BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003L22

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI25984.3|  unnamed protein product                                371   5e-127   Vitis vinifera
ref|XP_002302788.1|  hypothetical protein POPTR_0002s19210g             369   6e-127   Populus trichocarpa [western balsam poplar]
ref|XP_008777957.1|  PREDICTED: ADP-ribosylation factor                 369   8e-127   Phoenix dactylifera
gb|KHG04267.1|  ADP-ribosylation factor                                 371   9e-127   Gossypium arboreum [tree cotton]
ref|XP_007205794.1|  hypothetical protein PRUPE_ppa010615mg             371   1e-126   
gb|KJB11520.1|  hypothetical protein B456_001G263300                    369   1e-126   Gossypium raimondii
ref|NP_001236384.1|  uncharacterized protein LOC100306021               368   2e-126   Glycine max [soybeans]
emb|CDP13175.1|  unnamed protein product                                369   2e-126   Coffea canephora [robusta coffee]
gb|KDP28302.1|  hypothetical protein JCGZ_14073                         368   2e-126   Jatropha curcas
gb|EYU46846.1|  hypothetical protein MIMGU_mgv1a014704mg                368   2e-126   Erythranthe guttata [common monkey flower]
gb|KHN00225.1|  ADP-ribosylation factor 2                               368   2e-126   Glycine soja [wild soybean]
gb|ADH44695.1|  ADP-ribosylation factor                                 368   2e-126   Salvia miltiorrhiza [Chinese salvia]
gb|KJB24452.1|  hypothetical protein B456_004G146100                    368   2e-126   Gossypium raimondii
ref|NP_001290536.1|  uncharacterized protein LOC105052388               368   2e-126   Elaeis guineensis
gb|AAD17207.1|  ADP-ribosylation factor                                 368   2e-126   Glycine max [soybeans]
ref|XP_004288363.1|  PREDICTED: ADP-ribosylation factor 2-like          368   2e-126   Fragaria vesca subsp. vesca
ref|XP_003536036.1|  PREDICTED: ADP-ribosylation factor-like isof...    368   2e-126   
ref|XP_002318935.1|  hypothetical protein POPTR_0013s00700g             368   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_002892585.1|  ADP-ribosylation factor                            368   3e-126   Arabidopsis lyrata subsp. lyrata
gb|AGV54515.1|  ADP ribosylation factor                                 370   3e-126   Phaseolus vulgaris [French bean]
ref|XP_011040674.1|  PREDICTED: ADP-ribosylation factor-like isof...    368   3e-126   Populus euphratica
ref|XP_011003178.1|  PREDICTED: ADP-ribosylation factor-like isof...    368   3e-126   Populus euphratica
ref|XP_009121644.1|  PREDICTED: ADP-ribosylation factor 2               368   3e-126   Brassica rapa
ref|XP_010092942.1|  ADP-ribosylation factor 2                          368   3e-126   
ref|XP_004494449.1|  PREDICTED: ADP-ribosylation factor 2-like          367   3e-126   Cicer arietinum [garbanzo]
ref|XP_004304633.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    367   4e-126   Fragaria vesca subsp. vesca
emb|CDX95712.1|  BnaC03g25930D                                          368   4e-126   
ref|XP_006480700.1|  PREDICTED: ADP-ribosylation factor 2-like is...    367   4e-126   Citrus sinensis [apfelsine]
ref|XP_010524305.1|  PREDICTED: ADP-ribosylation factor-like            367   4e-126   Tarenaya hassleriana [spider flower]
ref|XP_008812250.1|  PREDICTED: ADP-ribosylation factor 2-like          367   4e-126   Phoenix dactylifera
ref|XP_008806237.1|  PREDICTED: ADP-ribosylation factor 2-like          367   4e-126   Phoenix dactylifera
ref|XP_006361664.1|  PREDICTED: ADP-ribosylation factor 2-like is...    367   4e-126   Solanum tuberosum [potatoes]
ref|XP_010659724.1|  PREDICTED: ADP-ribosylation factor isoform X1      367   4e-126   Vitis vinifera
ref|XP_003626009.1|  ADP-ribosylation factor-like protein               368   4e-126   
ref|XP_011038977.1|  PREDICTED: ADP-ribosylation factor-like            367   5e-126   Populus euphratica
ref|XP_004252939.1|  PREDICTED: ADP-ribosylation factor 2               367   5e-126   Solanum lycopersicum
gb|KJB11518.1|  hypothetical protein B456_001G263300                    368   5e-126   Gossypium raimondii
gb|EPS68301.1|  hypothetical protein M569_06468                         367   5e-126   Genlisea aurea
ref|XP_011087519.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    367   5e-126   
gb|AAT08648.1|  ADP-ribosylation factor                                 368   5e-126   Hyacinthus orientalis [common hyacinth]
gb|AEZ00866.1|  putative ADP-ribosylation factor protein                367   5e-126   Elaeis guineensis
ref|XP_010941504.1|  PREDICTED: ADP-ribosylation factor                 367   6e-126   Elaeis guineensis
gb|ACJ84691.1|  unknown                                                 367   6e-126   Medicago truncatula
ref|XP_010248146.1|  PREDICTED: ADP-ribosylation factor                 367   6e-126   Nelumbo nucifera [Indian lotus]
ref|XP_002265983.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    367   6e-126   Vitis vinifera
ref|NP_001055892.1|  Os05g0489600                                       367   6e-126   
ref|XP_010922923.1|  PREDICTED: ADP-ribosylation factor 2-like is...    367   6e-126   Elaeis guineensis
gb|KDP26602.1|  hypothetical protein JCGZ_17760                         367   6e-126   Jatropha curcas
ref|XP_010094415.1|  ADP-ribosylation factor 2                          368   6e-126   
ref|XP_003618207.1|  ADP-ribosylation factor                            369   7e-126   
ref|XP_006291918.1|  hypothetical protein CARUB_v10018102mg             367   7e-126   Capsella rubella
gb|ABR17508.1|  unknown                                                 367   7e-126   Picea sitchensis
ref|XP_010943658.1|  PREDICTED: ADP-ribosylation factor 2-like          367   8e-126   Elaeis guineensis
ref|XP_002457613.1|  hypothetical protein SORBIDRAFT_03g010350          367   8e-126   Sorghum bicolor [broomcorn]
ref|XP_003618209.1|  ADP-ribosylation factor                            367   8e-126   Medicago truncatula
ref|XP_006356426.1|  PREDICTED: ADP-ribosylation factor 2-like is...    367   8e-126   Solanum tuberosum [potatoes]
ref|XP_010553607.1|  PREDICTED: ADP-ribosylation factor 2-B             367   8e-126   Tarenaya hassleriana [spider flower]
ref|XP_008444322.1|  PREDICTED: ADP-ribosylation factor 2-like          367   8e-126   Cucumis melo [Oriental melon]
ref|NP_001275425.1|  ADP-ribosylation factor 2-like                     367   8e-126   Solanum tuberosum [potatoes]
ref|XP_006417443.1|  hypothetical protein EUTSA_v10008885mg             367   8e-126   Eutrema salsugineum [saltwater cress]
ref|XP_006488769.1|  PREDICTED: ADP-ribosylation factor-like            366   9e-126   Citrus sinensis [apfelsine]
ref|XP_004135253.1|  PREDICTED: ADP-ribosylation factor 2-like is...    367   9e-126   
gb|EYU19417.1|  hypothetical protein MIMGU_mgv1a014679mg                366   9e-126   Erythranthe guttata [common monkey flower]
ref|NP_001274832.1|  ADP-ribosylation factor 1-like protein             366   1e-125   Solanum tuberosum [potatoes]
sp|O48920.3|ARF_VIGUN  RecName: Full=ADP-ribosylation factor            366   1e-125   Vigna unguiculata
ref|XP_008389662.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    366   1e-125   Malus domestica [apple tree]
ref|NP_001280835.1|  ADP-ribosylation factor                            367   1e-125   Malus domestica [apple tree]
gb|EYU38402.1|  hypothetical protein MIMGU_mgv1a014684mg                366   1e-125   Erythranthe guttata [common monkey flower]
ref|XP_006305640.1|  hypothetical protein CARUB_v10010344mg             367   1e-125   
ref|XP_009612443.1|  PREDICTED: ADP-ribosylation factor                 366   1e-125   Nicotiana tomentosiformis
ref|NP_172533.2|  ADP-ribosylation factor A1F                           366   1e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009629758.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    369   1e-125   Nicotiana tomentosiformis
gb|KHG28118.1|  ARF2-B: ADP-ribosylation factor 2-B                     367   1e-125   Gossypium arboreum [tree cotton]
gb|ADP00406.1|  ADP-ribosylation factor                                 366   1e-125   Actinidia chinensis
ref|XP_009391635.1|  PREDICTED: ADP-ribosylation factor 2               366   1e-125   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK42466.1|  unknown                                                 366   1e-125   Lotus japonicus
ref|XP_006390885.1|  hypothetical protein EUTSA_v10019096mg             368   1e-125   
gb|KDO66124.1|  hypothetical protein CISIN_1g029675mg                   366   1e-125   Citrus sinensis [apfelsine]
gb|AIX10946.1|  putative ADP-ribosylation factor                        366   1e-125   Gardenia jasminoides
ref|XP_006399980.1|  hypothetical protein EUTSA_v10014797mg             366   1e-125   Eutrema salsugineum [saltwater cress]
ref|XP_004967765.1|  PREDICTED: ADP-ribosylation factor 2-like          366   1e-125   Setaria italica
gb|KJB81136.1|  hypothetical protein B456_013G131000                    367   2e-125   Gossypium raimondii
ref|XP_010319588.1|  PREDICTED: ADP-ribosylation factor                 366   2e-125   
gb|KHG04030.1|  ADP-ribosylation factor 2                               365   2e-125   Gossypium arboreum [tree cotton]
emb|CAD12855.1|  ADP-ribosylation factor                                365   2e-125   Gossypium hirsutum [American cotton]
ref|XP_009399937.1|  PREDICTED: ADP-ribosylation factor 2-like          365   2e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006344797.1|  PREDICTED: ADP-ribosylation factor 1-like is...    365   2e-125   Solanum tuberosum [potatoes]
gb|KJB31031.1|  hypothetical protein B456_005G181600                    365   2e-125   Gossypium raimondii
ref|XP_008443527.1|  PREDICTED: ADP-ribosylation factor 1-like          365   2e-125   Cucumis melo [Oriental melon]
emb|CDY47221.1|  BnaC09g14700D                                          365   2e-125   Brassica napus [oilseed rape]
ref|XP_010108788.1|  ADP-ribosylation factor                            365   2e-125   
ref|NP_191788.1|  ADP-ribosylation factor A1E                           365   2e-125   Arabidopsis thaliana [mouse-ear cress]
gb|AGH68504.1|  ADP-ribosylation factor                                 365   2e-125   Ipomoea batatas [batate]
ref|NP_177206.1|  ARF GTPase family protein                             365   2e-125   Arabidopsis thaliana [mouse-ear cress]
gb|ABD73294.1|  ADP-ribosylation factor-like protein                    365   2e-125   Panax ginseng [Asiatic ginseng]
ref|XP_007151018.1|  hypothetical protein PHAVU_004G011900g             365   2e-125   Phaseolus vulgaris [French bean]
emb|CDY09875.1|  BnaC09g42860D                                          367   3e-125   Brassica napus [oilseed rape]
emb|CDX69567.1|  BnaA10g19160D                                          366   3e-125   
ref|XP_009416365.1|  PREDICTED: ADP-ribosylation factor 1               365   3e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001044599.1|  Os01g0813400                                       365   3e-125   
ref|XP_004970328.1|  PREDICTED: ADP-ribosylation factor 1-like is...    365   3e-125   Setaria italica
ref|XP_007031496.1|  ADP-ribosylation factor A1F                        365   3e-125   Theobroma cacao [chocolate]
emb|CDX83340.1|  BnaA03g21660D                                          365   3e-125   
ref|XP_004228551.1|  PREDICTED: ADP-ribosylation factor 2-like          365   3e-125   Solanum lycopersicum
gb|KCW56002.1|  hypothetical protein EUGRSUZ_I01779                     365   3e-125   Eucalyptus grandis [rose gum]
ref|XP_006288755.1|  hypothetical protein CARUB_v10002073mg             365   3e-125   Capsella rubella
ref|NP_182239.1|  ADP-ribosylation factor 1                             365   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389142.1|  PREDICTED: ADP-ribosylation factor 1-like          365   3e-125   Musa acuminata subsp. malaccensis [pisang utan]
pdb|3AQ4|A  Chain A, Molecular Insights Into Plant Cell Prolifera...    365   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417875.1|  PREDICTED: ADP-ribosylation factor 1-like          365   3e-125   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT17349.1|  ADP-ribosylation factor 2                               365   3e-125   
ref|XP_010651474.1|  PREDICTED: ADP-ribosylation factor 2 isoform X2    365   3e-125   
ref|XP_009776781.1|  PREDICTED: ADP-ribosylation factor-like            365   3e-125   Nicotiana sylvestris
emb|CDM84658.1|  unnamed protein product                                365   3e-125   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002888469.1|  ADP-ribosylation factor                            365   3e-125   
ref|XP_006296139.1|  hypothetical protein CARUB_v10025292mg             365   4e-125   
ref|XP_010491587.1|  PREDICTED: ADP-ribosylation factor 1-like          365   4e-125   Camelina sativa [gold-of-pleasure]
ref|NP_001170436.1|  uncharacterized protein LOC100384428               365   4e-125   Zea mays [maize]
gb|KJB75878.1|  hypothetical protein B456_012G062700                    365   4e-125   Gossypium raimondii
ref|NP_001274834.1|  ARF-like small GTPase-like protein                 365   4e-125   Solanum tuberosum [potatoes]
ref|NP_001136508.1|  uncharacterized protein LOC100216623               365   4e-125   Zea mays [maize]
ref|XP_002876669.1|  ADP-ribosylation factor                            365   4e-125   
gb|KJB15578.1|  hypothetical protein B456_002G185200                    365   4e-125   Gossypium raimondii
gb|AFK39359.1|  unknown                                                 365   5e-125   Medicago truncatula
ref|XP_009375124.1|  PREDICTED: ADP-ribosylation factor 1-like          365   5e-125   Pyrus x bretschneideri [bai li]
ref|XP_002962225.1|  ARF family GTPase                                  365   5e-125   Selaginella moellendorffii
ref|XP_010660901.1|  PREDICTED: ADP-ribosylation factor isoform X1      365   5e-125   Vitis vinifera
gb|AAF17671.1|AC009398_20  F20B24.7                                     365   5e-125   Arabidopsis thaliana [mouse-ear cress]
sp|P51822.2|ARF1_DAUCA  RecName: Full=ADP-ribosylation factor 1         365   5e-125   Daucus carota [carrots]
gb|KDP46432.1|  hypothetical protein JCGZ_10272                         364   5e-125   Jatropha curcas
gb|KGN51378.1|  hypothetical protein Csa_5G524710                       365   5e-125   Cucumis sativus [cucumbers]
ref|XP_009110099.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    364   6e-125   Brassica rapa
ref|NP_001042668.1|  Os01g0265100                                       364   6e-125   
ref|XP_010232478.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    364   7e-125   Brachypodium distachyon [annual false brome]
emb|CDY47137.1|  BnaA08g05460D                                          364   7e-125   Brassica napus [oilseed rape]
ref|XP_010679455.1|  PREDICTED: ADP-ribosylation factor 2-B-like        364   7e-125   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS63688.1|  ADP-ribosylation factor 2                               364   7e-125   Triticum urartu
ref|XP_009113207.1|  PREDICTED: ADP-ribosylation factor 1-like          364   7e-125   Brassica rapa
ref|XP_010313707.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    364   7e-125   
ref|NP_001149117.1|  ADP-ribosylation factor                            364   8e-125   Zea mays [maize]
ref|XP_009595261.1|  PREDICTED: ADP-ribosylation factor 1-like          364   8e-125   Nicotiana tomentosiformis
ref|XP_002871626.1|  ADP-ribosylation factor A1B                        364   8e-125   Arabidopsis lyrata subsp. lyrata
dbj|BAJ87426.1|  predicted protein                                      364   8e-125   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW78462.1|  hypothetical protein ZEAMMB73_418055                    365   8e-125   
ref|XP_002521452.1|  ADP-ribosylation factor, arf, putative             364   9e-125   Ricinus communis
ref|XP_010492280.1|  PREDICTED: ADP-ribosylation factor isoform X1      364   9e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010551905.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    365   9e-125   Tarenaya hassleriana [spider flower]
ref|XP_010551906.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    364   9e-125   Tarenaya hassleriana [spider flower]
ref|NP_001051676.1|  Os03g0811900                                       363   1e-124   
ref|XP_009138731.1|  PREDICTED: ADP-ribosylation factor 1               363   1e-124   Brassica rapa
ref|XP_002277054.2|  PREDICTED: ADP-ribosylation factor isoform X2      363   1e-124   Vitis vinifera
ref|XP_002888782.1|  hypothetical protein ARALYDRAFT_476172             363   1e-124   
ref|XP_006416080.1|  hypothetical protein EUTSA_v10008884mg             363   1e-124   Eutrema salsugineum [saltwater cress]
ref|XP_004970327.1|  PREDICTED: ADP-ribosylation factor 1-like is...    363   1e-124   
gb|AFW67224.1|  hypothetical protein ZEAMMB73_332083                    364   1e-124   
ref|NP_196971.1|  ADP-ribosylation factor A1B                           363   1e-124   
ref|XP_002318934.1|  hypothetical protein POPTR_0013s00690g             363   2e-124   
gb|ACU16903.1|  unknown                                                 364   2e-124   Glycine max [soybeans]
gb|AAC98042.1|  Strong similarity to gb|M95166 ADP-ribosylation f...    363   2e-124   Arabidopsis thaliana [mouse-ear cress]
gb|AAO62347.1|  ARF1-like GTP-binding protein                           363   2e-124   Gossypium hirsutum [American cotton]
ref|XP_009118871.1|  PREDICTED: ADP-ribosylation factor 1-like          363   2e-124   Brassica rapa
gb|AFW78457.1|  hypothetical protein ZEAMMB73_418055                    363   3e-124   
ref|XP_009381359.1|  PREDICTED: ADP-ribosylation factor 1-like          363   3e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW67226.1|  hypothetical protein ZEAMMB73_332083                    365   3e-124   
ref|XP_002466220.1|  hypothetical protein SORBIDRAFT_01g003770          363   3e-124   Sorghum bicolor [broomcorn]
gb|ADB85106.1|  ADP ribosylation factor 002                             363   3e-124   Jatropha curcas
ref|XP_004981305.1|  PREDICTED: ADP-ribosylation factor-like isof...    364   3e-124   
ref|XP_009403841.1|  PREDICTED: ADP-ribosylation factor 1-like          362   3e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABY76246.1|  ADP-ribosylation factor                                 362   3e-124   Brassica napus [oilseed rape]
ref|XP_009110098.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    362   3e-124   Brassica rapa
gb|ACM67553.1|  ADP-ribosylation factor-like protein                    362   3e-124   Musa acuminata AAA Group [Cavendish banana]
gb|EMS51203.1|  ADP-ribosylation factor 2                               364   3e-124   Triticum urartu
gb|ACM67554.1|  ADP-ribosylation factor-like protein                    362   3e-124   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009115521.1|  PREDICTED: ADP-ribosylation factor 2-B             362   4e-124   
gb|ACF80896.1|  unknown                                                 362   4e-124   Zea mays [maize]
gb|AEX49947.1|  ADP-ribosylation factor 1                               362   4e-124   Haloxylon ammodendron
ref|XP_009393904.1|  PREDICTED: ADP-ribosylation factor 1-like          362   4e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011462890.1|  PREDICTED: ADP-ribosylation factor-like isof...    362   4e-124   Fragaria vesca subsp. vesca
ref|XP_004981306.1|  PREDICTED: ADP-ribosylation factor-like isof...    363   4e-124   
ref|XP_004158320.1|  PREDICTED: ADP-ribosylation factor 1-like          362   5e-124   
ref|NP_001237492.1|  uncharacterized protein LOC100499890               362   5e-124   Glycine max [soybeans]
ref|XP_001764375.1|  Arf1_5/ArfA-family small GTPase                    362   5e-124   
gb|AFW79615.1|  hypothetical protein ZEAMMB73_444016                    363   6e-124   
ref|XP_010674549.1|  PREDICTED: ADP-ribosylation factor-like isof...    362   7e-124   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004981304.1|  PREDICTED: ADP-ribosylation factor-like isof...    363   7e-124   
ref|XP_009133804.1|  PREDICTED: ADP-ribosylation factor 1-like          362   7e-124   Brassica rapa
ref|XP_009395959.1|  PREDICTED: ADP-ribosylation factor 1-like          362   8e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE66819.1|  hypothetical protein OsJ_23579                          365   8e-124   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92309.1|  hypothetical protein OsI_14032                          368   8e-124   Oryza sativa Indica Group [Indian rice]
gb|ABF74733.1|  ADP-ribosylation factor 1                               361   8e-124   Nicotiana benthamiana
ref|XP_009410044.1|  PREDICTED: ADP-ribosylation factor 1-like          361   8e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001776147.1|  Arf1_5/ArfA-family small GTPase                    361   8e-124   
ref|XP_009383762.1|  PREDICTED: ADP-ribosylation factor 1               361   9e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17658.1|  unknown                                                 361   9e-124   Picea sitchensis
ref|XP_003557370.1|  PREDICTED: ADP-ribosylation factor 1               361   1e-123   Brachypodium distachyon [annual false brome]
ref|NP_001059207.1|  Os07g0223400                                       361   1e-123   
sp|O23778.3|ARF1_CATRO  RecName: Full=ADP-ribosylation factor 1         361   1e-123   Catharanthus roseus [chatas]
ref|XP_001764701.1|  Arf1_5/ArfA-family small GTPase                    361   1e-123   
gb|AAU82112.1|  ADP-ribosylation factor                                 361   2e-123   Triticum aestivum [Canadian hard winter wheat]
gb|AAP69821.1|  ARF                                                     360   2e-123   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90396.1|  ADP-ribosylation factor                                368   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003613219.1|  ADP-ribosylation factor                            370   2e-123   
ref|XP_008443534.1|  PREDICTED: ADP-ribosylation factor 1-like is...    360   3e-123   Cucumis melo [Oriental melon]
ref|XP_003557369.1|  PREDICTED: ADP-ribosylation factor 1-like          360   3e-123   Brachypodium distachyon [annual false brome]
ref|NP_001168955.1|  uncharacterized protein LOC100382775               360   3e-123   Zea mays [maize]
ref|XP_002312302.1|  ADP-ribosylation factor family protein             360   3e-123   Populus trichocarpa [western balsam poplar]
ref|XP_009420958.1|  PREDICTED: ADP-ribosylation factor 1-like          360   3e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007224194.1|  hypothetical protein PRUPE_ppa017304mg             360   3e-123   
ref|NP_001105897.1|  ADP-ribosylation factor                            360   4e-123   
ref|XP_011462888.1|  PREDICTED: ADP-ribosylation factor-like isof...    361   4e-123   Fragaria vesca subsp. vesca
gb|AFW79619.1|  hypothetical protein ZEAMMB73_444016                    363   4e-123   
gb|EAY73411.1|  hypothetical protein OsI_01294                          361   5e-123   Oryza sativa Indica Group [Indian rice]
gb|KJB09503.1|  hypothetical protein B456_001G146100                    359   5e-123   Gossypium raimondii
gb|EEE66818.1|  hypothetical protein OsJ_23578                          362   6e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EMT22177.1|  ADP-ribosylation factor                                 362   6e-123   
ref|XP_010674548.1|  PREDICTED: ADP-ribosylation factor-like isof...    359   6e-123   
gb|ACG31280.1|  ADP-ribosylation factor 1                               359   7e-123   Zea mays [maize]
ref|XP_005643690.1|  ADP-ribosylation factor 1                          359   7e-123   Coccomyxa subellipsoidea C-169
ref|XP_001764700.1|  predicted protein                                  359   8e-123   
ref|XP_002314987.1|  ADP-ribosylation factor family protein             359   8e-123   Populus trichocarpa [western balsam poplar]
ref|XP_001776112.1|  Arf1_5/ArfA-family small GTPase                    358   9e-123   
ref|XP_009394868.1|  PREDICTED: ADP-ribosylation factor 1-like          358   1e-122   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAT08663.1|  ADP-ribosylation factor                                 358   1e-122   Hyacinthus orientalis [common hyacinth]
ref|XP_006438364.1|  hypothetical protein CICLE_v10032807mg             358   2e-122   
ref|XP_001776146.1|  predicted protein                                  358   2e-122   
ref|XP_004141190.1|  PREDICTED: ADP-ribosylation factor 1-like          365   2e-122   
ref|XP_010694842.1|  PREDICTED: ADP-ribosylation factor 1-like          358   2e-122   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW56007.1|  hypothetical protein EUGRSUZ_I01779                     357   3e-122   Eucalyptus grandis [rose gum]
emb|CBI39638.3|  unnamed protein product                                372   3e-122   Vitis vinifera
sp|P51821.2|ARF1_CHLRE  RecName: Full=ADP-ribosylation factor 1         357   4e-122   Chlamydomonas reinhardtii
ref|XP_008223454.1|  PREDICTED: ADP-ribosylation factor-like            357   4e-122   Prunus mume [ume]
gb|ACU13131.1|  unknown                                                 357   5e-122   Glycine max [soybeans]
gb|AAO63779.1|  ADP-ribosylation factor 1                               357   6e-122   Populus tremuloides
gb|ABR25719.1|  ADP-ribosylation factor 1                               356   8e-122   Oryza sativa Indica Group [Indian rice]
ref|XP_009105711.1|  PREDICTED: ADP-ribosylation factor 2-B-like        356   1e-121   Brassica rapa
ref|XP_007147411.1|  hypothetical protein PHAVU_006G122200g             353   1e-120   Phaseolus vulgaris [French bean]
ref|XP_003055413.1|  predicted protein                                  353   1e-120   Micromonas pusilla CCMP1545
ref|XP_001420856.1|  predicted protein                                  352   3e-120   Ostreococcus lucimarinus CCE9901
dbj|BAK00965.1|  predicted protein                                      352   4e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEF99966.1|  Small GTPase superfamily, ARF/SAR type                 353   5e-120   Ostreococcus tauri
ref|XP_003533111.1|  PREDICTED: ADP-ribosylation factor 2-B-like        352   6e-120   Glycine max [soybeans]
ref|XP_002973399.1|  ARF family GTPase                                  351   8e-120   Selaginella moellendorffii
gb|KIY96152.1|  ADP-ribosylation factor 1                               351   1e-119   Monoraphidium neglectum
ref|XP_003578999.1|  PREDICTED: ADP-ribosylation factor 1-like          351   1e-119   Brachypodium distachyon [annual false brome]
ref|XP_005845590.1|  hypothetical protein CHLNCDRAFT_49011              350   2e-119   Chlorella variabilis
gb|AGT16095.1|  ADP-ribosylation factor                                 350   2e-119   Saccharum hybrid cultivar R570
gb|KIY94970.1|  ADP-ribosylation factor 1                               350   3e-119   Monoraphidium neglectum
gb|EYU46843.1|  hypothetical protein MIMGU_mgv1a020290mg                348   1e-118   Erythranthe guttata [common monkey flower]
sp|P51824.2|ARF1_SOLTU  RecName: Full=ADP-ribosylation factor 1         346   2e-117   Solanum tuberosum [potatoes]
ref|XP_001690893.1|  small ARF-related GTPase                           345   2e-117   Chlamydomonas reinhardtii
ref|XP_006302886.1|  hypothetical protein CARUB_v10021017mg             343   1e-116   Capsella rubella
gb|EAZ29027.1|  hypothetical protein OsJ_13076                          343   2e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003591353.1|  ADP ribosylation factor                            342   3e-116   
gb|ACJ85257.1|  unknown                                                 342   5e-116   Medicago truncatula
ref|XP_009104952.1|  PREDICTED: ADP-ribosylation factor 2-B-like        341   8e-116   Brassica rapa
emb|CDH50625.1|  adp-ribosylation factor                                341   8e-116   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDX68343.1|  BnaA07g23830D                                          341   1e-115   
ref|XP_003618208.1|  ADP-ribosylation factor                            340   2e-115   
ref|XP_005830635.1|  hypothetical protein GUITHDRAFT_95331              340   2e-115   Guillardia theta CCMP2712
emb|CDS06496.1|  Putative ADP-ribosylation factor 1                     340   2e-115   Lichtheimia ramosa
ref|XP_006419277.1|  hypothetical protein CICLE_v10006079mg             339   2e-115   
gb|AAF79587.1|AC007945_7  F28C11.12                                     342   3e-115   Arabidopsis thaliana [mouse-ear cress]
gb|KFH64649.1|  ADP-ribosylation factor                                 339   4e-115   Mortierella verticillata NRRL 6337
emb|CDH54768.1|  adp-ribosylation factor                                339   6e-115   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH53772.1|  adp-ribosylation factor 2-like                         338   9e-115   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005760428.1|  ADP-ribosylation factor                            338   1e-114   Emiliania huxleyi CCMP1516
emb|CDY23500.1|  BnaC06g24690D                                          338   3e-114   Brassica napus [oilseed rape]
gb|KHG28117.1|  ADP-ribosylation factor 2                               350   3e-114   Gossypium arboreum [tree cotton]
ref|XP_009269147.1|  ADP-ribosylation factor                            337   3e-114   Wallemia ichthyophaga EXF-994
gb|KHG02135.1|  ADP-ribosylation factor                                 338   3e-114   Gossypium arboreum [tree cotton]
ref|XP_010244258.1|  PREDICTED: ADP-ribosylation factor 2-like          336   7e-114   Nelumbo nucifera [Indian lotus]
ref|XP_002948332.1|  small Arf-related GTPase                           336   8e-114   Volvox carteri f. nagariensis
gb|KDD76860.1|  ADP-ribosylation factor                                 336   1e-113   Helicosporidium sp. ATCC 50920
gb|EPB84634.1|  ADP-ribosylation factor 1                               335   1e-113   Mucor circinelloides f. circinelloides 1006PhL
gb|EIE86445.1|  ADP-ribosylation factor                                 335   1e-113   Rhizopus delemar RA 99-880
ref|XP_009028190.1|  hypothetical protein HELRODRAFT_186077             335   1e-113   Helobdella robusta
gb|KJB43808.1|  hypothetical protein B456_007G217400                    335   2e-113   Gossypium raimondii
gb|EIE79751.1|  ADP-ribosylation factor                                 335   2e-113   Rhizopus delemar RA 99-880
gb|KJB43807.1|  hypothetical protein B456_007G217400                    335   2e-113   Gossypium raimondii
ref|XP_003856771.1|  hypothetical protein MYCGRDRAFT_102943             335   2e-113   
emb|CEG67980.1|  Putative ADP-ribosylation factor 1                     335   2e-113   
ref|XP_007920061.1|  hypothetical protein MYCFIDRAFT_49010              335   2e-113   
gb|KIX04641.1|  ADP-ribosylation factor                                 335   3e-113   
ref|XP_007758701.1|  ADP-ribosylation factor                            335   3e-113   
emb|CBI36996.3|  unnamed protein product                                334   3e-113   
ref|XP_007747463.1|  ADP-ribosylation factor                            335   3e-113   
ref|XP_007725373.1|  ADP-ribosylation factor                            335   3e-113   
gb|EPB86904.1|  ADP-ribosylation factor                                 334   4e-113   
emb|CEG74858.1|  Putative ADP-ribosylation factor                       334   4e-113   
ref|XP_007672425.1|  hypothetical protein BAUCODRAFT_61772              334   4e-113   
dbj|GAM83579.1|  hypothetical protein ANO11243_015670                   334   5e-113   
gb|EMS22909.1|  ADP-ribosylation factor                                 334   5e-113   
gb|EXX72896.1|  Arf2p                                                   334   5e-113   
ref|XP_002740964.1|  PREDICTED: ADP-ribosylation factor 1-like is...    334   5e-113   
gb|KEQ60941.1|  ARF/SAR superfamily                                     334   5e-113   
emb|CAN59803.1|  hypothetical protein VITISV_038875                     334   6e-113   
ref|XP_009367578.1|  PREDICTED: ADP-ribosylation factor 2-like is...    334   6e-113   
ref|XP_007692073.1|  hypothetical protein COCMIDRAFT_106246             334   6e-113   
ref|XP_006959545.1|  ARF/SAR                                            334   6e-113   
ref|XP_006288756.1|  hypothetical protein CARUB_v10002073mg             333   6e-113   
ref|XP_003054231.1|  predicted protein                                  334   7e-113   
ref|XP_003975384.1|  PREDICTED: ADP-ribosylation factor 1-like 2-...    333   7e-113   
ref|XP_001797240.1|  hypothetical protein SNOG_06879                    333   8e-113   
ref|XP_009620631.1|  PREDICTED: ADP-ribosylation factor 2-B-like        333   9e-113   
emb|CBI28549.3|  unnamed protein product                                332   1e-112   
ref|XP_005830502.1|  hypothetical protein GUITHDRAFT_163836             333   1e-112   
gb|KDE06822.1|  ADP-ribosylation factor 1                               333   1e-112   
ref|XP_001634219.1|  predicted protein                                  333   1e-112   
gb|KDP31993.1|  hypothetical protein JCGZ_12454                         333   1e-112   
ref|XP_006897877.1|  PREDICTED: ADP-ribosylation factor 2-like          333   1e-112   
ref|XP_008086386.1|  P-loop containing nucleoside triphosphate hy...    333   1e-112   
gb|KIL95193.1|  adp-ribosylation factor                                 333   1e-112   
gb|ACJ84889.1|  unknown                                                 332   2e-112   
ref|XP_008296481.1|  PREDICTED: ADP-ribosylation factor 1-like          332   2e-112   
ref|XP_006970612.1|  PREDICTED: ADP-ribosylation factor 2-like is...    333   2e-112   
gb|ERE68625.1|  ADP-ribosylation factor 3-like protein                  333   2e-112   
ref|XP_008391498.1|  PREDICTED: ADP-ribosylation factor 2-like          332   3e-112   
ref|XP_004655168.1|  PREDICTED: ADP-ribosylation factor 2-like          332   3e-112   
ref|XP_004896721.1|  PREDICTED: ADP-ribosylation factor 2-like          332   3e-112   
ref|XP_005369447.1|  PREDICTED: ADP-ribosylation factor 2-like is...    333   3e-112   
ref|XP_002307284.1|  ADP-ribosylation factor family protein             332   3e-112   
ref|XP_002618500.1|  ADP-ribosylation factor 1                          332   3e-112   
ref|NP_031503.1|  ADP-ribosylation factor 2                             332   3e-112   
ref|XP_006017727.1|  PREDICTED: ADP-ribosylation factor 2-like          332   3e-112   
ref|XP_002524920.1|  ADP-ribosylation factor, arf, putative             332   3e-112   
ref|XP_006844021.1|  hypothetical protein AMTR_s00006p00218180          332   4e-112   
emb|CDP02095.1|  unnamed protein product                                331   4e-112   
ref|XP_002719499.1|  PREDICTED: ADP-ribosylation factor 2               332   4e-112   
ref|XP_007047386.1|  ADP-ribosylation factor A1F isoform 2              332   4e-112   
ref|XP_007068709.1|  PREDICTED: ADP-ribosylation factor 2-like is...    332   4e-112   
emb|CAF98439.1|  unnamed protein product                                332   4e-112   
ref|XP_007205981.1|  hypothetical protein PRUPE_ppa012138mg             332   4e-112   
ref|XP_009367594.1|  PREDICTED: ADP-ribosylation factor 2-like is...    332   4e-112   
ref|XP_007913163.1|  putative adp-ribosylation factor protein           332   4e-112   
ref|XP_007293765.1|  ADP-ribosylation factor 1                          332   4e-112   
ref|XP_007413478.1|  hypothetical protein MELLADRAFT_117357             332   5e-112   
ref|XP_007788559.1|  putative adp-ribosylation factor protein           332   5e-112   
ref|XP_001558462.1|  ADP-ribosylation factor                            332   5e-112   
gb|ABB86251.1|  ADP-ribosylation factor 1-like                          332   5e-112   
ref|XP_010753411.1|  PREDICTED: ADP-ribosylation factor 1-like          332   5e-112   
gb|KHN99894.1|  ADP-ribosylation factor 1                               332   5e-112   
ref|XP_005311784.1|  PREDICTED: ADP-ribosylation factor 2               332   5e-112   
gb|ELU04506.1|  hypothetical protein CAPTEDRAFT_151740                  332   5e-112   
ref|XP_006638193.1|  PREDICTED: ADP-ribosylation factor 1-like          332   5e-112   
gb|KFY84038.1|  hypothetical protein V500_09663                         332   6e-112   
emb|CDR39163.1|  CYFA0S03e00342g1_1                                     331   6e-112   
ref|XP_001837013.1|  ADP-ribosylation factor Arf1                       331   6e-112   
ref|XP_005986307.1|  PREDICTED: ADP-ribosylation factor 2-like          331   7e-112   
ref|XP_007820253.1|  RAS-like GTPase, Rho2 subfamily                    331   7e-112   
ref|XP_010872862.1|  PREDICTED: ADP-ribosylation factor 2               331   7e-112   
ref|XP_010652771.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    331   7e-112   
ref|XP_010652770.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    331   7e-112   
gb|ELR01747.1|  ADP-ribosylation factor                                 331   7e-112   
gb|KIW06748.1|  ADP-ribosylation factor                                 331   8e-112   
ref|XP_010270881.1|  PREDICTED: ADP-ribosylation factor 2-like          330   8e-112   
gb|KFO27677.1|  ADP-ribosylation factor 2                               332   9e-112   
ref|XP_003448684.1|  PREDICTED: ADP-ribosylation factor 1-like          331   9e-112   
ref|XP_001386620.1|  hypothetical protein PICST_79956                   331   1e-111   
emb|CCK73158.1|  ADP-ribosylation factor 1                              331   1e-111   
ref|XP_003961118.1|  PREDICTED: ADP-ribosylation factor 1-like          331   1e-111   
ref|XP_008238827.1|  PREDICTED: ADP-ribosylation factor 1-like          331   1e-111   
ref|XP_006339849.1|  PREDICTED: ADP-ribosylation factor 2-B-like        330   1e-111   
gb|AAP80740.1|  ADP-ribosylation factor 1                               330   1e-111   
ref|XP_004204777.1|  Piso0_000052                                       330   1e-111   
emb|CDP02537.1|  unnamed protein product                                330   1e-111   
ref|XP_007343507.1|  ARF/SAR                                            330   1e-111   
ref|XP_003713533.1|  ADP-ribosylation factor                            330   1e-111   
ref|NP_001138692.1|  ADP-ribosylation factor 2                          330   1e-111   
ref|XP_005998642.1|  PREDICTED: ADP-ribosylation factor 1-like          330   1e-111   
ref|XP_003611669.1|  ADP-ribosylation factor                            330   1e-111   
ref|NP_001167030.1|  ADP-ribosylation factor 1 like                     330   1e-111   
ref|XP_011276692.1|  ADP-ribosylation factor 1                          330   1e-111   
ref|XP_007511913.1|  ADP-ribosylation factor                            332   2e-111   
emb|CBI34904.3|  unnamed protein product                                329   2e-111   
ref|XP_007882123.1|  hypothetical protein PFL1_06914                    330   2e-111   
gb|EDM06291.1|  ADP-ribosylation factor 2, isoform CRA_c                333   2e-111   
dbj|GAC95502.1|  potential ADP-ribosylation factor                      330   2e-111   
ref|XP_003141875.1|  ADP-ribosylation factor 1                          330   2e-111   
emb|CBI33772.3|  unnamed protein product                                331   2e-111   
ref|XP_002839805.1|  hypothetical protein                               330   2e-111   
ref|XP_850048.1|  PREDICTED: ADP-ribosylation factor 2-like isofo...    330   2e-111   
ref|XP_002619854.1|  ADP-ribosylation factor 1                          330   2e-111   
ref|XP_723175.1|  potential ADP-ribosylation factor                     330   3e-111   
gb|KEY71043.1|  hypothetical protein S7711_00867                        330   3e-111   
ref|XP_006962569.1|  ADP-ribosylation factor GTPase of the ras su...    330   3e-111   
ref|XP_011115839.1|  hypothetical protein H072_10361                    330   3e-111   
ref|XP_459420.1|  DEHA2E02002p                                          330   3e-111   
ref|XP_009084000.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    329   3e-111   
gb|EJW75727.1|  ADP-ribosylation factor 1                               329   3e-111   
gb|KIR49173.1|  ADP-ribosylation factor                                 329   3e-111   
ref|XP_004204223.1|  Piso0_000052                                       329   4e-111   
ref|XP_007828274.1|  ADP-ribosylation factor                            329   4e-111   
gb|KCW59480.1|  hypothetical protein EUGRSUZ_H02224                     330   4e-111   
ref|XP_009226423.1|  ADP-ribosylation factor                            329   4e-111   
ref|XP_004874773.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    329   4e-111   
ref|XP_005599712.1|  PREDICTED: ADP-ribosylation factor 1 isoform X3    330   4e-111   
gb|EJU06117.1|  ARF/SAR                                                 329   5e-111   
ref|NP_001080474.1|  ADP-ribosylation factor 1                          329   5e-111   
gb|KDB16711.1|  ADP-ribosylation factor                                 329   5e-111   
ref|XP_007230008.1|  PREDICTED: ADP-ribosylation factor 1-like          329   5e-111   
ref|XP_001386074.1|  hypothetical protein PICST_62979                   329   5e-111   
gb|KIM91090.1|  hypothetical protein PILCRDRAFT_811607                  329   5e-111   
ref|XP_001730296.1|  hypothetical protein MGL_2678                      329   5e-111   
ref|XP_001494680.2|  PREDICTED: ADP-ribosylation factor 1 isoformX1     330   5e-111   
dbj|BAE40054.1|  unnamed protein product                                329   5e-111   
gb|KFW10391.1|  ADP-ribosylation factor 1                               329   5e-111   
dbj|BAC27325.1|  unnamed protein product                                329   6e-111   
emb|CCX06275.1|  Similar to ADP-ribosylation factor; acc. no. P0CM17    329   6e-111   
gb|KFM81919.1|  ADP-ribosylation factor 1                               329   6e-111   
ref|NP_001649.1|  ADP-ribosylation factor 1                             329   6e-111   
ref|NP_001001905.1|  ADP-ribosylation factor 1                          329   6e-111   
ref|XP_007236412.1|  PREDICTED: ADP-ribosylation factor 1-like          328   7e-111   
gb|EPQ67144.1|  ADP-ribosylation factor GTPase of the Ras superfa...    329   7e-111   
ref|XP_002174014.1|  ADP-ribosylation factor                            328   7e-111   
ref|XP_001484652.1|  ADP-ribosylation factor 1                          328   7e-111   
gb|KDQ20587.1|  hypothetical protein BOTBODRAFT_26592                   328   7e-111   
ref|XP_003307076.1|  ADP-ribosylation factor                            328   7e-111   
gb|KFZ47631.1|  ADP-ribosylation factor 1                               328   7e-111   
ref|NP_001091755.1|  ADP-ribosylation factor                            328   8e-111   
pdb|1HUR|A  Chain A, Human Adp-Ribosylation Factor 1 Complexed Wi...    328   8e-111   
ref|XP_007055604.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    328   8e-111   
gb|AFO83996.1|  ADP-ribosylation factor                                 328   9e-111   
gb|EWC44149.1|  ADP-ribosylation factor 1                               328   9e-111   
ref|XP_004874772.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    330   9e-111   
emb|CCQ18631.1|  GTP-binding ADP-ribosylation factor-like protein A     328   9e-111   
gb|KFM79737.1|  ADP-ribosylation factor 1                               328   9e-111   
ref|XP_006446528.1|  hypothetical protein CICLE_v10017502mg             328   9e-111   
ref|XP_011008774.1|  PREDICTED: ADP-ribosylation factor 1-like          328   1e-110   
ref|XP_007376194.1|  hypothetical protein SPAPADRAFT_61980              328   1e-110   
sp|P91924.3|ARF_DUGJA  RecName: Full=ADP-ribosylation factor            328   1e-110   
gb|KHJ35367.1|  putative adp-ribosylation factor                        328   1e-110   
emb|CEF66979.1|  ADP-ribosylation factor 1                              328   1e-110   
ref|XP_005661196.1|  PREDICTED: ADP-ribosylation factor 1 isoform X4    328   1e-110   
ref|XP_004275737.1|  PREDICTED: ADP-ribosylation factor 2-like          328   1e-110   
ref|XP_011428363.1|  PREDICTED: ADP-ribosylation factor 2               328   1e-110   
ref|XP_005853246.1|  PREDICTED: ADP-ribosylation factor 1 isoform X3    328   1e-110   
ref|NP_958888.1|  ADP-ribosylation factor 1 like                        328   1e-110   
ref|XP_968387.1|  PREDICTED: ADP-ribosylation factor 1                  328   1e-110   
ref|XP_005853247.1|  PREDICTED: ADP-ribosylation factor 1 isoform X4    328   1e-110   
ref|NP_989018.1|  ADP-ribosylation factor 5                             328   1e-110   
ref|XP_005599711.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    329   2e-110   
emb|CCU97464.1|  unnamed protein product                                328   2e-110   
gb|AEE61840.1|  unknown                                                 328   2e-110   
ref|NP_596118.1|  ADP-ribosylation factor, Arf family Arf1              328   2e-110   
ref|XP_003352775.1|  hypothetical protein SMAC_01609                    328   2e-110   
gb|KII94939.1|  hypothetical protein PLICRDRAFT_97075                   328   2e-110   
ref|XP_006671098.1|  ADP-ribosylation factor                            328   2e-110   
ref|XP_008766092.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    328   2e-110   
ref|XP_005853245.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    328   2e-110   
ref|XP_002413376.1|  ADP-ribosylation factor                            328   2e-110   
ref|XP_007169957.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    328   2e-110   
ref|XP_004028569.1|  PREDICTED: ADP-ribosylation factor 1 isoform 5     328   2e-110   
ref|XP_008312304.1|  PREDICTED: ADP-ribosylation factor 1-like          327   2e-110   
ref|XP_005678073.1|  PREDICTED: ADP-ribosylation factor 1-like          327   2e-110   
ref|XP_006109765.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    328   2e-110   
ref|XP_572032.1|  ARF small monomeric GTPase                            327   2e-110   
ref|XP_011502468.1|  PREDICTED: ADP-ribosylation factor 1               327   2e-110   
ref|NP_476955.1|  ADP ribosylation factor at 79F, isoform B             327   2e-110   
ref|XP_002641152.1|  C. briggsae CBR-ARF-1.2 protein                    327   2e-110   
emb|CDO71404.1|  hypothetical protein BN946_scf184908.g162              327   2e-110   
gb|ADE42873.1|  ADP-ribosylation factor 1                               327   2e-110   
ref|XP_392990.2|  PREDICTED: ADP-ribosylation factor 1-like isofo...    327   2e-110   
gb|KIL70197.1|  hypothetical protein M378DRAFT_96593                    327   2e-110   
ref|XP_010070606.1|  PREDICTED: ADP-ribosylation factor 1-like          327   2e-110   
ref|XP_006760139.1|  PREDICTED: ADP-ribosylation factor 1 isoform X3    328   3e-110   
ref|XP_006760138.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    328   3e-110   
ref|XP_011099095.1|  PREDICTED: ADP-ribosylation factor 1-like          327   3e-110   
ref|XP_002596943.1|  hypothetical protein BRAFLDRAFT_263946             327   3e-110   
gb|KFU83844.1|  ADP-ribosylation factor 1                               327   3e-110   
dbj|BAE31170.1|  unnamed protein product                                327   3e-110   
ref|XP_005661194.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    328   3e-110   
ref|XP_005341336.1|  PREDICTED: ADP-ribosylation factor 1               328   3e-110   
emb|CDJ89627.1|  unnamed protein product                                327   3e-110   
dbj|BAE28685.1|  unnamed protein product                                327   3e-110   
ref|XP_009439877.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    328   3e-110   
emb|CEP19057.1|  hypothetical protein                                   327   3e-110   
dbj|BAN20585.1|  ADP-ribosylation factor, arf                           327   4e-110   
ref|XP_011201936.1|  PREDICTED: ADP-ribosylation factor 1               327   4e-110   
ref|XP_004203082.1|  Piso0_000680                                       327   4e-110   
ref|XP_003964833.1|  PREDICTED: ADP-ribosylation factor 1-like          327   4e-110   
ref|XP_001877050.1|  predicted protein                                  327   4e-110   
ref|XP_005661195.1|  PREDICTED: ADP-ribosylation factor 1 isoform X3    328   4e-110   
ref|XP_011186694.1|  PREDICTED: ADP-ribosylation factor 1               327   4e-110   
gb|KIJ56883.1|  hypothetical protein M422DRAFT_23014                    327   4e-110   
ref|XP_006760137.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    328   4e-110   
ref|XP_002162887.1|  PREDICTED: ADP-ribosylation factor 1-like 2-...    327   5e-110   
ref|NP_958912.1|  ADP-ribosylation factor 2                             327   5e-110   
ref|XP_004287997.1|  PREDICTED: ADP-ribosylation factor 1-like          327   5e-110   
gb|ACO12345.1|  ADP-ribosylation factor 1                               327   5e-110   
ref|XP_011126154.1|  hypothetical protein AOL_s00173g110                327   5e-110   
gb|KDQ64318.1|  hypothetical protein JAAARDRAFT_27945                   326   6e-110   
ref|XP_007382404.1|  ARF/SAR                                            326   6e-110   
ref|XP_003036735.1|  ADP-ribosylation facter                            326   6e-110   
gb|EHJ64178.1|  ADP-ribosylation factor                                 326   6e-110   
gb|EFX73745.1|  hypothetical protein DAPPUDRAFT_231341                  326   6e-110   
ref|XP_007846256.1|  adp-ribosylation factor                            326   6e-110   
ref|XP_007169958.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    327   6e-110   
gb|EPZ32912.1|  ADP-ribosylation factor                                 326   6e-110   
ref|XP_005661193.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    328   7e-110   
ref|XP_006885207.1|  PREDICTED: ADP-ribosylation factor 1-like is...    326   7e-110   



>emb|CBI25984.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   371 bits (952),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  34   SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  93

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  94   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  153

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  154  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  211



>ref|XP_002302788.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 ref|XP_002320274.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_002264654.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera]
 ref|XP_002281047.1| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
 ref|XP_002515227.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 ref|XP_002515230.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 ref|XP_003518676.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 ref|XP_003535875.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 ref|XP_003555789.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Glycine 
max]
 ref|XP_003555790.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Glycine 
max]
 ref|XP_003591352.1| ADP ribosylation factor [Medicago truncatula]
 ref|XP_003632415.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera]
 ref|XP_004135977.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 ref|XP_004169278.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 ref|XP_004302301.1| PREDICTED: ADP-ribosylation factor-like [Fragaria vesca subsp. 
vesca]
 ref|XP_004495884.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 ref|XP_006386700.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006382312.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006375425.1| hypothetical protein POPTR_0014s11180g [Populus trichocarpa]
 ref|XP_006428233.1| hypothetical protein CICLE_v10012898mg [Citrus clementina]
 ref|XP_006444563.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006444564.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006444565.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006480701.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006492378.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492379.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_007051216.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007145024.1| hypothetical protein PHAVU_007G203600g [Phaseolus vulgaris]
 ref|XP_007145120.1| hypothetical protein PHAVU_007G211700g [Phaseolus vulgaris]
 ref|XP_007163209.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 ref|XP_007163210.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 ref|XP_007205795.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 ref|XP_008246262.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
 ref|XP_008353867.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 ref|XP_008362551.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 ref|XP_008461403.1| PREDICTED: ADP-ribosylation factor-like [Cucumis melo]
 ref|XP_008461404.1| PREDICTED: ADP-ribosylation factor-like [Cucumis melo]
 ref|XP_010042229.1| PREDICTED: ADP-ribosylation factor-like [Eucalyptus grandis]
 ref|XP_010270872.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270873.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270874.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270875.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270882.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270883.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270884.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010276502.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010276503.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_011040695.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011038982.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011038983.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011003176.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011003177.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011079513.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011079514.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011092180.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011092181.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 gb|ABB03801.1| ADP ribosylation factor 002 [Daucus carota]
 gb|ABK93146.1| unknown [Populus trichocarpa]
 gb|ABK93165.1| unknown [Populus trichocarpa]
 gb|ACJ84391.1| unknown [Medicago truncatula]
 gb|EEE82061.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 gb|EEE98589.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|EEF47211.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|EEF47214.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|AEA92306.1| Arf2 [Hevea brasiliensis]
 gb|AES61603.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AFK34270.1| unknown [Medicago truncatula]
 gb|AFS50009.1| hypothetical protein [Dendrobium catenatum]
 gb|EMJ06994.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gb|EOX95373.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|ERP53222.1| hypothetical protein POPTR_0014s11180g [Populus trichocarpa]
 gb|ERP60109.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP64497.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ESR41473.1| hypothetical protein CICLE_v10012898mg [Citrus clementina]
 gb|ESR57803.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESR57804.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESR57805.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESW17018.1| hypothetical protein PHAVU_007G203600g [Phaseolus vulgaris]
 gb|ESW17114.1| hypothetical protein PHAVU_007G211700g [Phaseolus vulgaris]
 gb|ESW35203.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 gb|ESW35204.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 gb|KDO86877.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KDO86878.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KGN45043.1| hypothetical protein Csa_7G414405 [Cucumis sativus]
 gb|KHG07003.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHG09762.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHG21203.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHN00327.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN02820.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KJB22479.1| hypothetical protein B456_004G049700 [Gossypium raimondii]
 gb|KJB24450.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
 gb|KJB24451.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
 gb|KJB41774.1| hypothetical protein B456_007G120600 [Gossypium raimondii]
 gb|KJB49771.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
 gb|KJB49772.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
 gb|KJB49773.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
Length=181

 Score =   369 bits (948),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_008777957.1| PREDICTED: ADP-ribosylation factor [Phoenix dactylifera]
 ref|XP_008777958.1| PREDICTED: ADP-ribosylation factor [Phoenix dactylifera]
 ref|XP_010914673.1| PREDICTED: ADP-ribosylation factor-like [Elaeis guineensis]
 ref|XP_010914674.1| PREDICTED: ADP-ribosylation factor-like [Elaeis guineensis]
 gb|ACL67836.1| ADP ribosylation factor [Jatropha curcas]
 gb|KDP23360.1| hypothetical protein JCGZ_23193 [Jatropha curcas]
Length=181

 Score =   369 bits (947),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KHG04267.1| ADP-ribosylation factor [Gossypium arboreum]
Length=237

 Score =   371 bits (952),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_007205794.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gb|EMJ06993.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
Length=243

 Score =   371 bits (952),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  66   SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  125

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  126  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  185

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  186  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  243



>gb|KJB11520.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=183

 Score =   369 bits (946),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|NP_001236384.1| uncharacterized protein LOC100306021 [Glycine max]
 ref|XP_003517709.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Glycine 
max]
 ref|XP_003519837.1| PREDICTED: ADP-ribosylation factor 2-like isoformX1 [Glycine 
max]
 ref|XP_003557055.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Glycine 
max]
 ref|XP_004135254.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004165817.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004238652.1| PREDICTED: ADP-ribosylation factor 2 [Solanum lycopersicum]
 ref|XP_006356427.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006574623.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Glycine 
max]
 ref|XP_007044675.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007153744.1| hypothetical protein PHAVU_003G061400g [Phaseolus vulgaris]
 ref|XP_007223549.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 ref|XP_008221835.1| PREDICTED: ADP-ribosylation factor 2 [Prunus mume]
 ref|XP_008389663.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Malus domestica]
 ref|XP_008340051.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Malus domestica]
 ref|XP_008446200.1| PREDICTED: ADP-ribosylation factor 2 [Cucumis melo]
 ref|XP_008776867.1| PREDICTED: ADP-ribosylation factor 2 [Phoenix dactylifera]
 ref|XP_008776868.1| PREDICTED: ADP-ribosylation factor 2 [Phoenix dactylifera]
 ref|XP_009622926.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana tomentosiformis]
 ref|XP_009629759.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009759206.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana sylvestris]
 ref|XP_009758092.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana sylvestris]
 ref|XP_010029157.1| PREDICTED: ADP-ribosylation factor 2 [Eucalyptus grandis]
 ref|XP_010552645.1| PREDICTED: ADP-ribosylation factor 2 [Tarenaya hassleriana]
 ref|XP_010904967.1| PREDICTED: ADP-ribosylation factor 2 [Elaeis guineensis]
 ref|XP_011071092.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 ref|XP_011071093.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 ref|XP_011086584.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 gb|ACJ85464.1| unknown [Medicago truncatula]
 gb|ACN39752.1| unknown [Picea sitchensis]
 gb|ACN39787.1| unknown [Picea sitchensis]
 gb|ACN41130.1| unknown [Picea sitchensis]
 gb|ACU13997.1| unknown [Glycine max]
 gb|ACU23220.1| unknown [Glycine max]
 gb|AFK34829.1| unknown [Medicago truncatula]
 gb|AFK43802.1| unknown [Lotus japonicus]
 gb|AFK44369.1| unknown [Lotus japonicus]
 gb|AFK46588.1| unknown [Medicago truncatula]
 gb|EMJ24748.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 gb|EOY00507.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|ESW25738.1| hypothetical protein PHAVU_003G061400g [Phaseolus vulgaris]
 gb|EYU22499.1| hypothetical protein MIMGU_mgv1a014705mg [Erythranthe guttata]
 gb|EYU22500.1| hypothetical protein MIMGU_mgv1a014705mg [Erythranthe guttata]
 gb|EYU28446.1| hypothetical protein MIMGU_mgv1a014709mg [Erythranthe guttata]
 gb|KCW56009.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KCW56010.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KCW56011.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KEH27753.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AES96177.2| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|KGN51799.1| hypothetical protein Csa_5G601490 [Cucumis sativus]
 gb|KHN00363.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN12112.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN25534.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN26886.1| ADP-ribosylation factor 2 [Glycine soja]
Length=181

 Score =   368 bits (945),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>emb|CDP13175.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   369 bits (948),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KDP28302.1| hypothetical protein JCGZ_14073 [Jatropha curcas]
Length=181

 Score =   368 bits (945),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN+A
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANRA  181



>gb|EYU46846.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46847.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46848.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46849.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
Length=181

 Score =   368 bits (945),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KHN00225.1| ADP-ribosylation factor 2 [Glycine soja]
Length=184

 Score =   368 bits (945),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|ADH44695.1| ADP-ribosylation factor [Salvia miltiorrhiza]
Length=181

 Score =   368 bits (945),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDK+RPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKVRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KJB24452.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
Length=184

 Score =   368 bits (945),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|NP_001290536.1| uncharacterized protein LOC105052388 [Elaeis guineensis]
 ref|XP_006438365.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 ref|XP_006438366.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 ref|XP_006483876.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006483877.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006483878.1| PREDICTED: ADP-ribosylation factor 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006842402.1| hypothetical protein AMTR_s00204p00014880 [Amborella trichopoda]
 ref|XP_008792471.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008792472.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008807332.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008807333.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 gb|AEQ94161.1| ADP-ribosylation factor [Elaeis guineensis]
 gb|ERN04077.1| hypothetical protein AMTR_s00204p00014880 [Amborella trichopoda]
 gb|ESR51605.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 gb|ESR51606.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
Length=181

 Score =   368 bits (944),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|AAD17207.1| ADP-ribosylation factor [Glycine max]
Length=178

 Score =   368 bits (944),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  1    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  60

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  61   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  120

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  121  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  178



>ref|XP_004288363.1| PREDICTED: ADP-ribosylation factor 2-like [Fragaria vesca subsp. 
vesca]
 ref|XP_007221509.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 ref|XP_007221510.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 ref|XP_008227807.1| PREDICTED: ADP-ribosylation factor 2 [Prunus mume]
 ref|XP_008381455.1| PREDICTED: ADP-ribosylation factor 2-like [Malus domestica]
 ref|XP_009363094.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 ref|XP_009367177.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 ref|XP_009376185.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 gb|EMJ22708.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 gb|EMJ22709.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
Length=181

 Score =   368 bits (944),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_003536036.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Glycine max]
 ref|XP_006589106.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Glycine max]
 ref|XP_006589107.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Glycine max]
 ref|XP_006589108.1| PREDICTED: ADP-ribosylation factor-like isoform X4 [Glycine max]
Length=181

 Score =   368 bits (944),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIANKA  181



>ref|XP_002318935.1| hypothetical protein POPTR_0013s00700g [Populus trichocarpa]
 ref|XP_003553934.1| PREDICTED: ADP-ribosylation factor isoform 3 [Glycine max]
 ref|XP_006382311.1| hypothetical protein POPTR_0005s00910g [Populus trichocarpa]
 ref|XP_006375716.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 ref|XP_006375717.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_009757514.1| PREDICTED: ADP-ribosylation factor [Nicotiana sylvestris]
 ref|XP_010550140.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010550141.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554051.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554052.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554053.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010672580.1| PREDICTED: ADP-ribosylation factor [Beta vulgaris subsp. vulgaris]
 ref|XP_011023829.1| PREDICTED: ADP-ribosylation factor isoform X1 [Populus euphratica]
 ref|XP_011023830.1| PREDICTED: ADP-ribosylation factor isoform X2 [Populus euphratica]
 ref|XP_011023831.1| PREDICTED: ADP-ribosylation factor isoform X3 [Populus euphratica]
 ref|XP_011023832.1| PREDICTED: ADP-ribosylation factor isoform X4 [Populus euphratica]
 ref|XP_011038984.1| PREDICTED: ADP-ribosylation factor [Populus euphratica]
 gb|ABK93177.1| unknown [Populus trichocarpa]
 gb|ABK93657.1| unknown [Populus trichocarpa]
 gb|ABK95673.1| unknown [Populus trichocarpa]
 gb|EEE94858.1| hypothetical protein POPTR_0013s00700g [Populus trichocarpa]
 gb|ERP53513.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 gb|ERP53514.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP60108.1| hypothetical protein POPTR_0005s00910g [Populus trichocarpa]
 gb|KHN23524.1| ADP-ribosylation factor [Glycine soja]
 gb|KHN27442.1| ADP-ribosylation factor [Glycine soja]
 gb|KJB11517.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
 gb|KJB11519.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
 gb|KJB11521.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=181

 Score =   368 bits (944),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_002892585.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 ref|XP_007031214.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|EFH68844.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EOY11716.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|KHG17086.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
 gb|KHG18341.1| ADP-ribosylation factor 2-B -like protein [Gossypium arboreum]
 gb|KJB81134.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
 gb|KJB81135.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
Length=181

 Score =   368 bits (944),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|AGV54515.1| ADP ribosylation factor [Phaseolus vulgaris]
Length=237

 Score =   370 bits (949),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_011040674.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011040681.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011040689.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
Length=189

 Score =   368 bits (945),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_011003178.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
Length=181

 Score =   368 bits (944),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_009121644.1| PREDICTED: ADP-ribosylation factor 2 [Brassica rapa]
 ref|XP_009121645.1| PREDICTED: ADP-ribosylation factor 2 [Brassica rapa]
Length=181

 Score =   368 bits (944),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    NFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_010092942.1| ADP-ribosylation factor 2 [Morus notabilis]
 gb|EXB52995.1| ADP-ribosylation factor 2 [Morus notabilis]
Length=188

 Score =   368 bits (944),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_004494449.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 ref|XP_011092183.1| PREDICTED: ADP-ribosylation factor-like [Sesamum indicum]
Length=181

 Score =   367 bits (943),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|XP_004304633.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   367 bits (943),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>emb|CDX95712.1| BnaC03g25930D [Brassica napus]
Length=190

 Score =   368 bits (944),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 183/193 (95%), Gaps = 6/193 (3%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*K  196
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK   
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK---  180

Query  195  VE*VPSSF*TFMY  157
               V SS  TF++
Sbjct  181  ---VSSSSSTFLF  190



>ref|XP_006480700.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
Length=183

 Score =   367 bits (943),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_010524305.1| PREDICTED: ADP-ribosylation factor-like [Tarenaya hassleriana]
Length=181

 Score =   367 bits (943),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_008812250.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008812251.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008812252.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
Length=181

 Score =   367 bits (943),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_008806237.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
Length=181

 Score =   367 bits (943),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_006361664.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361665.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006361666.1| PREDICTED: ADP-ribosylation factor 2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_009604530.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009604531.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009762302.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana sylvestris]
Length=181

 Score =   367 bits (942),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKS  181



>ref|XP_010659724.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
Length=183

 Score =   367 bits (943),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_003626009.1| ADP-ribosylation factor-like protein [Medicago truncatula]
Length=206

 Score =   368 bits (945),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*K  196
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K  K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKVNK  183

Query  195  VE*VPSSF*TFMYIL  151
             +    +  ++ +++
Sbjct  184  EKIFSETLLSYSFVM  198



>ref|XP_011038977.1| PREDICTED: ADP-ribosylation factor-like [Populus euphratica]
 ref|XP_011038978.1| PREDICTED: ADP-ribosylation factor-like [Populus euphratica]
 ref|XP_011038980.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011038981.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
Length=183

 Score =   367 bits (942),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_004252939.1| PREDICTED: ADP-ribosylation factor 2 [Solanum lycopersicum]
Length=181

 Score =   367 bits (942),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI+NKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISNKA  181



>gb|KJB11518.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=205

 Score =   368 bits (945),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  28   SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  87

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  88   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  147

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  148  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  205



>gb|EPS68301.1| hypothetical protein M569_06468, partial [Genlisea aurea]
Length=180

 Score =   367 bits (942),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV+EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVIEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_011087519.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Sesamum indicum]
 ref|XP_011087520.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Sesamum indicum]
Length=192

 Score =   367 bits (943),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  15   SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  74

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  75   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  134

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  135  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  192



>gb|AAT08648.1| ADP-ribosylation factor [Hyacinthus orientalis]
Length=199

 Score =   368 bits (944),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  22   SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  81

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  82   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  141

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K 
Sbjct  142  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKG  199



>gb|AEZ00866.1| putative ADP-ribosylation factor protein [Elaeis guineensis]
Length=181

 Score =   367 bits (942),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN SF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNFSF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_010941504.1| PREDICTED: ADP-ribosylation factor [Elaeis guineensis]
Length=181

 Score =   367 bits (942),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIANKA  181



>gb|ACJ84691.1| unknown [Medicago truncatula]
 gb|AFK35530.1| unknown [Medicago truncatula]
 gb|AES82227.2| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
Length=181

 Score =   367 bits (942),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS  181



>ref|XP_010248146.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
Length=181

 Score =   367 bits (942),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIANKA  181



>ref|XP_002265983.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Vitis vinifera]
 ref|XP_002265874.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Vitis vinifera]
 ref|XP_004297476.1| PREDICTED: ADP-ribosylation factor 2 [Fragaria vesca subsp. vesca]
 ref|XP_007157443.1| hypothetical protein PHAVU_002G070500g [Phaseolus vulgaris]
 ref|XP_010682536.1| PREDICTED: ADP-ribosylation factor 2 [Beta vulgaris subsp. vulgaris]
 gb|ESW29437.1| hypothetical protein PHAVU_002G070500g [Phaseolus vulgaris]
Length=181

 Score =   367 bits (942),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|NP_001055892.1| Os05g0489600 [Oryza sativa Japonica Group]
 ref|XP_002441289.1| hypothetical protein SORBIDRAFT_09g023880 [Sorghum bicolor]
 ref|XP_004961688.1| PREDICTED: ADP-ribosylation factor 2-like [Setaria italica]
 ref|XP_006644888.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
 ref|XP_006654568.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
 ref|XP_010232477.1| PREDICTED: ADP-ribosylation factor 2 [Brachypodium distachyon]
 ref|XP_010232479.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Brachypodium 
distachyon]
 sp|P51823.2|ARF2_ORYSJ RecName: Full=ADP-ribosylation factor 2 [Oryza sativa Japonica 
Group]
 dbj|BAA04607.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAB41081.1| ADP-ribosylation factor [Triticum aestivum]
 emb|CAD48129.2| ADP-ribosylation factor 1-like protein [Hordeum vulgare subsp. 
vulgare]
 gb|AAT77289.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF17806.1| Os05g0489600 [Oryza sativa Japonica Group]
 gb|EAY98506.1| hypothetical protein OsI_20417 [Oryza sativa Indica Group]
 dbj|BAG88186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90235.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99847.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64179.1| hypothetical protein OsJ_19011 [Oryza sativa Japonica Group]
 gb|EES19719.1| hypothetical protein SORBIDRAFT_09g023880 [Sorghum bicolor]
Length=181

 Score =   367 bits (942),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_010922923.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010922924.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Elaeis 
guineensis]
Length=181

 Score =   367 bits (941),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KDP26602.1| hypothetical protein JCGZ_17760 [Jatropha curcas]
Length=181

 Score =   367 bits (941),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN+A
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANRA  181



>ref|XP_010094415.1| ADP-ribosylation factor 2 [Morus notabilis]
 gb|EXB55996.1| ADP-ribosylation factor 2 [Morus notabilis]
Length=203

 Score =   368 bits (944),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_003618207.1| ADP-ribosylation factor [Medicago truncatula]
Length=248

 Score =   369 bits (948),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  71   TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  130

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  131  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  190

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  191  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  248



>ref|XP_006291918.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 ref|XP_006295602.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
 ref|XP_006397909.1| hypothetical protein EUTSA_v10001656mg [Eutrema salsugineum]
 ref|XP_006402389.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 ref|XP_006402390.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 ref|XP_009599611.1| PREDICTED: ADP-ribosylation factor 1 [Nicotiana tomentosiformis]
 ref|XP_009599612.1| PREDICTED: ADP-ribosylation factor 1 [Nicotiana tomentosiformis]
 ref|XP_010506745.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010507921.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010512616.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010518410.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010413292.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010468970.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010544949.1| PREDICTED: ADP-ribosylation factor 1 [Tarenaya hassleriana]
 ref|XP_011087521.1| PREDICTED: ADP-ribosylation factor 1 isoform X3 [Sesamum indicum]
 gb|AAF65512.1| ADP-ribosylation factor [Capsicum annuum]
 gb|AAR03592.1| ARF-like small GTPase [Brassica juncea]
 gb|EOA24816.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 gb|EOA28500.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
 gb|ESQ39362.1| hypothetical protein EUTSA_v10001656mg [Eutrema salsugineum]
 gb|ESQ43842.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 gb|ESQ43843.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 emb|CDX93979.1| BnaC04g21380D [Brassica napus]
Length=181

 Score =   367 bits (941),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|ABR17508.1| unknown [Picea sitchensis]
 gb|ABR17650.1| unknown [Picea sitchensis]
 gb|ABR18399.1| unknown [Picea sitchensis]
 gb|ACN39755.1| unknown [Picea sitchensis]
 gb|ACN39884.1| unknown [Picea sitchensis]
 gb|ACN40399.1| unknown [Picea sitchensis]
Length=181

 Score =   367 bits (941),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFQRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_010943658.1| PREDICTED: ADP-ribosylation factor 2-like [Elaeis guineensis]
Length=181

 Score =   367 bits (941),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_002457613.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
 gb|EES02733.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
Length=181

 Score =   367 bits (941),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANKA  181



>ref|XP_003618209.1| ADP-ribosylation factor [Medicago truncatula]
 ref|XP_004142795.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004142796.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156684.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156685.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004304634.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_004489257.1| PREDICTED: ADP-ribosylation factor 1-like [Cicer arietinum]
 ref|XP_006470306.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470307.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_008230584.1| PREDICTED: ADP-ribosylation factor 1 [Prunus mume]
 ref|XP_008341441.1| PREDICTED: ADP-ribosylation factor 1 [Malus domestica]
 ref|XP_008341442.1| PREDICTED: ADP-ribosylation factor 1 [Malus domestica]
 ref|XP_008458781.1| PREDICTED: ADP-ribosylation factor 1 [Cucumis melo]
 ref|XP_009334096.1| PREDICTED: ADP-ribosylation factor 1 [Pyrus x bretschneideri]
 ref|XP_009334097.1| PREDICTED: ADP-ribosylation factor 1 [Pyrus x bretschneideri]
 ref|XP_010029154.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010029155.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010029156.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010033289.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010033290.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 gb|AAR29293.1| ADP-ribosylation factor [Medicago sativa]
 emb|CAI29265.1| ADP-ribosylation factor 1 [Medicago truncatula]
 gb|AES74427.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AEV66152.1| ADP-ribosylation factor [Arachis hypogaea]
 gb|AFK42113.1| unknown [Medicago truncatula]
 gb|AFK44737.1| unknown [Lotus japonicus]
 gb|KCW56003.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56004.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56005.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56006.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KDO66122.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
 gb|KDO66123.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
 gb|KGN59678.1| hypothetical protein Csa_3G837590 [Cucumis sativus]
Length=181

 Score =   367 bits (941),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_006356426.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Solanum 
tuberosum]
Length=184

 Score =   367 bits (941),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_010553607.1| PREDICTED: ADP-ribosylation factor 2-B [Tarenaya hassleriana]
Length=181

 Score =   367 bits (941),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_008444322.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_008444323.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_008444324.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_010551584.1| PREDICTED: ADP-ribosylation factor 2-like [Tarenaya hassleriana]
Length=181

 Score =   367 bits (941),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|NP_001275425.1| ADP-ribosylation factor 2-like [Solanum tuberosum]
 gb|ABA40446.1| unknown [Solanum tuberosum]
Length=181

 Score =   367 bits (941),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_006417443.1| hypothetical protein EUTSA_v10008885mg [Eutrema salsugineum]
 ref|XP_010547797.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 ref|XP_010547805.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 ref|XP_010533952.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 gb|ESQ35796.1| hypothetical protein EUTSA_v10008885mg [Eutrema salsugineum]
Length=181

 Score =   367 bits (941),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|XP_006488769.1| PREDICTED: ADP-ribosylation factor-like [Citrus sinensis]
 gb|KDO72116.1| hypothetical protein CISIN_1g030193mg [Citrus sinensis]
Length=181

 Score =   366 bits (940),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIATKA  181



>ref|XP_004135253.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004165816.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis 
sativus]
Length=189

 Score =   367 bits (941),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>gb|EYU19417.1| hypothetical protein MIMGU_mgv1a014679mg [Erythranthe guttata]
Length=181

 Score =   366 bits (940),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|NP_001274832.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB16972.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB16982.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB87122.1| ADP-ribosylation factor 1-like [Solanum tuberosum]
Length=181

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>sp|O48920.3|ARF_VIGUN RecName: Full=ADP-ribosylation factor [Vigna unguiculata]
 gb|AAB91395.1| ADP-ribosylation factor [Vigna unguiculata]
Length=181

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>ref|XP_008389662.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Malus domestica]
 ref|XP_008340050.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Malus domestica]
Length=182

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|NP_001280835.1| ADP-ribosylation factor [Malus domestica]
 gb|AEX97079.1| ADP-ribosylation factor [Malus domestica]
Length=188

 Score =   367 bits (941),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>gb|EYU38402.1| hypothetical protein MIMGU_mgv1a014684mg [Erythranthe guttata]
Length=181

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF+KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFSKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|XP_006305640.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
 gb|EOA38538.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
Length=197

 Score =   367 bits (942),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  20   SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  79

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLV
Sbjct  80   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLV  139

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  140  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  197



>ref|XP_009612443.1| PREDICTED: ADP-ribosylation factor [Nicotiana tomentosiformis]
Length=181

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCA SGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAASGEGLYEGLDWLSNNIASKA  181



>ref|NP_172533.2| ADP-ribosylation factor A1F [Arabidopsis thaliana]
 ref|XP_010475938.1| PREDICTED: ADP-ribosylation factor 1-like [Camelina sativa]
 gb|AAT41759.1| At1g10630 [Arabidopsis thaliana]
 gb|AAT70455.1| At1g10630 [Arabidopsis thaliana]
 dbj|BAE98462.1| similar to ADP-ribosylation factor gb|AAD17207 [Arabidopsis thaliana]
 gb|AEE28611.1| ADP-ribosylation factor A1F [Arabidopsis thaliana]
Length=181

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_009629758.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Nicotiana tomentosiformis]
Length=244

 Score =   369 bits (946),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  67   TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  126

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  127  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  186

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  187  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  244



>gb|KHG28118.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
Length=190

 Score =   367 bits (941),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  13   SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  72

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  73   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  132

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  133  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  190



>gb|ADP00406.1| ADP-ribosylation factor [Actinidia chinensis]
Length=181

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDA+LLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAILLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_009391635.1| PREDICTED: ADP-ribosylation factor 2 [Musa acuminata subsp. malaccensis]
Length=181

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV+EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVIEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|AFK42466.1| unknown [Lotus japonicus]
Length=181

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDA GKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAVGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_006390885.1| hypothetical protein EUTSA_v10019096mg [Eutrema salsugineum]
 gb|ESQ28171.1| hypothetical protein EUTSA_v10019096mg [Eutrema salsugineum]
Length=226

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  49   SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  108

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  109  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  168

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  169  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  226



>gb|KDO66124.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
Length=189

 Score =   366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>gb|AIX10946.1| putative ADP-ribosylation factor [Gardenia jasminoides]
Length=181

 Score =   366 bits (939),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLP+AMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPDAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_006399980.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 ref|XP_006399981.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 ref|XP_010420114.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010420115.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010453596.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010492281.1| PREDICTED: ADP-ribosylation factor isoform X2 [Camelina sativa]
 gb|ESQ41433.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 gb|ESQ41434.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
Length=181

 Score =   366 bits (939),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    NFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_004967765.1| PREDICTED: ADP-ribosylation factor 2-like [Setaria italica]
 ref|XP_006644030.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
Length=181

 Score =   366 bits (939),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>gb|KJB81136.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
Length=227

 Score =   367 bits (943),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  50   SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  109

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  110  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  169

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  170  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  227



>ref|XP_010319588.1| PREDICTED: ADP-ribosylation factor [Solanum lycopersicum]
Length=185

 Score =   366 bits (939),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD VLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDVVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>gb|KHG04030.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KJB15573.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
 gb|KJB15574.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
 gb|KJB15577.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGL+SLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>emb|CAD12855.1| ADP-ribosylation factor [Gossypium hirsutum]
 gb|AAO37820.1| ADP-ribosylation factor [Gossypium hirsutum]
 gb|AAO45616.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gb|AAO62348.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gb|KJB82422.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82423.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82426.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82427.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82428.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82429.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|XP_009399937.1| PREDICTED: ADP-ribosylation factor 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399938.1| PREDICTED: ADP-ribosylation factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|XP_006344797.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006344798.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_011087517.1| PREDICTED: ADP-ribosylation factor 1-like [Sesamum indicum]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKS  181



>gb|KJB31031.1| hypothetical protein B456_005G181600, partial [Gossypium raimondii]
Length=180

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_008443527.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis melo]
 ref|XP_008443528.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis melo]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>emb|CDY47221.1| BnaC09g14700D [Brassica napus]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|XP_010108788.1| ADP-ribosylation factor [Morus notabilis]
 gb|EXC20303.1| ADP-ribosylation factor [Morus notabilis]
Length=185

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>ref|NP_191788.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|NP_001190161.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|NP_001190162.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|XP_002880284.1| ADP-ribosylation factor A1E [Arabidopsis lyrata subsp. lyrata]
 ref|XP_009142560.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_009142561.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_010523901.1| PREDICTED: ADP-ribosylation factor 1 [Tarenaya hassleriana]
 gb|AAK49618.1|AF372902_1 AT3g62290/T17J13_250 [Arabidopsis thaliana]
 emb|CAB71889.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|AAL15358.1| AT3g62290/T17J13_250 [Arabidopsis thaliana]
 gb|AAM62611.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|ABL97964.1| ADP-ribosylation factor-like protein [Brassica rapa]
 gb|EFH56543.1| ADP-ribosylation factor A1E [Arabidopsis lyrata subsp. lyrata]
 gb|AEE80332.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 gb|AEE80333.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 gb|AEE80334.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 emb|CDY51415.1| BnaA04g26920D [Brassica napus]
 emb|CDY37791.1| BnaC04g00340D [Brassica napus]
 emb|CDY27506.1| BnaC04g51470D [Brassica napus]
 emb|CDX89139.1| BnaA04g00470D [Brassica napus]
 emb|CDX80083.1| BnaA05g00730D [Brassica napus]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|AGH68504.1| ADP-ribosylation factor, partial [Ipomoea batatas]
Length=180

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFKKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|NP_177206.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|NP_564195.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 ref|NP_850975.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|NP_974120.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|XP_002890586.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009127800.1| PREDICTED: ADP-ribosylation factor 2-B isoform X2 [Brassica rapa]
 ref|XP_009127801.1| PREDICTED: ADP-ribosylation factor 2-B isoform X2 [Brassica rapa]
 ref|XP_009103171.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_009103173.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_010498859.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010415728.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010415729.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010427826.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010427827.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010460136.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010471043.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010471044.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010477643.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 sp|P0DH91.1|ARF2B_ARATH RecName: Full=ADP-ribosylation factor 2-B; Short=AtARF2; AltName: 
Full=ARF1-like protein U5 [Arabidopsis thaliana]
 sp|Q9LQC8.2|ARF2A_ARATH RecName: Full=ADP-ribosylation factor 2-A; Short=AtARF2 [Arabidopsis 
thaliana]
 gb|AAG40035.1|AF324684_1 At1g23490 [Arabidopsis thaliana]
 gb|AAG40377.1|AF325025_1 At1g70490 [Arabidopsis thaliana]
 gb|AAG42921.1|AF329504_1 putative ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAG52463.1|AC010796_2 putative ADP-ribosylation factor 1; 15065-14075 [Arabidopsis 
thaliana]
 gb|AAK25874.1|AF360164_1 putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAK49591.1|AF372875_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gb|AAK49617.1|AF372901_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gb|AAL07190.1| putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAL15357.1| At1g23490/F5O8_5 [Arabidopsis thaliana]
 gb|AAM44988.1| putative ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAM64791.1| ADP-ribosylation factor 1-like [Arabidopsis thaliana]
 gb|EFH66845.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30394.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AEE35068.1| ARF GTPase family protein [Arabidopsis thaliana]
 gb|AEE35069.1| ARF GTPase family protein [Arabidopsis thaliana]
 gb|AEE35070.1| ARF GTPase family protein [Arabidopsis thaliana]
 emb|CDY54291.1| BnaC07g48320D [Brassica napus]
 emb|CDY44152.1| BnaA09g31000D [Brassica napus]
 emb|CDY25787.1| BnaA07g09950D [Brassica napus]
 emb|CDY11588.1| BnaC06g31510D [Brassica napus]
 emb|CDY09441.1| BnaC02g19830D [Brassica napus]
 emb|CDY04706.1| BnaC05g18830D [Brassica napus]
 emb|CDY03747.1| BnaA02g14900D [Brassica napus]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>gb|ABD73294.1| ADP-ribosylation factor-like protein [Panax ginseng]
Length=181

 Score =   365 bits (938),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLN DELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNGDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_007151018.1| hypothetical protein PHAVU_004G011900g [Phaseolus vulgaris]
 gb|AGZ15424.1| ADP-ribosylation factor 1 [Phaseolus vulgaris]
 gb|ESW23012.1| hypothetical protein PHAVU_004G011900g [Phaseolus vulgaris]
Length=181

 Score =   365 bits (937),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>emb|CDY09875.1| BnaC09g42860D [Brassica napus]
Length=213

 Score =   367 bits (941),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    NFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>emb|CDX69567.1| BnaA10g19160D [Brassica napus]
Length=206

 Score =   366 bits (940),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    NFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_009416365.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416366.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416367.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416368.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416369.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416370.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEA+DELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEAKDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|NP_001044599.1| Os01g0813400 [Oryza sativa Japonica Group]
 sp|Q06396.3|ARF1_ORYSJ RecName: Full=ADP-ribosylation factor 1; AltName: Full=13 kDa 
cold-induced protein [Oryza sativa Japonica Group]
 dbj|BAD68219.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAD82682.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF06513.1| Os01g0813400 [Oryza sativa Japonica Group]
 dbj|BAG88255.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71689.1| hypothetical protein OsI_04181 [Oryza sativa Indica Group]
 gb|EEE55569.1| hypothetical protein OsJ_03844 [Oryza sativa Japonica Group]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_004970328.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Setaria 
italica]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_007031496.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007215053.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 ref|XP_007215054.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 ref|XP_008379235.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 gb|EMJ16252.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 gb|EMJ16253.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 gb|EOY02422.1| ADP-ribosylation factor A1F [Theobroma cacao]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>emb|CDX83340.1| BnaA03g21660D [Brassica napus]
Length=191

 Score =   365 bits (938),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/193 (93%), Positives = 182/193 (94%), Gaps = 5/193 (3%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*K  196
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK   
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV--  181

Query  195  VE*VPSSF*TFMY  157
                 SS  TF++
Sbjct  182  ---SSSSSSTFLF  191



>ref|XP_004228551.1| PREDICTED: ADP-ribosylation factor 2-like [Solanum lycopersicum]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KCW56002.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=190

 Score =   365 bits (938),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>ref|XP_006288755.1| hypothetical protein CARUB_v10002073mg [Capsella rubella]
 gb|EOA21653.1| hypothetical protein CARUB_v10002073mg [Capsella rubella]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    NFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|NP_182239.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 sp|P36397.2|ARF1_ARATH RecName: Full=ADP-ribosylation factor 1; Short=AtARF1 [Arabidopsis 
thaliana]
 gb|AAA32729.1| ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAB63817.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAL75910.1| At2g47170/T3D7.2 [Arabidopsis thaliana]
 gb|AAM15469.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAM64892.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAM98296.1| At2g47170/T3D7.2 [Arabidopsis thaliana]
 gb|AEC10810.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_009389142.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389143.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389144.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389145.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 gb|KJB75876.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
 gb|KJB75877.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKA  181



>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance 
By Agrobacterium Protein 6b
 pdb|3AQ4|B Chain B, Molecular Insights Into Plant Cell Proliferation Disturbance 
By Agrobacterium Protein 6b
Length=184

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  7    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  66

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  67   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  126

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  127  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  184



>ref|XP_009417875.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>gb|EMT17349.1| ADP-ribosylation factor 2 [Aegilops tauschii]
Length=193

 Score =   365 bits (938),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_010651474.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Vitis vinifera]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_009776781.1| PREDICTED: ADP-ribosylation factor-like [Nicotiana sylvestris]
 ref|XP_009776782.1| PREDICTED: ADP-ribosylation factor-like [Nicotiana sylvestris]
Length=181

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDRDRV+EARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRVIEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>emb|CDM84658.1| unnamed protein product [Triticum aestivum]
Length=182

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_002888469.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64728.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   365 bits (937),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_006296139.1| hypothetical protein CARUB_v10025292mg, partial [Capsella rubella]
 gb|EOA29037.1| hypothetical protein CARUB_v10025292mg, partial [Capsella rubella]
Length=180

 Score =   365 bits (936),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_010491587.1| PREDICTED: ADP-ribosylation factor 1-like [Camelina sativa]
Length=181

 Score =   365 bits (936),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|NP_001170436.1| uncharacterized protein LOC100384428 [Zea mays]
 ref|XP_008648189.1| PREDICTED: uncharacterized protein LOC100384428 isoform X1 [Zea 
mays]
 ref|XP_008648190.1| PREDICTED: uncharacterized protein LOC100384428 isoform X1 [Zea 
mays]
 gb|ACN36989.1| unknown [Zea mays]
 gb|AFW78458.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
 gb|AFW78459.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
 gb|AFW78460.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=184

 Score =   365 bits (937),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|KJB75878.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
Length=191

 Score =   365 bits (937),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKA  181



>ref|NP_001274834.1| ARF-like small GTPase-like protein [Solanum tuberosum]
 ref|XP_006344796.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum tuberosum]
 ref|XP_009626500.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana tomentosiformis]
 ref|XP_009794408.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 ref|XP_009759065.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 ref|XP_010313700.1| PREDICTED: ADP-ribosylation factor 1 [Solanum lycopersicum]
 ref|XP_010313704.1| PREDICTED: ADP-ribosylation factor 1 [Solanum lycopersicum]
 ref|XP_010313716.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum lycopersicum]
 ref|XP_010313724.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum lycopersicum]
 gb|ABA40455.1| ARF-like small GTPase-like protein [Solanum tuberosum]
 gb|ABC01907.1| ARF-like small GTPase-like protein [Solanum tuberosum]
Length=181

 Score =   365 bits (936),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|NP_001136508.1| uncharacterized protein LOC100216623 [Zea mays]
 ref|XP_008654461.1| PREDICTED: uncharacterized protein LOC100216623 isoform X1 [Zea 
mays]
 gb|ACF82071.1| unknown [Zea mays]
 gb|AFW79616.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gb|AFW79617.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gb|AFW79618.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=181

 Score =   365 bits (936),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|XP_002876669.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52928.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   365 bits (937),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>gb|KJB15578.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=192

 Score =   365 bits (937),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 184/193 (95%), Gaps = 5/193 (3%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*K  196
            FANKQDLPNAMNAAEITDKLGL+SLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  +
Sbjct  124  FANKQDLPNAMNAAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKVRR  183

Query  195  VE*VPSSF*TFMY  157
                  +F T++Y
Sbjct  184  Y-----TFKTYLY  191



>gb|AFK39359.1| unknown [Medicago truncatula]
Length=181

 Score =   365 bits (936),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLP+AMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPDAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_009375124.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009375125.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009377201.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009377202.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
Length=181

 Score =   365 bits (936),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKP  181



>ref|XP_002962225.1| ARF family GTPase [Selaginella moellendorffii]
 ref|XP_002965138.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ33976.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ37485.1| ARF family GTPase [Selaginella moellendorffii]
Length=181

 Score =   365 bits (936),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFQRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|XP_010660901.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
 ref|XP_010660902.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
Length=183

 Score =   365 bits (936),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD+VLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDSVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIATKA  181



>gb|AAF17671.1|AC009398_20 F20B24.7 [Arabidopsis thaliana]
Length=186

 Score =   365 bits (936),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>sp|P51822.2|ARF1_DAUCA RecName: Full=ADP-ribosylation factor 1 [Daucus carota]
 dbj|BAA08259.1| ADP-ribosylation factor [Daucus carota]
Length=181

 Score =   365 bits (936),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEI DKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K+
Sbjct  124  FANKQDLPNAMNAAEIIDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS  181



>gb|KDP46432.1| hypothetical protein JCGZ_10272 [Jatropha curcas]
Length=181

 Score =   364 bits (935),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>gb|KGN51378.1| hypothetical protein Csa_5G524710 [Cucumis sativus]
Length=191

 Score =   365 bits (936),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKV  181



>ref|XP_009110099.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Brassica rapa]
 gb|ACD37536.1| putative ADP-ribosylation factor [Brassica napus]
 emb|CDY41444.1| BnaA08g20460D [Brassica napus]
 emb|CDX91717.1| BnaC08g06360D [Brassica napus]
Length=181

 Score =   364 bits (935),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|NP_001042668.1| Os01g0265100 [Oryza sativa Japonica Group]
 dbj|BAA90347.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAA92519.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF04582.1| Os01g0265100 [Oryza sativa Japonica Group]
 dbj|BAG90318.1| unnamed protein product [Oryza sativa Japonica Group]
Length=181

 Score =   364 bits (935),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANKA  181



>ref|XP_010232478.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Brachypodium 
distachyon]
Length=182

 Score =   364 bits (935),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>emb|CDY47137.1| BnaA08g05460D [Brassica napus]
Length=181

 Score =   364 bits (935),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_010679455.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679456.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679457.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
Length=181

 Score =   364 bits (934),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKL LHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLSLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>gb|EMS63688.1| ADP-ribosylation factor 2 [Triticum urartu]
Length=186

 Score =   364 bits (935),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_009113207.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_009113208.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 emb|CDY53050.1| BnaA09g14150D [Brassica napus]
Length=181

 Score =   364 bits (934),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  181



>ref|XP_010313707.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Solanum lycopersicum]
 ref|XP_010313711.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Solanum lycopersicum]
Length=183

 Score =   364 bits (935),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 176/178 (99%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|NP_001149117.1| ADP-ribosylation factor [Zea mays]
 ref|XP_002456522.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor]
 ref|XP_008672877.1| PREDICTED: ADP-ribosylation factor isoform X1 [Zea mays]
 gb|ACF83883.1| unknown [Zea mays]
 gb|ACF88010.1| unknown [Zea mays]
 gb|ACG34254.1| ADP-ribosylation factor [Zea mays]
 gb|ACG42128.1| ADP-ribosylation factor [Zea mays]
 gb|EES01642.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor]
 tpg|DAA57153.1| TPA: ADP-ribosylation factor [Zea mays]
Length=181

 Score =   364 bits (934),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKS  181



>ref|XP_009595261.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana tomentosiformis]
 ref|XP_009775097.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 dbj|BAF34209.1| ADP ribosylation factor [Nicotiana tabacum]
Length=181

 Score =   364 bits (934),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI+NKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISNKA  181



>ref|XP_002871626.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47885.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score =   364 bits (934),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    NFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKV  181



>dbj|BAJ87426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   364 bits (934),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    AFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>gb|AFW78462.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=199

 Score =   365 bits (936),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  19   TFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  78

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  79   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  138

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  139  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  196



>ref|XP_002521452.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|EEF40942.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
Length=181

 Score =   364 bits (934),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGL+SLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA  181



>ref|XP_010492280.1| PREDICTED: ADP-ribosylation factor isoform X1 [Camelina sativa]
Length=183

 Score =   364 bits (934),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    NFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKV  181



>ref|XP_010551905.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Tarenaya hassleriana]
Length=208

 Score =   365 bits (936),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  31   SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  90

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  91   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLV  150

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI++KA
Sbjct  151  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKA  208



>ref|XP_010551906.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Tarenaya hassleriana]
 ref|XP_010551907.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Tarenaya hassleriana]
Length=181

 Score =   364 bits (934),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI++KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKA  181



>ref|NP_001051676.1| Os03g0811900 [Oryza sativa Japonica Group]
 ref|XP_006650781.1| PREDICTED: ADP-ribosylation factor 1-like [Oryza brachyantha]
 gb|AAP73857.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 gb|ABF99500.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99501.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99504.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13590.1| Os03g0811900 [Oryza sativa Japonica Group]
 emb|CCI55417.1| PH01B015M02.18 [Phyllostachys edulis]
Length=181

 Score =   363 bits (933),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  181



>ref|XP_009138731.1| PREDICTED: ADP-ribosylation factor 1 [Brassica rapa]
Length=181

 Score =   363 bits (933),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQ+TQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQDTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_002277054.2| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
 ref|XP_010660903.1| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
Length=181

 Score =   363 bits (933),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD+VLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDSVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIATKA  181



>ref|XP_002888782.1| hypothetical protein ARALYDRAFT_476172 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009127797.1| PREDICTED: ADP-ribosylation factor 2-B isoform X1 [Brassica rapa]
 ref|XP_009127798.1| PREDICTED: ADP-ribosylation factor 2-B isoform X1 [Brassica rapa]
 gb|EFH65041.1| hypothetical protein ARALYDRAFT_476172 [Arabidopsis lyrata subsp. 
lyrata]
Length=182

 Score =   363 bits (933),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGK  180



>ref|XP_006416080.1| hypothetical protein EUTSA_v10008884mg [Eutrema salsugineum]
 gb|ESQ34433.1| hypothetical protein EUTSA_v10008884mg [Eutrema salsugineum]
Length=181

 Score =   363 bits (933),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_004970327.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Setaria 
italica]
Length=182

 Score =   363 bits (933),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>gb|AFW67224.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=206

 Score =   364 bits (935),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATKV  181



>ref|NP_196971.1| ADP-ribosylation factor A1B [Arabidopsis thaliana]
 emb|CAB87634.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|AED92061.1| ADP-ribosylation factor A1B [Arabidopsis thaliana]
Length=188

 Score =   363 bits (933),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    NFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIATKV  181



>ref|XP_002318934.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 gb|EEE94857.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
Length=182

 Score =   363 bits (932),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 178/179 (99%), Gaps = 1/179 (1%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNE-DELRDAVLL  379
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNE DELRDAVLL
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEVDELRDAVLL  123

Query  378  VFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            VFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  VFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  182



>gb|ACU16903.1| unknown [Glycine max]
Length=204

 Score =   364 bits (934),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA  211
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA  178



>gb|AAC98042.1| Strong similarity to gb|M95166 ADP-ribosylation factor from Arabidopsis 
thaliana. ESTs gb|Z25826, gb|R90191, gb|N65697, gb|AA713150, 
gb|T46332, gb|AA040967, gb|AA712956, gb|T46403, 
gb|T46050, gb|AI100391 and gb|Z25043 come from this gene [Arabidopsis 
thaliana]
Length=188

 Score =   363 bits (933),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGK  180



>gb|AAO62347.1| ARF1-like GTP-binding protein [Gossypium hirsutum]
Length=181

 Score =   363 bits (932),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQD+IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN+DELRDAVLLV
Sbjct  64   TVWDVGGQDRIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNKDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKG  181



>ref|XP_009118871.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
Length=181

 Score =   363 bits (931),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLI VVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLISVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|AFW78457.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=182

 Score =   363 bits (931),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>ref|XP_009381359.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381360.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   363 bits (931),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FT+LFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTRLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI +KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSKA  181



>gb|AFW67226.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=241

 Score =   365 bits (937),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  56   TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  115

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  116  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  175

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA K
Sbjct  176  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATK  232



>ref|XP_002466220.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
 ref|XP_010227861.1| PREDICTED: ADP-ribosylation factor [Brachypodium distachyon]
 gb|EER93218.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
Length=181

 Score =   363 bits (931),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKS  181



>gb|ADB85106.1| ADP ribosylation factor 002 [Jatropha curcas]
Length=181

 Score =   363 bits (931),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQD PNAMNAAEITDKLGLHS RQRHWYIQSTCAT GEGLYEGLDWLSNNIAN+A
Sbjct  124  FANKQDFPNAMNAAEITDKLGLHSFRQRHWYIQSTCATFGEGLYEGLDWLSNNIANRA  181



>ref|XP_004981305.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Setaria italica]
Length=213

 Score =   364 bits (934),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKV  181



>ref|XP_009403841.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   362 bits (930),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/177 (98%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>gb|ABY76246.1| ADP-ribosylation factor [Brassica napus]
Length=181

 Score =   362 bits (930),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLP+AMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPDAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>ref|XP_009110098.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Brassica rapa]
Length=182

 Score =   362 bits (930),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGK  180



>gb|ACM67553.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
Length=181

 Score =   362 bits (930),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQD PNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+KA
Sbjct  124  FANKQDPPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKA  181



>gb|EMS51203.1| ADP-ribosylation factor 2 [Triticum urartu]
Length=233

 Score =   364 bits (935),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 181/187 (97%), Gaps = 2/187 (1%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*K  196
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  +
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK--E  181

Query  195  VE*VPSS  175
            V  VP  
Sbjct  182  VHFVPPP  188



>gb|ACM67554.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
Length=181

 Score =   362 bits (930),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFIRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKA  181



>ref|XP_009115521.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_009115522.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
Length=181

 Score =   362 bits (930),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILM GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMGGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA  181



>gb|ACF80896.1| unknown [Zea mays]
 gb|AFW67225.1| ADP-ribosylation factor [Zea mays]
Length=181

 Score =   362 bits (930),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATKS  181



>gb|AEX49947.1| ADP-ribosylation factor 1 [Haloxylon ammodendron]
Length=181

 Score =   362 bits (930),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/177 (98%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAM AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct  124  FANKQDLPNAMTAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>ref|XP_009393904.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393905.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   362 bits (929),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>ref|XP_011462890.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   362 bits (929),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKL SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLLSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDE+HRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDEVHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNA EITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNADEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_004981306.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Setaria italica]
Length=198

 Score =   363 bits (931),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  21   TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  80

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  81   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  140

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K+
Sbjct  141  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKS  198



>ref|XP_004158320.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus]
 ref|XP_008443537.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Cucumis 
melo]
 gb|KGN59683.1| hypothetical protein Csa_3G837640 [Cucumis sativus]
Length=181

 Score =   362 bits (929),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI +KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSKA  181



>ref|NP_001237492.1| uncharacterized protein LOC100499890 [Glycine max]
 gb|ACU14076.1| unknown [Glycine max]
Length=181

 Score =   362 bits (929),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRD VVEARDELH MLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDLVVEARDELHGMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_001764375.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70929.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   362 bits (929),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF++LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFTKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKA  181



>gb|AFW79615.1| hypothetical protein ZEAMMB73_444016, partial [Zea mays]
Length=210

 Score =   363 bits (931),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANK  180



>ref|XP_010674549.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score =   362 bits (928),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAM AAEITDKLGL+SLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMTAAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_004981304.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Setaria italica]
Length=230

 Score =   363 bits (933),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  21   TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  80

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  81   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  140

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K 
Sbjct  141  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKV  198



>ref|XP_009133804.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
Length=181

 Score =   362 bits (928),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHW IQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWDIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_009395959.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395960.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395962.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   362 bits (928),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FT+LFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTRLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI +KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSKA  181



>gb|EEE66819.1| hypothetical protein OsJ_23579 [Oryza sativa Japonica Group]
Length=279

 Score =   365 bits (937),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  102  AFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  161

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  162  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  221

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+KA
Sbjct  222  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  279



>gb|EAY92309.1| hypothetical protein OsI_14032 [Oryza sativa Indica Group]
Length=354

 Score =   368 bits (944),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKS  181



>gb|ABF74733.1| ADP-ribosylation factor 1 [Nicotiana benthamiana]
Length=181

 Score =   361 bits (927),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEI TTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIGTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQD PNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK+
Sbjct  124  FANKQDPPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKS  181



>ref|XP_009410044.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   361 bits (927),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>ref|XP_001776147.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ59058.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   361 bits (927),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF +LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFQKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKA  181



>ref|XP_009383762.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009383763.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
Length=180

 Score =   361 bits (927),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>gb|ABR17658.1| unknown [Picea sitchensis]
 gb|ACN40238.1| unknown [Picea sitchensis]
Length=181

 Score =   361 bits (927),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF R+FAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFQRMFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVAEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAM AAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMTAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_003557370.1| PREDICTED: ADP-ribosylation factor 1 [Brachypodium distachyon]
Length=181

 Score =   361 bits (927),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    AFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASKS  181



>ref|NP_001059207.1| Os07g0223400 [Oryza sativa Japonica Group]
 ref|NP_001147310.1| ADP-ribosylation factor 1 [Zea mays]
 ref|NP_001146953.1| ADP-ribosylation factor 1 [Zea mays]
 ref|XP_002459554.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 ref|XP_004955819.1| PREDICTED: ADP-ribosylation factor 1-like [Setaria italica]
 ref|XP_006657565.1| PREDICTED: ADP-ribosylation factor 1-like [Oryza brachyantha]
 gb|AAB65432.1| ADP-ribosylation factor 1 [Oryza sativa]
 dbj|BAC06914.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAC45192.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAD31195.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAF21121.1| Os07g0223400 [Oryza sativa Japonica Group]
 gb|ACF83333.1| unknown [Zea mays]
 gb|ACG24722.1| ADP-ribosylation factor 1 [Zea mays]
 gb|ACG26712.1| ADP-ribosylation factor 1 [Zea mays]
 dbj|BAH01227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81745.1| hypothetical protein OsI_25399 [Oryza sativa Indica Group]
 gb|EEC81746.1| hypothetical protein OsI_25400 [Oryza sativa Indica Group]
 gb|ACN30622.1| unknown [Zea mays]
 gb|EER96075.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 tpg|DAA60037.1| TPA: ADP-ribosylation factor 1 [Zea mays]
Length=181

 Score =   361 bits (927),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    AFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  181



>sp|O23778.3|ARF1_CATRO RecName: Full=ADP-ribosylation factor 1 [Catharanthus roseus]
 gb|AAB62249.1| ADP-ribosylation factor 1 [Catharanthus roseus]
Length=181

 Score =   361 bits (927),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILY+LKLGEIVTTIPTIGFNVETVEY+ ISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYQLKLGEIVTTIPTIGFNVETVEYQYISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDK GLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKHGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>ref|XP_001764701.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 ref|XP_001764769.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70400.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70468.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   361 bits (926),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF++LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFTKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIANK+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKS  181



>gb|AAU82112.1| ADP-ribosylation factor [Triticum aestivum]
Length=181

 Score =   361 bits (926),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFGRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATAGEGLYEGLDWLSSNIASKS  181



>gb|AAP69821.1| ARF [Oryza sativa Japonica Group]
Length=181

 Score =   360 bits (925),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TV DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVRDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANKA  181



>dbj|BAB90396.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
Length=376

 Score =   368 bits (944),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/177 (98%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  182  TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  241

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  242  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  301

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct  302  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  358



>ref|XP_003613219.1| ADP-ribosylation factor [Medicago truncatula]
Length=454

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/178 (99%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  277  TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  336

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  337  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  396

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  397  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  454


 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/177 (99%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  180



>ref|XP_008443534.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
 ref|XP_008443535.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
 ref|XP_008443536.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
Length=186

 Score =   360 bits (925),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI +K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSKV  181



>ref|XP_003557369.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon]
Length=181

 Score =   360 bits (924),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    AFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKS  181



>ref|NP_001168955.1| uncharacterized protein LOC100382775 [Zea mays]
 gb|ACN31185.1| unknown [Zea mays]
 gb|AFW84789.1| hypothetical protein ZEAMMB73_845118 [Zea mays]
Length=181

 Score =   360 bits (924),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NI++K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNISSKS  181



>ref|XP_002312302.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_011019121.1| PREDICTED: ADP-ribosylation factor 1-like [Populus euphratica]
 gb|ABK94475.1| unknown [Populus trichocarpa]
 gb|EEE89669.1| ADP-ribosylation factor family protein [Populus trichocarpa]
Length=181

 Score =   360 bits (924),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKL  RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLLGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>ref|XP_009420958.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420959.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   360 bits (924),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/177 (97%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIA+K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIASK  180



>ref|XP_007224194.1| hypothetical protein PRUPE_ppa017304mg [Prunus persica]
 gb|EMJ25393.1| hypothetical protein PRUPE_ppa017304mg [Prunus persica]
Length=182

 Score =   360 bits (923),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDA+GKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDASGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDRVVEARDE+HRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRVVEARDEMHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKL LHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI +KA
Sbjct  124  FANKQDLPNAMNAAEITDKLNLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNITSKA  181



>ref|NP_001105897.1| ADP-ribosylation factor [Zea mays]
 sp|P49076.2|ARF_MAIZE RecName: Full=ADP-ribosylation factor [Zea mays]
 emb|CAA56351.1| ADP-ribosylation factor [Zea mays]
Length=181

 Score =   360 bits (923),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGL+SLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLNSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATKS  181



>ref|XP_011462888.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=216

 Score =   361 bits (926),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKL SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  39   SFTKLLSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  98

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDE+HRMLNEDELRDAVLLV
Sbjct  99   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDEVHRMLNEDELRDAVLLV  158

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNA EITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  159  FANKQDLPNAMNADEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  216



>gb|AFW79619.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=278

 Score =   363 bits (932),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKV  181



>gb|EAY73411.1| hypothetical protein OsI_01294 [Oryza sativa Indica Group]
 gb|EAZ11343.1| hypothetical protein OsJ_01211 [Oryza sativa Japonica Group]
Length=216

 Score =   361 bits (926),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIANK  180



>gb|KJB09503.1| hypothetical protein B456_001G146100 [Gossypium raimondii]
Length=181

 Score =   359 bits (922),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFS LF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSWLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHR LNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRTLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHS RQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSPRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  181



>gb|EEE66818.1| hypothetical protein OsJ_23578 [Oryza sativa Japonica Group]
Length=241

 Score =   362 bits (928),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/178 (97%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  64   AFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  123

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  124  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  183

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+KA
Sbjct  184  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  241



>gb|EMT22177.1| ADP-ribosylation factor [Aegilops tauschii]
Length=263

 Score =   362 bits (930),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  27   TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  86

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  87   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  146

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+K
Sbjct  147  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK  203



>ref|XP_010674548.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   359 bits (922),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/177 (98%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAM AAEITDKLGL+SLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K
Sbjct  124  FANKQDLPNAMTAAEITDKLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK  180



>gb|ACG31280.1| ADP-ribosylation factor 1 [Zea mays]
Length=181

 Score =   359 bits (921),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILM GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    AFGKLFSRLFAKKEMRILMFGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASKA  181



>ref|XP_005643690.1| ADP-ribosylation factor 1 [Coccomyxa subellipsoidea C-169]
 gb|EIE19146.1| ADP-ribosylation factor 1 [Coccomyxa subellipsoidea C-169]
Length=181

 Score =   359 bits (921),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF+RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    AFTKLFARLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIGEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKG  181



>ref|XP_001764700.1| predicted protein [Physcomitrella patens]
 gb|EDQ70399.1| predicted protein [Physcomitrella patens]
Length=190

 Score =   359 bits (922),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 171/177 (97%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF +LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFQKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIANK
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANK  180



>ref|XP_002314987.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006378561.1| hypothetical protein POPTR_0010s16240g [Populus trichocarpa]
 ref|XP_011011379.1| PREDICTED: ADP-ribosylation factor 1 [Populus euphratica]
 sp|O48649.3|ARF1_SALBA RecName: Full=ADP-ribosylation factor 1 [Salix bakko]
 dbj|BAA24696.1| ADP-ribosylation factor [Salix bakko]
 gb|AAO63780.1| ADP-ribosylation factor 2 [Populus tremuloides]
 gb|ABK92843.1| unknown [Populus trichocarpa]
 gb|EEF01158.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP56358.1| hypothetical protein POPTR_0010s16240g [Populus trichocarpa]
Length=181

 Score =   359 bits (921),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKL  RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLLGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI++KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKA  181



>ref|XP_001776112.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ59023.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   358 bits (920),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 170/178 (96%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFS+LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLP+AMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NI NK+
Sbjct  124  FANKQDLPDAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNITNKS  181



>ref|XP_009394868.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   358 bits (920),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/178 (96%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FT+LFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTRLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLR RHWYIQS CATSGEGLYEGLDWLSNNI  KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRHRHWYIQSACATSGEGLYEGLDWLSNNIVTKA  181



>gb|AAT08663.1| ADP-ribosylation factor [Hyacinthus orientalis]
Length=181

 Score =   358 bits (919),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F K+FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    AFGKIFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGL SLRQRHWYIQSTCATSGEGLYEGLDWLS+NI+NK+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLQSLRQRHWYIQSTCATSGEGLYEGLDWLSSNISNKS  181



>ref|XP_006438364.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 gb|ESR51604.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
Length=195

 Score =   358 bits (920),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 178/192 (93%), Gaps = 14/192 (7%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTI--------------  598
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTI              
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIAIQGCNCLNVRLST  63

Query  597  GFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHR  418
            GFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHR
Sbjct  64   GFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHR  123

Query  417  MLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEG  238
            MLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEG
Sbjct  124  MLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEG  183

Query  237  LDWLSNNIANKA  202
            LDWLSNNIANKA
Sbjct  184  LDWLSNNIANKA  195



>ref|XP_001776146.1| predicted protein [Physcomitrella patens]
 gb|EDQ59057.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   358 bits (919),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF+RLF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFTRLFSKQEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDEL RMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELLRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS+NIANK+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKS  181



>ref|XP_004141190.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus]
Length=368

 Score =   365 bits (936),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/178 (98%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  188  TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  247

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  248  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  307

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K 
Sbjct  308  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKV  365


 Score =   360 bits (925),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/177 (97%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI +K
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVSK  180



>ref|XP_010694842.1| PREDICTED: ADP-ribosylation factor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=181

 Score =   358 bits (918),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/178 (97%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELR AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRYAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKG  181



>gb|KCW56007.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=179

 Score =   357 bits (917),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/178 (98%), Positives = 176/178 (99%), Gaps = 2/178 (1%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN  ELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN--ELRDAVLLV  121

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  122  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  179



>emb|CBI39638.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  414  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  473

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  474  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  533

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct  534  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  591



>sp|P51821.2|ARF1_CHLRE RecName: Full=ADP-ribosylation factor 1 [Chlamydomonas reinhardtii]
 gb|AAA92566.1| ADP-ribosylation factor [Chlamydomonas reinhardtii]
Length=181

 Score =   357 bits (917),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/176 (97%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = -1

Query  732  FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFT  553
            FTK  SRLF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFT
Sbjct  5    FTKALSRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFT  64

Query  552  VWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVF  373
            VWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAVLLVF
Sbjct  65   VWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVF  124

Query  372  ANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            ANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN+ANK
Sbjct  125  ANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNLANK  180



>ref|XP_008223454.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
 ref|XP_008223455.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
Length=181

 Score =   357 bits (917),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDA+GKTTILYKLKLGEIVTTIPTIGFNVET+EYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDASGKTTILYKLKLGEIVTTIPTIGFNVETLEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDRVVEARDE+HRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRVVEARDEMHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKL LHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI +K 
Sbjct  124  FANKQDLPNAMNAAEITDKLSLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNITSKV  181



>gb|ACU13131.1| unknown [Glycine max]
Length=180

 Score =   357 bits (915),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/174 (98%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI  214
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLS  +
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSTTL  177



>gb|AAO63779.1| ADP-ribosylation factor 1 [Populus tremuloides]
Length=181

 Score =   357 bits (915),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKL  RLF++KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFTKLLGRLFSEKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EAR+ELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEAREELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA  181



>gb|ABR25719.1| ADP-ribosylation factor 1 [Oryza sativa Indica Group]
Length=181

 Score =   356 bits (914),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    AFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGL SLRQRHWYIQSTCAT+GEGLYEGLDWLS+N+A+KA
Sbjct  124  FANKQDLPNAMNAAEITDKLGLLSLRQRHWYIQSTCATTGEGLYEGLDWLSSNLASKA  181



>ref|XP_009105711.1| PREDICTED: ADP-ribosylation factor 2-B-like [Brassica rapa]
Length=181

 Score =   356 bits (914),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL++N A K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLAHNNAGKG  181



>ref|XP_007147411.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris]
 gb|ESW19405.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris]
Length=184

 Score =   353 bits (907),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF K+FSRL AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKIFSRLCAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITD+LGL+SLRQRHWYIQSTCATSGEGLYEGLDWLSNNI++K
Sbjct  124  FANKQDLPNAMNAAEITDRLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSK  180



>ref|XP_003055413.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60665.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   353 bits (906),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/176 (95%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFQRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN  208
            FANKQDLPNAM AAEITDKLGLHS+RQRHW+IQSTCATSGEGLYEGLDWLS NIAN
Sbjct  124  FANKQDLPNAMTAAEITDKLGLHSIRQRHWFIQSTCATSGEGLYEGLDWLSTNIAN  179



>ref|XP_001420856.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_003082427.1| unnamed protein product [Ostreococcus tauri]
 gb|ABO99149.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=181

 Score =   352 bits (904),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFAKLFQRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAM+AAEITDKLGLHSLRQRHW+IQSTCATSGEGLYEGLDWLS+NI+ +A
Sbjct  124  FANKQDLPNAMSAAEITDKLGLHSLRQRHWFIQSTCATSGEGLYEGLDWLSSNISQRA  181



>dbj|BAK00965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   352 bits (903),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF  LF  LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGTLFGALFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIAEARDELHRMLNEDELRNAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CATSGEGLYEGLDWLSNNIA+K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS  181



>emb|CEF99966.1| Small GTPase superfamily, ARF/SAR type [Ostreococcus tauri]
Length=209

 Score =   353 bits (905),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +F KLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  32   TFAKLFQRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  91

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAVLLV
Sbjct  92   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAVLLV  151

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAM+AAEITDKLGLHSLRQRHW+IQSTCATSGEGLYEGLDWLS+NI+ +A
Sbjct  152  FANKQDLPNAMSAAEITDKLGLHSLRQRHWFIQSTCATSGEGLYEGLDWLSSNISQRA  209



>ref|XP_003533111.1| PREDICTED: ADP-ribosylation factor 2-B-like [Glycine max]
 gb|KHN44681.1| ADP-ribosylation factor 2-B [Glycine soja]
Length=184

 Score =   352 bits (902),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLFS+L AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGKLFSKLCAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EA+DELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEAKDELHRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITD+LGL+SLRQRHWYIQSTCATSGEGLYEGLDWLSNNI+ KA
Sbjct  124  FANKQDLPNAMNAAEITDRLGLNSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISGKA  181



>ref|XP_002973399.1| ARF family GTPase [Selaginella moellendorffii]
 ref|XP_002976510.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ22179.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ25773.1| ARF family GTPase [Selaginella moellendorffii]
Length=181

 Score =   351 bits (901),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF KLF R   KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFAKLFQRFLGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELREAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI  K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIVTKS  181



>gb|KIY96152.1| ADP-ribosylation factor 1 [Monoraphidium neglectum]
Length=181

 Score =   351 bits (900),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            + +KL SRL AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TISKLLSRLIAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDEL RMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIGEARDELQRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKG  181



>ref|XP_003578999.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon]
Length=181

 Score =   351 bits (900),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SF  LF  LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    SFGTLFGALFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+ EARDELHRMLNEDELR+AVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERITEARDELHRMLNEDELRNAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CATSGEGLYEGLDWLSNNIA+K+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSACATSGEGLYEGLDWLSNNIASKS  181



>ref|XP_005845590.1| hypothetical protein CHLNCDRAFT_49011 [Chlorella variabilis]
 gb|EFN53488.1| hypothetical protein CHLNCDRAFT_49011 [Chlorella variabilis]
Length=183

 Score =   350 bits (899),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 2/179 (1%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLF+RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFARLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDK--IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVL  382
            TVWDVGGQDK  IRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELRDAVL
Sbjct  64   TVWDVGGQDKASIRPLWRHYFQNTQGLIFVVDSNDRDRIGEARDELHRMLNEDELRDAVL  123

Query  381  LVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            LVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQS CATSGEGLYEGLDWLS NIAN+
Sbjct  124  LVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSCCATSGEGLYEGLDWLSQNIANR  182



>gb|AGT16095.1| ADP-ribosylation factor [Saccharum hybrid cultivar R570]
Length=176

 Score =   350 bits (898),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/178 (96%), Positives = 173/178 (97%), Gaps = 5/178 (3%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            +FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGG     PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  64   TVWDVGG-----PLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  118

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCAT+GEGLYEGLDWLSNNIANKA
Sbjct  119  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSNNIANKA  176



>gb|KIY94970.1| ADP-ribosylation factor 1 [Monoraphidium neglectum]
Length=181

 Score =   350 bits (897),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            + +KL SRL AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TISKLLSRLIAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDEL RMLNEDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIGEARDELQRMLNEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA++ 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASRG  181



>gb|EYU46843.1| hypothetical protein MIMGU_mgv1a020290mg [Erythranthe guttata]
Length=183

 Score =   348 bits (894),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            SFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE+KNI+F
Sbjct  4    SFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEFKNINF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWD+GGQDKIRPLWR+YFQNTQGLIFVVDS DRDR+VEARDELH+MLNED+LRDAVLLV
Sbjct  64   TVWDIGGQDKIRPLWRYYFQNTQGLIFVVDSIDRDRIVEARDELHKMLNEDQLRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            FANKQDLPNAMNAAEITDKLGLHS+ +RHWYIQSTCATSGEGLYEGLDWLSNNIANK 
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSIGKRHWYIQSTCATSGEGLYEGLDWLSNNIANKV  181



>sp|P51824.2|ARF1_SOLTU RecName: Full=ADP-ribosylation factor 1 [Solanum tuberosum]
 emb|CAA52468.1| ADP-ribosylation factor 1 [Solanum tuberosum]
Length=197

 Score =   346 bits (888),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -1

Query  735  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  556
            + +KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  4    TISKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  63

Query  555  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  376
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EAR+EL RML EDELRDAVLLV
Sbjct  64   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVNEAREELMRMLAEDELRDAVLLV  123

Query  375  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK  205
            FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSN I N+
Sbjct  124  FANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNQIRNQ  180



>ref|XP_001690893.1| small ARF-related GTPase [Chlamydomonas reinhardtii]
 ref|XP_001691481.1| small ARF-related GTPase [Chlamydomonas reinhardtii]
 gb|EDO96164.1| small ARF-related GTPase [Chlamydomonas reinhardtii]
 gb|EDP05339.1| small ARF-related GTPase [Chlamydomonas reinhardtii]
Length=181

 Score =   345 bits (886),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  729  TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV  550
            +K  SRLF KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV
Sbjct  6    SKALSRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV  65

Query  549  WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFA  370
            WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EA+DELHRMLNEDELRDAVLLVFA
Sbjct  66   WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIGEAKDELHRMLNEDELRDAVLLVFA  125

Query  369  NKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA  202
            NKQDLPNAMNAAEIT+KLGLH LRQRHWYIQSTCATSGEGLYEGLDWLS NI NK+
Sbjct  126  NKQDLPNAMNAAEITEKLGLHGLRQRHWYIQSTCATSGEGLYEGLDWLSQNIQNKS  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500