA
Sbjct  359  VMDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKKQEERDWVLHEFKSGKSPIMIA  418

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDVKDI+ V+NYDFP  +EDYVHRIGRTGRAG KG A+TFFT    K AR LV
Sbjct  419  TDVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAGCKGNAYTFFTADKIKMARGLV  478

Query  424  KILQQAGQIVPPQLSALA  371
            +IL++A Q V P+L  L+
Sbjct  479  QILREANQTVSPELERLS  496



>gb|KHN25107.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=378

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 10/139 (7%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+GSRI IF+ TKKGCDQITRQLRMDGWPALSIHG+K+  ER WVLSEFKSG+SP    
Sbjct  235  IMDGSRILIFMGTKKGCDQITRQLRMDGWPALSIHGDKSHAERDWVLSEFKSGKSP----  290

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
                  GLDVKD+K VINYDF   LEDYVHRIGR GRAGAKGTA+ +FT  NA+FA++L+
Sbjct  291  ------GLDVKDVKYVINYDFRGSLEDYVHRIGRIGRAGAKGTAYPYFTAANARFAKDLI  344

Query  424  KILQQAGQIVPPQLSALAC  368
             IL++AGQ V P+L+A+  
Sbjct  345  AILEEAGQKVSPELAAMGS  363



>emb|CDR95325.1| p68-like protein, putative [Babesia bigemina]
Length=535

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +  G+++ IF +TKK  D +TR+LR+DGWPALSIHG+K Q+ER WVL+EFKSG+ P+M+A
Sbjct  354  ISEGTKVLIFADTKKTADSLTRELRLDGWPALSIHGDKKQEERNWVLNEFKSGKHPIMVA  413

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDV+D+K VIN+DFP  +EDYVHRIGRTGR G KG ++TF T    + ARELV
Sbjct  414  TDVASRGLDVRDVKVVINFDFPNQIEDYVHRIGRTGRGGNKGASYTFLTPDKGRIARELV  473

Query  424  KILQQAGQIVPPQLSALA  371
            K++++A Q + P+LS LA
Sbjct  474  KLMREANQTISPELSKLA  491



>gb|KDP40781.1| hypothetical protein JCGZ_24780 [Jatropha curcas]
Length=361

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +M+G RI IF++TKKGCDQI RQLRMDGWPALS HG+K+Q ER WVLSEFK+G+SP+M A
Sbjct  269  IMDGCRILIFMDTKKGCDQIIRQLRMDGWPALSFHGDKSQAERDWVLSEFKAGKSPIMTA  328

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVH  515
            TDVAARGLDVKD+K VINYDFP  LEDYVH
Sbjct  329  TDVAARGLDVKDVKYVINYDFPGSLEDYVH  358



>emb|CDJ62108.1| MGC53795 protein, related [Eimeria necatrix]
Length=216

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 112/171 (65%), Gaps = 35/171 (20%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+GS+I +F ETK+G D +TR LRM+GWPALS+HG+K Q+ER WVL EFK GR+P+M+AT
Sbjct  1    MDGSKILVFAETKRGADNLTRDLRMEGWPALSLHGDKKQEERTWVLDEFKQGRNPIMVAT  60

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftff-------------  461
            DVA+RGLDVKDI+ VINYD P  +EDYVHRIGRTGRAGAKG                   
Sbjct  61   DVASRGLDVKDIRHVINYDMPNQIEDYVHRIGRTGRAGAKGQQQQQQQQQQRQQQQGPLL  120

Query  460  -------------THGNA---------KFARELVKILQQAGQIVPPQLSAL  374
                           GNA         + AR+LV++L++A Q+VPP+L AL
Sbjct  121  PLLRARRGSGRVCAGGNAYTFFTTDKQRLARDLVRVLKEASQVVPPELEAL  171



>ref|XP_002955411.1| DEAD-box RNA helicase, ATP-dependent [Volvox carteri f. nagariensis]
 gb|EFJ43482.1| DEAD-box RNA helicase, ATP-dependent [Volvox carteri f. nagariensis]
Length=535

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  MNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIAT  602
            M+G RI IF ETK+GCD++ RQLR DG+PAL +HG+K+Q ER WVL EFK+G  P+M+AT
Sbjct  356  MDGRRILIFCETKRGCDELVRQLRTDGYPALGLHGDKSQQERDWVLQEFKNGTHPIMLAT  415

Query  601  DVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVK  422
            DVAARGLDVKDIK V+NYD P   EDYVHRIGRTGRAGA GTA++FFT  +A+ AR++V+
Sbjct  416  DVAARGLDVKDIKVVVNYDMPKTAEDYVHRIGRTGRAGAHGTAYSFFTGADARLARQVVE  475

Query  421  ILQQAGQIVPPQL  383
            ++Q+AGQ  PP+L
Sbjct  476  VMQEAGQQPPPEL  488



>ref|XP_736707.1| helicase [Plasmodium chabaudi chabaudi]
 emb|CAH85853.1| helicase, putative [Plasmodium chabaudi chabaudi]
Length=158

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -2

Query  769  RIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVAA  590
            RI +FVETK+  D IT+ LR++G PAL IHG+K QDER WVL++FK+G+SP++IATDVA+
Sbjct  8    RIIVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIATDVAS  67

Query  589  RGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQ  410
            RGLD+KD+K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKIL++
Sbjct  68   RGLDIKDVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILRE  127

Query  409  AGQIVPPQLSALA  371
            + Q +PPQL  ++
Sbjct  128  SEQPIPPQLEKIS  140



>ref|XP_744215.1| helicase  [Plasmodium chabaudi chabaudi]
 emb|CAH74440.1| helicase, truncated, putative [Plasmodium chabaudi chabaudi]
Length=186

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -2

Query  769  RIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVAA  590
            RI +FVETK+  D IT+ LR++G PAL IHG+K QDER WVL++FK+G+SP++IATDVA+
Sbjct  21   RIIVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIATDVAS  80

Query  589  RGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQ  410
            RGLD+KD+K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKIL++
Sbjct  81   RGLDIKDVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILRE  140

Query  409  AGQIVPPQLSALA  371
            + Q +PPQL  ++
Sbjct  141  SEQPIPPQLEKIS  153



>ref|XP_003032253.1| hypothetical protein SCHCODRAFT_82297 [Schizophyllum commune 
H4-8]
 gb|EFI97350.1| hypothetical protein SCHCODRAFT_82297 [Schizophyllum commune 
H4-8]
Length=488

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D ITR LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  308  AKVLIFVGTKRVADDITRYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKDI  VINYDFP   EDY+HRIGRTGRAGAKGTA+T+FT  NAK ARELV IL 
Sbjct  368  SRGLDVKDIGYVINYDFPNNCEDYIHRIGRTGRAGAKGTAYTYFTTENAKSARELVSILT  427

Query  412  QAGQIVPPQLSALAC  368
            +A Q+VPP+L  +A 
Sbjct  428  EAKQVVPPELQEMAA  442



>gb|ETW56550.1| hypothetical protein PFUGPA_01340 [Plasmodium falciparum Palo 
Alto/Uganda]
Length=193

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -2

Query  769  RIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVAA  590
            RI +FVETKK  D IT+ LR+DG PAL IHG+K Q+ER WVL+EFK+G+SP+MIATDVA+
Sbjct  28   RIIVFVETKKNADFITKALRLDGMPALCIHGDKKQEERRWVLNEFKTGKSPIMIATDVAS  87

Query  589  RGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQ  410
            RGLD+K++K VIN+DFP  +EDYVHRIGRTGRAG+ G +FTF T    + A++LVKIL++
Sbjct  88   RGLDIKNVKYVINFDFPNQIEDYVHRIGRTGRAGSHGASFTFLTADKYRLAKDLVKILRE  147

Query  409  AGQIVPPQLSALA  371
            + Q VPPQL  ++
Sbjct  148  SEQPVPPQLEKIS  160



>ref|XP_001609970.1| p68-like protein [Babesia bovis]
 gb|EDO06402.1| p68-like protein [Babesia bovis]
Length=529

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  784  VMNGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIA  605
            +  G++I IF +TKK  D IT++LR+DGWPALSIHG+K Q+ER WVL+EFKSG+ P+M+A
Sbjct  351  IGQGTKILIFTDTKKTADSITKELRLDGWPALSIHGDKKQEERNWVLNEFKSGKHPIMVA  410

Query  604  TDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELV  425
            TDVA+RGLDV+D+K VIN+DFP  +EDYVHRIGRTGR G KG ++TF T    + ARELV
Sbjct  411  TDVASRGLDVRDVKVVINFDFPNQIEDYVHRIGRTGRGGNKGASYTFLTPDKNRVARELV  470

Query  424  KILQQAGQIVPPQLSALA  371
            K++++A Q + P+LS LA
Sbjct  471  KLMREAKQQISPELSKLA  488



>ref|XP_006521353.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Mus musculus]
Length=378

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  66   NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  125

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  126  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  185

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  186  EANQAINPKLMQL  198



>ref|XP_678450.1| helicase  [Plasmodium berghei strain ANKA]
 emb|CAH99688.1| helicase, truncated, putative [Plasmodium berghei]
Length=187

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -2

Query  769  RIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVAA  590
            RI +FVETK+  D IT+ LR++G PAL IHG+K QDER WVL++FK+G+SP++IATDVA+
Sbjct  21   RIIVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIATDVAS  80

Query  589  RGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQ  410
            RGLD+K++K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKIL++
Sbjct  81   RGLDIKNVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILRE  140

Query  409  AGQIVPPQLSALA  371
            + Q +PPQL  ++
Sbjct  141  SEQPIPPQLEKIS  153



>ref|XP_729738.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21303.1| Helicase conserved C-terminal domain, putative [Plasmodium yoelii 
yoelii]
Length=212

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -2

Query  769  RIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVAA  590
            RI +FVETK+  D IT+ LR++G PAL IHG+K QDER WVL++FK+G+SP++IATDVA+
Sbjct  34   RIIVFVETKRSADFITKALRLEGMPALCIHGDKKQDERRWVLNDFKTGKSPILIATDVAS  93

Query  589  RGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQ  410
            RGLD+K++K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKIL++
Sbjct  94   RGLDIKNVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILRE  153

Query  409  AGQIVPPQLSALA  371
            + Q +PPQL  ++
Sbjct  154  SEQPIPPQLEKIS  166



>gb|KJA13443.1| hypothetical protein HYPSUDRAFT_73013 [Hypholoma sublateritium 
FD-334 SS-4]
Length=482

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATDVA
Sbjct  292  AKVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATDVA  351

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  N+K ARELV IL+
Sbjct  352  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNSKCARELVGILK  411

Query  412  QAGQIVPPQLSALAC  368
            +A  IVPPQL  +A 
Sbjct  412  EAKAIVPPQLEEMAS  426



>gb|EGN99017.1| hypothetical protein SERLA73DRAFT_137127 [Serpula lacrymans var. 
lacrymans S7.3]
Length=332

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  189  AKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  248

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL+
Sbjct  249  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELIGILR  308

Query  412  QAGQIVPPQLSALA  371
            +A   VPPQL  +A
Sbjct  309  EAKANVPPQLEEMA  322



>ref|XP_006958620.1| p68 RNA helicase [Wallemia sebi CBS 633.66]
 gb|EIM21267.1| p68 RNA helicase [Wallemia sebi CBS 633.66]
Length=546

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IF+ TK+  D +T+ LR DGWPAL+IHG+K Q ER WVLSEFKSGRSP+M+ATDVA
Sbjct  368  AKVLIFIGTKRIADDLTKYLRQDGWPALAIHGDKQQQERDWVLSEFKSGRSPIMLATDVA  427

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKDI  VINYDF + +EDY+HRIGRTGRAG KGT+ TFFT  NAK +R+LVKIL+
Sbjct  428  SRGLDVKDIGYVINYDFSSNVEDYIHRIGRTGRAGTKGTSITFFTTENAKSSRDLVKILR  487

Query  412  QAGQIVPPQLSALAC  368
            +A Q VPP+L  +A 
Sbjct  488  EANQNVPPELEEMAS  502



>gb|KIM84767.1| hypothetical protein PILCRDRAFT_96565 [Piloderma croceum F 1598]
Length=482

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  308  AKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK ARELV IL+
Sbjct  368  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELVTILR  427

Query  412  QAGQIVPPQLSALA  371
            +A  +VPPQL  +A
Sbjct  428  EAKAVVPPQLEEMA  441



>emb|CCM04686.1| predicted protein [Fibroporia radiculosa]
Length=755

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATDVA
Sbjct  574  AKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATDVA  633

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL+
Sbjct  634  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELISILR  693

Query  412  QAGQIVPPQLSALA  371
            +A  IVPPQL  +A
Sbjct  694  EAKAIVPPQLEEMA  707



>ref|XP_006459201.1| hypothetical protein AGABI2DRAFT_65810 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV49124.1| hypothetical protein AGABI2DRAFT_65810 [Agaricus bisporus var. 
bisporus H97]
Length=494

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  308  AKVLIFVGTKRIADDITKYLRTDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL+
Sbjct  368  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTENAKAARELINILR  427

Query  412  QAGQIVPPQLSALAC  368
            +A  ++PPQL  +A 
Sbjct  428  EAKAVIPPQLEEMAA  442



>ref|XP_007330446.1| hypothetical protein AGABI1DRAFT_100622 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78570.1| hypothetical protein AGABI1DRAFT_100622 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=494

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  308  AKVLIFVGTKRIADDITKYLRTDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL+
Sbjct  368  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTENAKAARELINILR  427

Query  412  QAGQIVPPQLSALAC  368
            +A  ++PPQL  +A 
Sbjct  428  EAKAVIPPQLEEMAA  442



>gb|KDQ24573.1| hypothetical protein PLEOSDRAFT_1090372 [Pleurotus ostreatus 
PC15]
Length=523

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATDVA
Sbjct  343  AKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATDVA  402

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG  GT++T+FT  NAK ARELV IL+
Sbjct  403  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMTGTSYTYFTTDNAKSARELVGILR  462

Query  412  QAGQIVPPQLSALA  371
            +A  ++PPQL  + 
Sbjct  463  EAKAVIPPQLEEMT  476



>gb|KIK57769.1| hypothetical protein GYMLUDRAFT_45959 [Gymnopus luxurians FD-317 
M1]
Length=492

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATDVA
Sbjct  308  AKVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT+FT+FT  N+K ARELV IL+
Sbjct  368  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSFTYFTTDNSKQARELVSILK  427

Query  412  QAGQIVPPQLSALA  371
            +A   +PPQL  +A
Sbjct  428  EAKATIPPQLEEMA  441



>ref|XP_002140793.1| DEAD/DEAH box helicase family protein [Cryptosporidium muris 
RN66]
 gb|EEA06444.1| DEAD/DEAH box helicase family protein [Cryptosporidium muris 
RN66]
Length=562

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = -2

Query  784  VMNG--SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVM  611
            VMN   S++ IF ETKKG D +TR+LR++GWPAL IHG+K Q+ER WVL+EF++G SP+M
Sbjct  391  VMNSPTSKVLIFCETKKGADILTRELRLEGWPALCIHGDKKQEERTWVLNEFRNGTSPIM  450

Query  610  IATDVAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARE  431
            IATDVAARGLDVKDI  V+NYDFP  +EDY+HRIGRTGRAGA G + +FFT    + A +
Sbjct  451  IATDVAARGLDVKDITFVVNYDFPNQMEDYIHRIGRTGRAGASGVSLSFFTADKCRLAND  510

Query  430  LVKILQQAGQIVPPQLSALAC  368
            LV++L++A Q +PP+L+ L  
Sbjct  511  LVRVLREAKQDIPPELTKLGT  531



>ref|XP_008039863.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW57832.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=494

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  308  AKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD++ VINYDFP   EDY+HRIGRTGRAG  GT+FT+FT  NAK AREL+ IL+
Sbjct  368  SRGLDVKDVRYVINYDFPNNCEDYIHRIGRTGRAGTTGTSFTYFTTDNAKQARELIGILK  427

Query  412  QAGQIVPPQLSALA  371
            +A  +VPPQL  ++
Sbjct  428  EAKAVVPPQLEEMS  441



>ref|XP_007414813.1| hypothetical protein MELLADRAFT_78893 [Melampsora larici-populina 
98AG31]
 gb|EGG01979.1| hypothetical protein MELLADRAFT_78893 [Melampsora larici-populina 
98AG31]
Length=537

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D +T+ LR DGWP+L+IHG+K Q ER WVL EFKSGRSP+MIATDVA
Sbjct  354  AKVLIFVGTKRVADDLTKYLRQDGWPSLAIHGDKQQTERDWVLGEFKSGRSPIMIATDVA  413

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYD P  +EDY+HRIGRTGRAG  GTA+++ +    K ARELVKILQ
Sbjct  414  SRGLDVKDVAYVINYDMPNGIEDYIHRIGRTGRAGRTGTAYSYISADQGKLARELVKILQ  473

Query  412  QAGQIVPPQLSALAC  368
             A Q+VPP L  L+ 
Sbjct  474  DAKQVVPPALVELSS  488



>ref|XP_007008272.1| hypothetical protein TREMEDRAFT_46029 [Tremella mesenterica DSM 
1558]
 gb|EIW65766.1| hypothetical protein TREMEDRAFT_46029 [Tremella mesenterica DSM 
1558]
Length=558

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D +T+ LR DGWPAL+IHG+K Q ER WVLSEFKSGRSP+MIATDVA
Sbjct  376  AKVLIFVGTKRVADDLTKHLRTDGWPALAIHGDKQQGERDWVLSEFKSGRSPIMIATDVA  435

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RG+DV+DIK VINYDFP   EDYVHRIGRTGRAG  GTA+TFFT  N+K ARELV IL+
Sbjct  436  SRGIDVRDIKYVINYDFPNNCEDYVHRIGRTGRAGQTGTAYTFFTADNSKSARELVGILR  495

Query  412  QAGQIVPPQLSALA  371
            ++   +PP+L+ +A
Sbjct  496  ESKADIPPELAEMA  509



>ref|XP_007370735.1| DEAD-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF56503.1| DEAD-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=487

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVLSEFK+GRSP++IATDVA
Sbjct  308  AKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLSEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD++ VINYDFP   EDY+HRIGRTGRAG  GT++T+FT  NAK AREL+ IL+
Sbjct  368  SRGLDVKDVRYVINYDFPNNCEDYIHRIGRTGRAGMTGTSYTYFTTDNAKQARELIGILR  427

Query  412  QAGQIVPPQLSALA  371
            +A   VPPQL  ++
Sbjct  428  EAKAHVPPQLEEMS  441



>gb|EXX56938.1| Dbp2p [Rhizophagus irregularis DAOM 197198w]
Length=601

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IF  TK+  D+IT+ LR DGWPAL+IHG+K Q ER WVLSEF+SG+SP+M+ATDVA
Sbjct  441  NKTLIFTGTKRTADEITKYLRQDGWPALAIHGDKAQSERDWVLSEFRSGKSPIMVATDVA  500

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RG+DVKD+K VINYDFPT +EDYVHRIGRTGR GAKG+A TFFT  NAK A++LV IL+
Sbjct  501  SRGIDVKDVKLVINYDFPTNVEDYVHRIGRTGRGGAKGSATTFFTMDNAKQAKDLVNILR  560

Query  412  QAGQIVPPQLSALA  371
            +A Q V P+L+ LA
Sbjct  561  EANQEVDPKLADLA  574



>gb|KIM24458.1| hypothetical protein M408DRAFT_75932 [Serendipita vermifera MAFF 
305830]
Length=493

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 109/136 (80%), Gaps = 1/136 (1%)
 Frame = -2

Query  778  NGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  599
            NG ++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL+EFK+GRSP++IATD
Sbjct  307  NG-KVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLAEFKAGRSPILIATD  365

Query  598  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  419
            VA+RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG  GTA+T+ T  N+K A ELV I
Sbjct  366  VASRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGKFGTAYTYLTTENSKIAHELVAI  425

Query  418  LQQAGQIVPPQLSALA  371
            L++A Q+VPPQL  ++
Sbjct  426  LREAKQVVPPQLEEMS  441



>gb|KIM40445.1| hypothetical protein M413DRAFT_73199 [Hebeloma cylindrosporum 
h7]
Length=489

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR +GWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  308  AKVLIFVATKRVADDITKYLRQEGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK AREL+ IL+
Sbjct  368  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELIGILR  427

Query  412  QAGQIVPPQLSALAC  368
            +A  IVPPQL  +A 
Sbjct  428  EAKAIVPPQLEEMAS  442



>gb|KGB75854.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii R265]
 gb|KIR28590.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii LA55]
 gb|KIR35255.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii MMRL2647]
 gb|KIR40335.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii Ram5]
 gb|KIR93608.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii CBS 10090]
 gb|KIY58576.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii 99/473]
Length=539

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = -2

Query  778  NGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  599
            NG ++ IFV TK+  D +T+ LRMDGWPAL+IHG+K Q ER WVL+EFKSGRSP+M+ATD
Sbjct  354  NG-KVLIFVATKRVADDLTKFLRMDGWPALAIHGDKQQAERDWVLAEFKSGRSPIMLATD  412

Query  598  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  419
            VA+RGLDV+DI  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  N+K ARELV+I
Sbjct  413  VASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMDNSKSARELVQI  472

Query  418  LQQAGQIVPPQLSALA  371
            L+++  ++PP+L  +A
Sbjct  473  LRESKAVIPPELEEMA  488



>gb|EDM15798.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isoform CRA_b [Rattus 
norvegicus]
Length=523

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  211  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  270

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  271  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  330

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  331  EANQAINPKLMQL  343



>gb|KIR99876.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii 2001/935-1]
Length=543

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = -2

Query  778  NGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  599
            NG ++ IFV TK+  D +T+ LRMDGWPAL+IHG+K Q ER WVL+EFKSGRSP+M+ATD
Sbjct  358  NG-KVLIFVATKRVADDLTKFLRMDGWPALAIHGDKQQAERDWVLAEFKSGRSPIMLATD  416

Query  598  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  419
            VA+RGLDV+DI  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  N+K ARELV+I
Sbjct  417  VASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMDNSKSARELVQI  476

Query  418  LQQAGQIVPPQLSALA  371
            L+++  ++PP+L  +A
Sbjct  477  LRESKAVIPPELEEMA  492



>gb|EMS23120.1| ATP-dependent rna helicase dbp2 [Rhodosporidium toruloides NP11]
 emb|CDR46482.1| RHTO0S12e04984g1_1 [Rhodosporidium toruloides]
Length=547

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IF+ TK+  D +T+ LR DGWPAL+IHG+K Q ER WVL EFKSGRSP+MIATDVA
Sbjct  364  AKVLIFIATKRVADDLTKYLRQDGWPALAIHGDKAQQERDWVLGEFKSGRSPIMIATDVA  423

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKDI  VINYD P  +EDY+HRIGRTGRAGAKGTA+++ T    + A++LVKILQ
Sbjct  424  SRGLDVKDIGYVINYDMPNGIEDYIHRIGRTGRAGAKGTAYSYVTPDQGRIAKDLVKILQ  483

Query  412  QAGQIVPPQLSALA  371
             A Q+VPPQL  +A
Sbjct  484  DAKQVVPPQLQEIA  497



>gb|KIR72047.1| ATP-dependent RNA helicase DBP2-A [Cryptococcus gattii CA1014]
Length=612

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = -2

Query  778  NGSRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATD  599
            NG ++ IFV TK+  D +T+ LRMDGWPAL+IHG+K Q ER WVL+EFKSGRSP+M+ATD
Sbjct  427  NG-KVLIFVATKRVADDLTKFLRMDGWPALAIHGDKQQAERDWVLAEFKSGRSPIMLATD  485

Query  598  VAARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKI  419
            VA+RGLDV+DI  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  N+K ARELV+I
Sbjct  486  VASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMDNSKSARELVQI  545

Query  418  LQQAGQIVPPQLSALA  371
            L+++  ++PP+L  +A
Sbjct  546  LRESKAVIPPELEEMA  561



>gb|KFP69316.1| putative ATP-dependent RNA helicase DDX17, partial [Acanthisitta 
chloris]
Length=415

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  272  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  331

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  332  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  391

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  392  EANQAINPKLMQL  404



>ref|NP_001082679.1| DEAD (Asp-Glu-Ala-Asp) box helicase 17 [Xenopus laevis]
 gb|AAH80992.1| LOC398649 protein [Xenopus laevis]
Length=610

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD++TR++R DGWPA+ IHG+K+Q ER WVL EF++G++P++IATDVA
Sbjct  330  NKTIIFVETKRRCDELTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVA  389

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+DIK VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K ARELVK+L+
Sbjct  390  SRGLDVEDIKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELVKVLE  449

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  450  EANQTINPKLMQL  462



>gb|KII89609.1| hypothetical protein PLICRDRAFT_158683 [Plicaturopsis crispa 
FD-325 SS-3]
Length=493

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  308  AKVLIFVGTKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RG+DVKD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK ARELV IL+
Sbjct  368  SRGIDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGNKGISYTYFTTDNAKSARELVGILR  427

Query  412  QAGQIVPPQLSALA  371
            +A  ++PPQL  +A
Sbjct  428  EANAVIPPQLEEMA  441



>dbj|BAE87553.1| unnamed protein product [Macaca fascicularis]
Length=396

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKGQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>gb|EAW60248.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isoform CRA_h [Homo 
sapiens]
Length=547

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>ref|XP_009436590.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X3 [Pan troglodytes]
Length=549

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>ref|XP_009073300.1| PREDICTED: probable ATP-dependent RNA helicase DDX17, partial 
[Acanthisitta chloris]
Length=476

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  273  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  332

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  333  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  392

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  393  EANQAINPKLMQL  405



>ref|XP_004563118.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X3 [Maylandia zebra]
Length=498

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETKK CD +TR++R DGWPA+ IHG+K+Q ER WVLSEF+SG++P++IATDVA
Sbjct  342  NKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLSEFRSGKAPILIATDVA  401

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDY+HRIGRT R+  KGTA+TFFT GN + AREL+++L+
Sbjct  402  SRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTNKGTAYTFFTPGNLRQARELIRVLE  461

Query  412  QAGQIVPPQLSALA  371
            +A Q + P+L  LA
Sbjct  462  EARQAINPKLLQLA  475



>ref|XP_004610567.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Sorex araneus]
Length=547

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>ref|XP_004700310.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Echinops 
telfairi]
Length=558

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>ref|XP_010565532.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Haliaeetus leucocephalus]
Length=574

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  257  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  316

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  317  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  376

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  377  EANQAINPKLMQL  389



>ref|XP_009880187.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Charadrius 
vociferus]
Length=569

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>ref|XP_004311417.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Tursiops 
truncatus]
Length=549

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>ref|XP_006174954.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Camelus 
ferus]
 ref|XP_006207147.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Vicugna 
pacos]
Length=549

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>ref|XP_008067650.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X3 [Tarsius syrichta]
Length=550

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  237  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  296

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  297  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  356

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  357  EANQAINPKLMQL  369



>ref|XP_003745440.1| PREDICTED: probable ATP-dependent RNA helicase DDX5-like [Metaseiulus 
occidentalis]
Length=510

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  +F ETK+  D+ITR++R DGWPA+ IHG+K Q ER WVL EF+SG+SP+++ATDVA
Sbjct  337  NKTIVFAETKRKVDEITRRMRRDGWPAMCIHGDKAQQERDWVLHEFRSGKSPILVATDVA  396

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            ARGLDV D+K VINYD+P C EDYVHRIGRT R+   GTA+TFFT  NAK A+EL+ +LQ
Sbjct  397  ARGLDVDDVKFVINYDYPNCSEDYVHRIGRTARSNKTGTAYTFFTSNNAKQAQELIDVLQ  456

Query  412  QAGQIVPPQLSALA  371
            +A Q+V P+L  LA
Sbjct  457  EAKQVVNPKLYELA  470



>gb|EOB03912.1| Putative ATP-dependent RNA helicase DDX17, partial [Anas platyrhynchos]
Length=599

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  323  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  382

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  383  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  442

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  443  EANQAINPKLMQL  455



>ref|XP_009336746.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
 ref|XP_009336748.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=140

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -2

Query  709  MDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVAARGLDVKDIKCVINYDFPTCL  530
            MDGWPALSIHG+K+Q ER WVLS+FK+G+SP+M ATDVAARGLDVKD+K VINYDFP  L
Sbjct  1    MDGWPALSIHGDKSQAERDWVLSKFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSL  60

Query  529  EDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIVPPQLSALA  371
            EDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ V P+L+A+ 
Sbjct  61   EDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQKVSPELAAMG  113



>gb|KIK28896.1| hypothetical protein PISMIDRAFT_90259 [Pisolithus microcarpus 
441]
Length=484

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            +++ IFV TK+  D IT+ LR DGWPAL+IHG+K Q ER WVL EFK+GRSP++IATDVA
Sbjct  308  AKVLIFVATKRVADDITKYLRQDGWPALAIHGDKEQRERDWVLGEFKAGRSPILIATDVA  367

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK ARELV IL+
Sbjct  368  SRGLDVKDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELVSILR  427

Query  412  QAGQIVPPQLSALA  371
            +A   +PPQL  +A
Sbjct  428  EARANIPPQLEEMA  441



>ref|XP_009566745.1| PREDICTED: probable ATP-dependent RNA helicase DDX17, partial 
[Cuculus canorus]
Length=609

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  325  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  384

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  385  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  444

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  445  EANQAINPKLMQL  457



>gb|ETE72827.1| putative ATP-dependent RNA helicase DDX17 [Ophiophagus hannah]
Length=610

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  297  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  356

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  357  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  416

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  417  EANQAINPKLMQL  429



>ref|XP_002769661.1| RNA-dependent helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER02379.1| RNA-dependent helicase, putative [Perkinsus marinus ATCC 50983]
Length=310

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IF +TK+G D ITR LR DGWPALSIHG+K Q ER WVL++FK+GRS +MIATDVA
Sbjct  100  AKTLIFCDTKRGADDITRLLRRDGWPALSIHGDKKQSERDWVLNQFKTGRSAIMIATDVA  159

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDVKD+K VINYDFP  +EDYVHRIGRTGRAGA G A++FF+    K AR+LV  L+
Sbjct  160  SRGLDVKDVKYVINYDFPGTIEDYVHRIGRTGRAGASGVAYSFFSPDKGKLARQLVNCLR  219

Query  412  QAGQIVPPQLSALA  371
            +A Q VP  L  +A
Sbjct  220  EANQSVPEALETIA  233



>ref|XP_004563116.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X1 [Maylandia zebra]
Length=623

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETKK CD +TR++R DGWPA+ IHG+K+Q ER WVLSEF+SG++P++IATDVA
Sbjct  342  NKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLSEFRSGKAPILIATDVA  401

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDY+HRIGRT R+  KGTA+TFFT GN + AREL+++L+
Sbjct  402  SRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTNKGTAYTFFTPGNLRQARELIRVLE  461

Query  412  QAGQIVPPQLSALA  371
            +A Q + P+L  LA
Sbjct  462  EARQAINPKLLQLA  475



>ref|XP_009481222.1| PREDICTED: probable ATP-dependent RNA helicase DDX17, partial 
[Pelecanus crispus]
Length=595

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  323  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  382

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  383  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  442

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  443  EANQAINPKLMQL  455



>ref|XP_010341891.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Saimiri 
boliviensis boliviensis]
Length=587

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  275  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  334

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  335  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  394

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  395  EANQAINPKLMQL  407



>ref|XP_008634834.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Corvus 
brachyrhynchos]
Length=607

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  336  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  395

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  396  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  455

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  456  EANQAINPKLMQL  468



>ref|XP_010145760.1| PREDICTED: probable ATP-dependent RNA helicase DDX17, partial 
[Eurypyga helias]
Length=596

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -2

Query  772  SRIXIFVETKKGCDQITRQLRMDGWPALSIHGNKNQDERVWVLSEFKSGRSPVMIATDVA  593
            ++  IFVETK+ CD +TR++R DGWPA+ IHG+K+Q ER WVL+EF+SG++P++IATDVA
Sbjct  323  NKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA  382

Query  592  ARGLDVKDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQ  413
            +RGLDV+D+K VINYD+P   EDYVHRIGRT R+  KGTA+TFFT GN K AREL+K+L+
Sbjct  383  SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE  442

Query  412  QAGQIVPPQLSAL  374
            +A Q + P+L  L
Sbjct  443  EANQAINPKLMQL  455



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150