BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003L08

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617349.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    206   4e-60   Nicotiana tomentosiformis
ref|XP_009778598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    205   7e-60   Nicotiana sylvestris
ref|XP_009762973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    202   6e-59   Nicotiana sylvestris
ref|XP_009626445.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    202   8e-59   Nicotiana tomentosiformis
ref|XP_006339453.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    201   1e-58   Solanum tuberosum [potatoes]
ref|XP_011091747.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    200   1e-58   
ref|XP_004240042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    202   2e-58   Solanum lycopersicum
ref|XP_004229832.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    201   3e-58   Solanum lycopersicum
ref|XP_006345510.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    199   1e-57   Solanum tuberosum [potatoes]
gb|EYU32071.1|  hypothetical protein MIMGU_mgv1a008136mg                196   2e-56   Erythranthe guttata [common monkey flower]
gb|EYU35067.1|  hypothetical protein MIMGU_mgv1a008119mg                194   1e-55   Erythranthe guttata [common monkey flower]
emb|CDP08874.1|  unnamed protein product                                192   5e-55   Coffea canephora [robusta coffee]
emb|CAN65431.1|  hypothetical protein VITISV_017099                     187   1e-53   Vitis vinifera
ref|XP_011093163.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    188   2e-53   Sesamum indicum [beniseed]
emb|CBI38762.3|  unnamed protein product                                186   2e-53   Vitis vinifera
ref|XP_002271651.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    188   2e-53   Vitis vinifera
ref|XP_007211433.1|  hypothetical protein PRUPE_ppa007140mg             186   2e-52   Prunus persica
ref|XP_008225188.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    185   2e-52   Prunus mume [ume]
gb|EPS63490.1|  hypothetical protein M569_11294                         183   5e-52   Genlisea aurea
ref|XP_004295567.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    183   2e-51   Fragaria vesca subsp. vesca
ref|XP_010255490.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    178   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010255491.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    178   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010255487.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    179   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010255488.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    179   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_007051906.1|  RING/U-box superfamily protein, putative           176   9e-49   Theobroma cacao [chocolate]
ref|XP_009352819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    174   6e-48   Pyrus x bretschneideri [bai li]
ref|XP_009346865.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    173   9e-48   Pyrus x bretschneideri [bai li]
ref|XP_008358659.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    172   1e-47   
ref|XP_006491024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    171   4e-47   Citrus sinensis [apfelsine]
gb|KDO86036.1|  hypothetical protein CISIN_1g017405mg                   171   5e-47   Citrus sinensis [apfelsine]
ref|XP_006445135.1|  hypothetical protein CICLE_v10020664mg             171   6e-47   Citrus clementina [clementine]
ref|XP_010101531.1|  E3 ubiquitin-protein ligase                        167   7e-47   
ref|XP_008345901.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    170   2e-46   Malus domestica [apple tree]
ref|XP_010278588.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    170   2e-46   
ref|XP_010278590.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    170   2e-46   
ref|XP_010278589.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    169   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010278591.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    169   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_008799543.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    168   5e-46   Phoenix dactylifera
ref|XP_008799545.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    168   5e-46   Phoenix dactylifera
gb|KDP28678.1|  hypothetical protein JCGZ_14449                         166   1e-45   Jatropha curcas
emb|CBI34726.3|  unnamed protein product                                164   2e-45   Vitis vinifera
ref|XP_004511598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    167   3e-45   Cicer arietinum [garbanzo]
ref|XP_008438087.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    165   1e-44   Cucumis melo [Oriental melon]
ref|XP_010661149.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    165   1e-44   Vitis vinifera
ref|XP_003631422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    165   1e-44   Vitis vinifera
gb|KHN35002.1|  E3 ubiquitin-protein ligase                             162   2e-44   Glycine soja [wild soybean]
ref|XP_007158469.1|  hypothetical protein PHAVU_002G155000g             165   2e-44   Phaseolus vulgaris [French bean]
ref|XP_008800795.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    164   2e-44   Phoenix dactylifera
ref|XP_006590532.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    164   2e-44   Glycine max [soybeans]
ref|XP_003538385.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    164   3e-44   Glycine max [soybeans]
ref|XP_010533709.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    164   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_003517458.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    164   4e-44   Glycine max [soybeans]
gb|KDO63537.1|  hypothetical protein CISIN_1g020491mg                   162   4e-44   Citrus sinensis [apfelsine]
gb|KDO63536.1|  hypothetical protein CISIN_1g020491mg                   162   4e-44   Citrus sinensis [apfelsine]
gb|KDO63535.1|  hypothetical protein CISIN_1g020491mg                   162   4e-44   Citrus sinensis [apfelsine]
ref|XP_002301335.1|  zinc finger family protein                         163   5e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006440563.1|  hypothetical protein CICLE_v10020554mg             163   5e-44   Citrus clementina [clementine]
ref|XP_006477420.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    163   5e-44   Citrus sinensis [apfelsine]
ref|XP_004133878.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    163   5e-44   Cucumis sativus [cucumbers]
ref|XP_006440560.1|  hypothetical protein CICLE_v10020554mg             163   5e-44   Citrus clementina [clementine]
ref|XP_006440561.1|  hypothetical protein CICLE_v10020554mg             163   5e-44   Citrus clementina [clementine]
ref|XP_006477421.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    163   5e-44   Citrus sinensis [apfelsine]
ref|XP_006477422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    163   6e-44   Citrus sinensis [apfelsine]
ref|XP_006477419.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    163   6e-44   Citrus sinensis [apfelsine]
ref|XP_006477418.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    163   6e-44   Citrus sinensis [apfelsine]
ref|XP_006440562.1|  hypothetical protein CICLE_v10020554mg             163   7e-44   Citrus clementina [clementine]
ref|XP_011023403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    162   1e-43   Populus euphratica
ref|XP_010053666.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    162   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010671755.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    162   2e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB39631.1|  hypothetical protein B456_007G022500                    161   3e-43   Gossypium raimondii
gb|KHN34425.1|  E3 ubiquitin-protein ligase                             157   3e-43   Glycine soja [wild soybean]
ref|XP_008383660.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    161   3e-43   
ref|XP_010934468.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    160   5e-43   Elaeis guineensis
ref|XP_010934467.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    160   5e-43   Elaeis guineensis
ref|XP_010919263.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    160   7e-43   Elaeis guineensis
ref|XP_010919264.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    160   7e-43   Elaeis guineensis
gb|KDP25486.1|  hypothetical protein JCGZ_20642                         160   1e-42   Jatropha curcas
ref|XP_002509740.1|  cleavage and polyadenylation specificity fac...    159   1e-42   Ricinus communis
gb|KHG00577.1|  hypothetical protein F383_17805                         159   2e-42   Gossypium arboreum [tree cotton]
gb|EMT12642.1|  E3 ubiquitin-protein ligase                             155   2e-42   
ref|XP_002511805.1|  cleavage and polyadenylation specificity fac...    159   2e-42   Ricinus communis
ref|XP_008448958.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    159   3e-42   Cucumis melo [Oriental melon]
gb|KHG14407.1|  hypothetical protein F383_04260                         159   3e-42   Gossypium arboreum [tree cotton]
ref|XP_008438088.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    159   3e-42   
ref|XP_003611137.1|  E3 ubiquitin-protein ligase                        158   3e-42   Medicago truncatula
gb|KHG06982.1|  hypothetical protein F383_33104                         158   5e-42   Gossypium arboreum [tree cotton]
gb|EEE57561.1|  hypothetical protein OsJ_07906                          154   5e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002320752.2|  hypothetical protein POPTR_0014s07100g             150   6e-42   
ref|XP_009393489.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   8e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006391774.1|  hypothetical protein EUTSA_v10023515mg             157   8e-42   Eutrema salsugineum [saltwater cress]
ref|XP_006391773.1|  hypothetical protein EUTSA_v10023515mg             157   8e-42   Eutrema salsugineum [saltwater cress]
gb|KJB25759.1|  hypothetical protein B456_004G208600                    157   8e-42   Gossypium raimondii
ref|XP_004147971.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   8e-42   
ref|XP_003550874.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   9e-42   Glycine max [soybeans]
ref|XP_009345443.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   1e-41   Pyrus x bretschneideri [bai li]
gb|KCW77597.1|  hypothetical protein EUGRSUZ_D01910                     155   1e-41   Eucalyptus grandis [rose gum]
gb|KCW77596.1|  hypothetical protein EUGRSUZ_D01910                     155   1e-41   Eucalyptus grandis [rose gum]
ref|XP_009345444.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_009345445.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_007155554.1|  hypothetical protein PHAVU_003G211600g             157   1e-41   Phaseolus vulgaris [French bean]
gb|KJB20719.1|  hypothetical protein B456_003G161000                    157   1e-41   Gossypium raimondii
ref|XP_009345446.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    157   1e-41   Pyrus x bretschneideri [bai li]
dbj|BAJ98696.1|  predicted protein                                      156   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB20720.1|  hypothetical protein B456_003G161000                    157   1e-41   Gossypium raimondii
ref|NP_001031032.1|  E3 ubiquitin-protein ligase                        155   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053324.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    157   2e-41   Eucalyptus grandis [rose gum]
gb|AFW63358.1|  putative RING zinc finger domain superfamily protein    152   2e-41   
ref|XP_011033783.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    156   2e-41   Populus euphratica
ref|XP_011033785.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    156   2e-41   Populus euphratica
ref|XP_011033784.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    156   2e-41   Populus euphratica
ref|XP_006417201.1|  hypothetical protein EUTSA_v10007780mg             157   3e-41   Eutrema salsugineum [saltwater cress]
ref|NP_172736.2|  E3 ubiquitin-protein ligase                           156   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525718.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   3e-41   Glycine max [soybeans]
ref|NP_001047717.2|  Os02g0674700                                       155   3e-41   
ref|XP_003570086.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    155   3e-41   Brachypodium distachyon [annual false brome]
ref|XP_002889965.1|  protein binding protein                            154   4e-41   
ref|XP_009369023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   4e-41   Pyrus x bretschneideri [bai li]
emb|CDY16029.1|  BnaC08g40940D                                          155   5e-41   Brassica napus [oilseed rape]
ref|XP_009369024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_009369025.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_009369026.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_010494577.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010476241.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   6e-41   Camelina sativa [gold-of-pleasure]
dbj|BAD29468.1|  ring zinc finger protein-like                          155   6e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010458710.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011463818.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    155   6e-41   Fragaria vesca subsp. vesca
gb|KFK43535.1|  hypothetical protein AALP_AA1G139400                    155   6e-41   Arabis alpina [alpine rockcress]
ref|XP_011463819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    155   6e-41   Fragaria vesca subsp. vesca
ref|XP_008392388.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   7e-41   
ref|XP_008392389.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   8e-41   
ref|XP_008392390.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   8e-41   
ref|XP_008238809.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   8e-41   Prunus mume [ume]
ref|XP_008238810.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   8e-41   Prunus mume [ume]
ref|XP_008392391.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   8e-41   
ref|XP_010940871.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    155   8e-41   Elaeis guineensis
ref|XP_008232745.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    154   8e-41   Prunus mume [ume]
dbj|BAK01729.1|  predicted protein                                      154   9e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007209235.1|  hypothetical protein PRUPE_ppa007012mg             155   9e-41   Prunus persica
ref|XP_010940872.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    154   9e-41   Elaeis guineensis
ref|XP_002303571.2|  hypothetical protein POPTR_0003s12350g             155   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_009112972.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    154   1e-40   Brassica rapa
gb|EMT20198.1|  E3 ubiquitin-protein ligase                             151   1e-40   
gb|ACF87715.1|  unknown                                                 152   1e-40   Zea mays [maize]
ref|XP_006304987.1|  hypothetical protein CARUB_v10009353mg             154   1e-40   Capsella rubella
gb|KHG00725.1|  hypothetical protein F383_22058                         154   1e-40   Gossypium arboreum [tree cotton]
dbj|BAK00653.1|  predicted protein                                      154   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB52052.1|  hypothetical protein B456_008G244300                    154   2e-40   Gossypium raimondii
ref|NP_001130198.1|  uncharacterized LOC100191292                       154   2e-40   Zea mays [maize]
ref|XP_009411463.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    154   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540663.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_007220471.1|  hypothetical protein PRUPE_ppa007521mg             153   2e-40   Prunus persica
ref|XP_010540671.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010540654.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010540680.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|NP_001147541.1|  protein binding protein                            153   3e-40   Zea mays [maize]
ref|XP_009118058.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    153   3e-40   Brassica rapa
gb|ACF78887.1|  unknown                                                 153   4e-40   Zea mays [maize]
ref|XP_003570089.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    152   4e-40   Brachypodium distachyon [annual false brome]
ref|XP_009112973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    152   5e-40   Brassica rapa
emb|CDY49194.1|  BnaA09g10840D                                          152   5e-40   Brassica napus [oilseed rape]
ref|XP_002887973.1|  zinc finger family protein                         152   6e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_009118057.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    152   6e-40   Brassica rapa
gb|AGG16262.1|  C3HC4 type RING finger                                  147   7e-40   Oryza sativa Japonica Group [Japonica rice]
emb|CDY47347.1|  BnaCnng14840D                                          151   8e-40   Brassica napus [oilseed rape]
gb|AAO72540.1|  ring zinc finger protein-like protein                   149   9e-40   Oryza sativa Japonica Group [Japonica rice]
emb|CDY60265.1|  BnaC05g49290D                                          151   1e-39   Brassica napus [oilseed rape]
ref|XP_008803037.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    152   1e-39   Phoenix dactylifera
ref|XP_006402511.1|  hypothetical protein EUTSA_v10006041mg             151   1e-39   
ref|XP_008803038.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    152   1e-39   Phoenix dactylifera
gb|KFK40526.1|  hypothetical protein AALP_AA2G007300                    151   1e-39   Arabis alpina [alpine rockcress]
ref|NP_564810.1|  zinc finger, C3HC4 type (RING finger) family pr...    151   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001053593.2|  Os04g0568900                                       149   1e-39   
ref|NP_567110.1|  RING/U-box superfamily protein                        151   1e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CAB71048.1|  putative protein                                       151   1e-39   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA39681.1|  TPA: putative RING zinc finger domain superfamil...    146   2e-39   
emb|CAE02249.2|  OSJNBb0032E06.5                                        150   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010112554.1|  E3 ubiquitin-protein ligase                        151   2e-39   Morus notabilis
gb|AAM63303.1|  unknown                                                 151   2e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CDY26592.1|  BnaA09g46850D                                          151   2e-39   Brassica napus [oilseed rape]
ref|XP_010529546.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    151   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_006302394.1|  hypothetical protein CARUB_v10020462mg             150   3e-39   Capsella rubella
ref|XP_010529547.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    150   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_011035074.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    150   4e-39   Populus euphratica
ref|XP_011035066.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    150   4e-39   Populus euphratica
emb|CDY31275.1|  BnaC08g15700D                                          150   4e-39   Brassica napus [oilseed rape]
emb|CDY66607.1|  BnaA06g38090D                                          150   6e-39   Brassica napus [oilseed rape]
ref|XP_004956145.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    149   6e-39   Setaria italica
ref|XP_004956144.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    149   6e-39   Setaria italica
ref|XP_010430403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    150   7e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007040144.1|  Zinc finger, C3HC4 type (RING finger) family...    149   7e-39   Theobroma cacao [chocolate]
ref|XP_007040145.1|  Zinc finger, C3HC4 type (RING finger) family...    149   7e-39   Theobroma cacao [chocolate]
ref|XP_009148567.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    150   7e-39   Brassica rapa
ref|XP_010545919.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    150   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_010545936.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    150   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_010545928.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    150   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_010545944.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    150   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_004515807.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    149   8e-39   Cicer arietinum [garbanzo]
ref|XP_006279087.1|  hypothetical protein CARUB_v10012711mg             149   8e-39   Capsella rubella
ref|XP_010473550.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    149   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003563155.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    149   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_010418331.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    149   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006652656.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    146   1e-38   Oryza brachyantha
emb|CDY70309.1|  BnaCnng67740D                                          149   1e-38   Brassica napus [oilseed rape]
ref|XP_002876598.1|  hypothetical protein ARALYDRAFT_486593             149   2e-38   
emb|CDY21061.1|  BnaA08g24640D                                          147   2e-38   Brassica napus [oilseed rape]
ref|XP_002320753.2|  hypothetical protein POPTR_0014s07110g             148   2e-38   
ref|XP_006396865.1|  hypothetical protein EUTSA_v10028703mg             149   2e-38   Eutrema salsugineum [saltwater cress]
emb|CDX74763.1|  BnaA05g05090D                                          148   2e-38   
ref|XP_002459812.1|  hypothetical protein SORBIDRAFT_02g011130          148   2e-38   Sorghum bicolor [broomcorn]
ref|XP_010544693.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    148   2e-38   Tarenaya hassleriana [spider flower]
emb|CDX71761.1|  BnaC08g31130D                                          148   2e-38   
ref|XP_010544692.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    148   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_006294289.1|  hypothetical protein CARUB_v10023298mg             149   3e-38   
ref|XP_009116780.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   3e-38   Brassica rapa
ref|XP_008670056.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    147   3e-38   
emb|CDY52328.1|  BnaA09g38770D                                          147   3e-38   Brassica napus [oilseed rape]
ref|XP_009110629.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    148   3e-38   Brassica rapa
gb|ADK63393.1|  C3HC4 type zinc finger protein                          146   4e-38   Brassica rapa
ref|XP_009110628.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    148   4e-38   Brassica rapa
ref|XP_009420927.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    146   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008355581.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    147   4e-38   
ref|XP_008355582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    147   4e-38   
ref|XP_008355580.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    147   4e-38   
ref|XP_008355584.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    147   5e-38   
ref|NP_001059583.1|  Os07g0463400                                       147   5e-38   
gb|EEC81984.1|  hypothetical protein OsI_25906                          147   6e-38   Oryza sativa Indica Group [Indian rice]
gb|KFK31927.1|  hypothetical protein AALP_AA6G177200                    147   6e-38   Arabis alpina [alpine rockcress]
gb|KFK37366.1|  hypothetical protein AALP_AA4G247400                    147   6e-38   Arabis alpina [alpine rockcress]
gb|KHN24279.1|  E3 ubiquitin-protein ligase                             141   9e-38   Glycine soja [wild soybean]
gb|AAL24200.1|  At1g63170/F16M19_7                                      146   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567379.1|  E3 ubiquitin-protein ligase                           146   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401774.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382298.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    146   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401775.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004976528.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    146   1e-37   Setaria italica
ref|XP_008363169.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    141   1e-37   
tpg|DAA60522.1|  TPA: putative RING zinc finger domain superfamil...    145   2e-37   
emb|CDY57781.1|  BnaCnng32440D                                          146   2e-37   Brassica napus [oilseed rape]
ref|NP_001151256.1|  protein binding protein                            145   2e-37   Zea mays [maize]
ref|XP_009143169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    145   2e-37   Brassica rapa
ref|XP_008389094.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    142   2e-37   
ref|XP_010434567.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    145   3e-37   Camelina sativa [gold-of-pleasure]
gb|ACN40787.1|  unknown                                                 145   3e-37   Picea sitchensis
ref|XP_010422123.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    145   3e-37   Camelina sativa [gold-of-pleasure]
gb|KHN29414.1|  E3 ubiquitin-protein ligase                             143   3e-37   Glycine soja [wild soybean]
ref|XP_004493023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    144   3e-37   Cicer arietinum [garbanzo]
emb|CDY37062.1|  BnaA04g26400D                                          145   3e-37   Brassica napus [oilseed rape]
ref|XP_002880197.1|  hypothetical protein ARALYDRAFT_322232             145   4e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_010092737.1|  E3 ubiquitin-protein ligase                        145   4e-37   
ref|XP_009124794.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    145   4e-37   Brassica rapa
ref|XP_010469042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    144   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_003533627.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    144   6e-37   Glycine max [soybeans]
gb|KEH31714.1|  zinc finger, C3HC4 type (RING finger) protein           144   6e-37   Medicago truncatula
ref|XP_008651537.1|  PREDICTED: protein binding protein isoform X2      144   8e-37   Zea mays [maize]
ref|XP_008651536.1|  PREDICTED: protein binding protein isoform X1      144   8e-37   Zea mays [maize]
emb|CDX86759.1|  BnaA09g21490D                                          144   8e-37   
ref|XP_010413448.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006658537.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    142   1e-36   Oryza brachyantha
gb|KHF98416.1|  hypothetical protein F383_13016                         143   1e-36   Gossypium arboreum [tree cotton]
ref|XP_010512452.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_011035055.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    143   2e-36   Populus euphratica
ref|XP_008390260.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    138   2e-36   
ref|XP_011035060.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    143   2e-36   Populus euphratica
gb|KJB41239.1|  hypothetical protein B456_007G096300                    143   2e-36   Gossypium raimondii
gb|ADK63418.1|  C3HC4 type zinc finger protein                          142   3e-36   Brassica rapa
ref|XP_008662009.1|  PREDICTED: LOC100284185 isoform X1                 142   3e-36   
ref|XP_009801536.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    138   5e-36   Nicotiana sylvestris
ref|XP_008354302.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    141   5e-36   
ref|XP_010933858.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    141   7e-36   Elaeis guineensis
ref|XP_009142362.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    141   7e-36   Brassica rapa
ref|XP_010933860.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    141   8e-36   Elaeis guineensis
ref|XP_003623820.1|  E3 ubiquitin-protein ligase                        140   1e-35   Medicago truncatula
ref|XP_010455583.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    140   2e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001150553.1|  LOC100284185                                       140   2e-35   
ref|XP_003552356.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    140   3e-35   Glycine max [soybeans]
ref|XP_006287901.1|  hypothetical protein CARUB_v10001135mg             140   4e-35   Capsella rubella
emb|CDY27362.1|  BnaC04g50430D                                          143   6e-35   Brassica napus [oilseed rape]
ref|XP_010553509.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    138   1e-34   
ref|XP_010553508.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    138   1e-34   
ref|XP_010553507.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    138   1e-34   
ref|XP_010553504.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    138   1e-34   
ref|XP_010553505.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    138   1e-34   
ref|XP_009615318.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    137   1e-34   
ref|XP_009615319.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    137   2e-34   
ref|XP_008646047.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    132   4e-34   
ref|XP_006857849.1|  hypothetical protein AMTR_s00069p00064990          137   4e-34   
tpg|DAA60524.1|  TPA: putative RING zinc finger domain superfamil...    129   4e-34   
gb|ABR18161.1|  unknown                                                 136   6e-34   
gb|ABR17177.1|  unknown                                                 136   6e-34   
ref|XP_010676528.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    133   6e-33   
ref|XP_002874711.1|  hypothetical protein ARALYDRAFT_327304             132   2e-32   
ref|XP_008360211.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    127   2e-32   
ref|XP_008386321.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    127   3e-32   
emb|CAB39939.1|  putative protein                                       131   7e-32   
ref|XP_002962655.1|  hypothetical protein SELMODRAFT_78385              124   1e-29   
ref|XP_002980437.1|  hypothetical protein SELMODRAFT_112292             124   2e-29   
ref|XP_004306831.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    124   2e-29   
ref|XP_007139958.1|  hypothetical protein PHAVU_008G073000g             122   1e-28   
ref|XP_002452761.1|  hypothetical protein SORBIDRAFT_04g032025          112   1e-27   
ref|XP_006364123.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    112   3e-25   
ref|XP_010695901.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    111   4e-25   
ref|XP_006583716.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    111   4e-25   
gb|KFK30652.1|  hypothetical protein AALP_AA6G009800                    111   5e-25   
ref|XP_001784296.1|  predicted protein                                  110   5e-25   
ref|XP_004252582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    110   6e-25   
ref|XP_003518612.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    110   1e-24   
gb|KEH40623.1|  zinc finger (C3HC4-type RING finger) family protein     110   2e-24   
ref|XP_001754436.1|  predicted protein                                  109   2e-24   
ref|XP_006391188.1|  hypothetical protein EUTSA_v10018815mg             108   3e-24   
ref|XP_006482012.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    108   3e-24   
ref|XP_010251798.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    108   3e-24   
emb|CDY01880.1|  BnaC06g29200D                                          108   4e-24   
ref|XP_009105357.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        107   9e-24   
ref|XP_007153245.1|  hypothetical protein PHAVU_003G019100g             106   9e-24   
emb|CDX96049.1|  BnaA07g26820D                                          107   1e-23   
ref|XP_007153246.1|  hypothetical protein PHAVU_003G019100g             107   1e-23   
ref|XP_010534170.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        107   1e-23   
emb|CDY12686.1|  BnaA02g13540D                                          107   1e-23   
ref|XP_009127596.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    106   2e-23   
ref|XP_004498249.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    106   2e-23   
emb|CDY71708.1|  BnaCnng74070D                                          106   3e-23   
ref|XP_010111279.1|  E3 ubiquitin protein ligase RIE1                   103   5e-23   
ref|XP_002312464.2|  zinc finger family protein                         105   5e-23   
ref|XP_006430473.1|  hypothetical protein CICLE_v10012313mg             105   5e-23   
ref|XP_010107068.1|  E3 ubiquitin protein ligase RIE1                   105   5e-23   
gb|KHG06981.1|  hypothetical protein F383_33104                         108   6e-23   
gb|AAM61051.1|  putative RING zinc finger protein                       105   8e-23   
ref|NP_176974.1|  C3HC4-type RING finger domain-containing protein      105   8e-23   
ref|XP_006302484.1|  hypothetical protein CARUB_v10020579mg             104   9e-23   
ref|XP_010055479.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    102   2e-22   
gb|EPS70600.1|  hypothetical protein M569_04161                         100   2e-22   
ref|XP_004165340.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    102   2e-22   
ref|XP_008778191.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   2e-22   
ref|XP_011021769.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    103   2e-22   
gb|KJB15334.1|  hypothetical protein B456_002G172200                    103   2e-22   
ref|XP_010272924.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    103   2e-22   
emb|CBI32866.3|  unnamed protein product                                102   3e-22   
ref|XP_002314782.2|  hypothetical protein POPTR_0010s11660g             103   3e-22   
ref|XP_004136763.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    103   3e-22   
gb|KHG00424.1|  E3 ubiquitin ligase RIE1 -like protein                  102   3e-22   
ref|XP_010470747.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    103   3e-22   
ref|XP_010319559.1|  PREDICTED: cleavage and polyadenylation spec...    106   5e-22   
gb|KDP38117.1|  hypothetical protein JCGZ_04760                         102   5e-22   
gb|KJB30722.1|  hypothetical protein B456_005G157000                    102   5e-22   
gb|KCW64497.1|  hypothetical protein EUGRSUZ_G02105                     102   5e-22   
ref|XP_007045267.1|  Zinc finger, C3HC4 type (RING finger) family...    102   5e-22   
ref|XP_002526000.1|  cleavage and polyadenylation specificity fac...    105   6e-22   
ref|XP_010651669.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        102   6e-22   
gb|AFK39085.1|  unknown                                               97.1    7e-22   
ref|XP_002887158.1|  hypothetical protein ARALYDRAFT_475916             102   7e-22   
ref|XP_011463168.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        102   7e-22   
ref|XP_008221359.1|  PREDICTED: cleavage and polyadenylation spec...    105   9e-22   
ref|XP_002283980.2|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    102   9e-22   
ref|XP_007223310.1|  hypothetical protein PRUPE_ppa007296mg             102   9e-22   
gb|KHN21610.1|  E3 ubiquitin protein ligase RIE1                        101   9e-22   
ref|XP_003525228.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    101   1e-21   
ref|XP_002970900.1|  hypothetical protein SELMODRAFT_66382              101   1e-21   
ref|XP_002969635.1|  hypothetical protein SELMODRAFT_66385              101   1e-21   
ref|XP_011070566.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    101   1e-21   
ref|XP_011070565.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    101   1e-21   
ref|XP_008389170.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        101   1e-21   
gb|KCW89980.1|  hypothetical protein EUGRSUZ_A02179                     101   1e-21   
ref|XP_010511779.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    101   1e-21   
ref|XP_011024112.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    101   2e-21   
ref|XP_010271358.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    100   2e-21   
ref|XP_007160430.1|  hypothetical protein PHAVU_002G321300g             100   3e-21   
ref|XP_008443208.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    100   4e-21   
gb|KDO60760.1|  hypothetical protein CISIN_1g018193mg                   100   4e-21   
ref|XP_006448162.1|  hypothetical protein CICLE_v10015731mg             100   5e-21   
ref|XP_010066571.1|  PREDICTED: cleavage and polyadenylation spec...    102   5e-21   
ref|XP_003630948.1|  E3 ubiquitin-protein ligase                      99.8    5e-21   
ref|XP_003521096.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  99.0    9e-21   
ref|XP_008467019.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      99.0    1e-20   
ref|XP_006355061.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...    101   2e-20   
emb|CDP16293.1|  unnamed protein product                              97.4    2e-20   
gb|KHN34569.1|  E3 ubiquitin protein ligase RIE1                      96.3    2e-20   
ref|XP_009765931.1|  PREDICTED: cleavage and polyadenylation spec...    101   2e-20   
gb|KHN16532.1|  E3 ubiquitin protein ligase RIE1                      97.4    2e-20   
ref|XP_004498315.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  97.4    3e-20   
ref|XP_006584880.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  97.4    3e-20   
ref|XP_007162014.1|  hypothetical protein PHAVU_001G116400g           97.4    3e-20   
gb|EMT20031.1|  hypothetical protein F775_33295                       92.0    3e-20   
ref|XP_006469322.1|  PREDICTED: cleavage and polyadenylation spec...    100   4e-20   
ref|XP_004150618.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  97.1    4e-20   
ref|XP_003553376.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  97.1    4e-20   
gb|AES81093.2|  RING-finger ubiquitin ligase                          94.7    5e-20   
gb|EYU35678.1|  hypothetical protein MIMGU_mgv1a018208mg              96.7    6e-20   
ref|XP_008381749.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      96.3    1e-19   
ref|XP_006339241.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  94.0    1e-19   
gb|KJB41242.1|  hypothetical protein B456_007G096300                  95.5    1e-19   
ref|XP_009608303.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  95.5    1e-19   
gb|KJB60892.1|  hypothetical protein B456_009G330000                  95.5    2e-19   
ref|XP_009351549.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  95.5    2e-19   
ref|XP_009399941.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.7    3e-19   
ref|XP_003624869.1|  E3 ubiquitin-protein ligase                      94.4    3e-19   
ref|XP_008789277.1|  PREDICTED: E3 ubiquitin protein ligase RIE1 ...  94.4    4e-19   
ref|XP_008789278.1|  PREDICTED: E3 ubiquitin protein ligase RIE1 ...  94.4    4e-19   
gb|KHG10998.1|  E3 ubiquitin ligase RIE1 -like protein                94.4    4e-19   
ref|XP_003624875.1|  RING finger protein                              94.7    5e-19   
ref|XP_008465569.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  89.7    9e-19   
ref|XP_002452592.1|  hypothetical protein SORBIDRAFT_04g028660        93.2    9e-19   
ref|XP_010932732.1|  PREDICTED: uncharacterized protein LOC105053331  95.9    1e-18   
ref|XP_011070049.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  92.8    1e-18   
ref|XP_003570691.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  92.4    2e-18   
dbj|BAG92967.1|  unnamed protein product                              88.6    2e-18   
ref|NP_001048049.1|  Os02g0735900                                     89.0    3e-18   
dbj|BAD15897.1|  RING zinc finger protein-like                        89.4    3e-18   
ref|XP_004493307.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  91.3    3e-18   
gb|AFW73301.1|  putative RING zinc finger domain superfamily protein  86.7    4e-18   
ref|XP_004953845.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  91.3    4e-18   
ref|XP_004249338.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  91.3    4e-18   
gb|KJB68139.1|  hypothetical protein B456_010G227900                  92.0    4e-18   
ref|XP_010312169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  90.9    5e-18   
ref|XP_009408396.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      90.9    6e-18   
gb|EEC73955.1|  hypothetical protein OsI_08846                        89.7    1e-17   
dbj|BAK01779.1|  predicted protein                                    90.1    1e-17   
ref|XP_006649025.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  90.5    2e-17   
emb|CAN61404.1|  hypothetical protein VITISV_014258                   89.7    2e-17   
ref|XP_004144310.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  89.4    2e-17   
gb|KHG22085.1|  hypothetical protein F383_26605                       90.1    2e-17   
ref|XP_009773933.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  89.0    2e-17   
ref|XP_009773932.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  89.0    2e-17   
ref|XP_010907310.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  87.4    2e-17   
ref|XP_009101309.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      89.0    3e-17   
ref|XP_010527797.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      89.0    3e-17   
ref|XP_008679100.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  89.0    3e-17   
emb|CBI36189.3|  unnamed protein product                              89.4    3e-17   
emb|CDY17638.1|  BnaA06g34570D                                        88.6    4e-17   
ref|XP_003624876.1|  RING finger protein                              88.2    4e-17   
dbj|BAJ07983.1|  RING finger family protein                           89.7    4e-17   
gb|AES81094.2|  C3HC4-type RING zinc finger protein                   87.8    4e-17   
ref|XP_002961593.1|  hypothetical protein SELMODRAFT_76977            89.0    5e-17   
ref|XP_002971210.1|  hypothetical protein SELMODRAFT_171829           88.6    5e-17   
ref|NP_001149757.1|  LOC100283384                                     88.2    5e-17   
ref|XP_004503351.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  87.8    6e-17   
gb|KCW44815.1|  hypothetical protein EUGRSUZ_L01620                   89.0    6e-17   
ref|XP_010654710.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  89.0    7e-17   
gb|KCW84811.1|  hypothetical protein EUGRSUZ_B01618                   88.6    7e-17   
emb|CDP14337.1|  unnamed protein product                              87.8    7e-17   
ref|XP_009606719.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  87.8    8e-17   
ref|XP_010691252.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  88.6    8e-17   
ref|XP_006291380.1|  hypothetical protein CARUB_v10017517mg           87.4    9e-17   
ref|XP_008813538.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  85.9    9e-17   
ref|XP_010040893.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  88.6    1e-16   
ref|XP_010039941.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  88.6    1e-16   
ref|XP_009408952.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.8    1e-16   
ref|XP_006832971.1|  hypothetical protein AMTR_s00095p00171280        84.0    1e-16   
ref|XP_009408951.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  88.2    1e-16   
ref|XP_010688136.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.8    1e-16   
ref|XP_010673203.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  86.3    2e-16   
ref|XP_009760536.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.4    2e-16   
gb|KCW44260.1|  hypothetical protein EUGRSUZ_L02308                   87.0    2e-16   
ref|XP_010062440.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  86.7    2e-16   
emb|CDY36255.1|  BnaC07g21090D                                        86.3    2e-16   
ref|XP_010518550.1|  PREDICTED: cleavage and polyadenylation spec...  89.0    3e-16   
ref|XP_011026527.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.0    3e-16   
dbj|BAD19217.1|  RING zinc finger protein-like                        84.3    3e-16   
gb|KJB70539.1|  hypothetical protein B456_011G078300                  87.0    3e-16   
gb|KFK33397.1|  hypothetical protein AALP_AA5G007500                  85.9    3e-16   
emb|CBI26830.3|  unnamed protein product                              85.5    3e-16   
ref|XP_010062439.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  86.7    4e-16   
ref|XP_003522643.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  86.3    4e-16   
ref|XP_002309588.2|  zinc finger family protein                       86.7    4e-16   
ref|XP_010249880.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  86.7    4e-16   
ref|XP_011019728.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  86.3    5e-16   
gb|KHN44137.1|  E3 ubiquitin-protein ligase                           86.3    5e-16   
ref|XP_003543658.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  86.3    5e-16   
emb|CBI28122.3|  unnamed protein product                              85.9    6e-16   
ref|XP_001765270.1|  predicted protein                                84.7    6e-16   
emb|CDM81802.1|  unnamed protein product                              87.8    6e-16   
ref|NP_001169753.1|  uncharacterized LOC100383634                     85.5    7e-16   
ref|XP_003546278.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  85.9    7e-16   
ref|XP_002281595.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  85.9    7e-16   
gb|KHF98391.1|  hypothetical protein F383_13476                       85.9    7e-16   
gb|KHG16467.1|  hypothetical protein F383_05962                       85.5    7e-16   
ref|XP_001765272.1|  predicted protein                                84.3    7e-16   
ref|NP_001048342.1|  Os02g0787500                                     84.7    8e-16   
ref|XP_007024038.1|  RING/U-box superfamily protein                   85.5    8e-16   
ref|XP_006643827.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  85.5    8e-16   
ref|XP_010656378.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  85.1    8e-16   
gb|KCW59672.1|  hypothetical protein EUGRSUZ_H02426                   84.7    9e-16   
ref|XP_010502156.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      84.7    9e-16   
ref|XP_010025224.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  81.6    9e-16   
ref|XP_008809197.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  85.5    1e-15   
ref|XP_006596122.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  85.5    1e-15   
gb|KHN25509.1|  E3 ubiquitin-protein ligase                           85.5    1e-15   
ref|XP_002324833.1|  zinc finger family protein                       85.5    1e-15   
ref|XP_003545507.2|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  85.5    1e-15   
ref|XP_010925106.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  85.5    1e-15   
gb|EAY87799.1|  hypothetical protein OsI_09219                        85.1    1e-15   
ref|XP_010925109.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  85.5    1e-15   
gb|KJB83263.1|  hypothetical protein B456_013G238400                  85.5    1e-15   
ref|XP_009595010.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  84.7    1e-15   
ref|XP_008337111.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  83.6    1e-15   
ref|XP_006395857.1|  hypothetical protein EUTSA_v10004486mg           84.0    2e-15   
gb|EYU29255.1|  hypothetical protein MIMGU_mgv1a007086mg              84.7    2e-15   
gb|KDP32286.1|  hypothetical protein JCGZ_13211                       84.7    2e-15   
gb|KJB83264.1|  hypothetical protein B456_013G238400                  85.1    2e-15   
gb|KHM98780.1|  E3 ubiquitin-protein ligase                           84.7    2e-15   
ref|XP_010913106.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  84.3    2e-15   



>ref|XP_009617349.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
tomentosiformis]
Length=389

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+ER PKYKFRRLG+FEK++GEIQESFGGVM ECDTD+P EHVLPPEDAECCICLC+Y
Sbjct  281  KEDVERLPKYKFRRLGNFEKESGEIQESFGGVMVECDTDTPTEHVLPPEDAECCICLCSY  340

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG ELRELPCRH FH ACIDKWLYINATCPLCKFNIVKN NQS SE+ 
Sbjct  341  EDGAELRELPCRHHFHAACIDKWLYINATCPLCKFNIVKNGNQSGSEEA  389



>ref|XP_009778598.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=383

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+ER PKYKFR+LGDFEKQNGEIQESFGGVMTECDTD+PIEHVLP EDAECCICLC Y
Sbjct  275  KEDVERLPKYKFRKLGDFEKQNGEIQESFGGVMTECDTDTPIEHVLPLEDAECCICLCPY  334

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
            +DG ELRELPCRH FH ACIDKWL+INATCPLCKFNI+KN NQS+ ED
Sbjct  335  EDGTELRELPCRHHFHSACIDKWLFINATCPLCKFNILKNGNQSSGED  382



>ref|XP_009762973.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=389

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+ER  KYKFRRLG+FEK+NGEIQESFGGVM ECDTD+P EHVLPPEDAECCIC+C+Y
Sbjct  281  KEDVERLTKYKFRRLGNFEKENGEIQESFGGVMVECDTDTPTEHVLPPEDAECCICICSY  340

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG ELRELPCRH FH ACIDKWLYINATCPLCKFNI+KN NQS SE+ 
Sbjct  341  EDGAELRELPCRHHFHAACIDKWLYINATCPLCKFNILKNGNQSGSEEA  389



>ref|XP_009626445.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nicotiana 
tomentosiformis]
Length=383

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+ER PKYKFR+LGDFEKQNGEIQESFGGVMTECDTD+PIEHVL  EDAECCICLC Y
Sbjct  275  KEDVERLPKYKFRKLGDFEKQNGEIQESFGGVMTECDTDTPIEHVLTLEDAECCICLCPY  334

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
            +DG ELRELPCRH FH ACIDKWL+INATCPLCKFNI+KN NQS+ ED
Sbjct  335  EDGTELRELPCRHHFHSACIDKWLFINATCPLCKFNILKNGNQSSGED  382



>ref|XP_006339453.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=383

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+ER  KYKFRRLG+FEKQNGEIQESFGGVMTECDTD+PIEHVLP EDAECCICLC Y
Sbjct  275  KEDVERLTKYKFRRLGEFEKQNGEIQESFGGVMTECDTDTPIEHVLPLEDAECCICLCPY  334

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
            +DG+ELRELPCRH FH  CIDKWLY+NATCPLCKFNI+KN NQS+SE+
Sbjct  335  EDGIELRELPCRHHFHSVCIDKWLYMNATCPLCKFNILKNGNQSSSEE  382



>ref|XP_011091747.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
Length=329

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI+R P+YKFR++GDFEKQNGEIQESFGG+MTECDTDSP EHVLP EDAECCICLCAY
Sbjct  221  KEDIDRLPRYKFRKIGDFEKQNGEIQESFGGIMTECDTDSPTEHVLPLEDAECCICLCAY  280

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FH ACIDKWL+INATCPLCKFNI+KN NQS SE+ 
Sbjct  281  DDGTELRELPCLHHFHSACIDKWLHINATCPLCKFNILKNGNQSGSEEA  329



>ref|XP_004240042.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
lycopersicum]
Length=396

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+ER PKYKF+RLG+FEK+NG+IQESFGGVM ECDTD+P EHVLPPEDAECCICLC+Y
Sbjct  288  KEDVERLPKYKFKRLGNFEKENGDIQESFGGVMVECDTDTPTEHVLPPEDAECCICLCSY  347

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG+ELRELPCRH FH ACIDKWLYINATCPLCKFNI+K  NQS SE+ 
Sbjct  348  EDGIELRELPCRHHFHAACIDKWLYINATCPLCKFNILKYGNQSGSEEA  396



>ref|XP_004229832.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Solanum lycopersicum]
Length=383

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+ER  KYKFRRLG FEKQNGEIQESFGGVMTECDTD+PIEHVLP EDAECCICLC Y
Sbjct  275  KEDVERLTKYKFRRLGKFEKQNGEIQESFGGVMTECDTDTPIEHVLPLEDAECCICLCPY  334

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
            +DG+ELRELPCRH FH  CIDKWLY+NATCPLCKFNI+KN NQS+SE+
Sbjct  335  EDGIELRELPCRHHFHSVCIDKWLYMNATCPLCKFNILKNGNQSSSEE  382



>ref|XP_006345510.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=396

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+ER PKYKF+RLG+FEK+NG+IQESFGGVM ECDTD+P EHVLPPEDAECCICLC+Y
Sbjct  288  KEDVERLPKYKFKRLGNFEKENGDIQESFGGVMVECDTDTPTEHVLPPEDAECCICLCSY  347

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG+ELRELPC H FH ACIDKWLYINATCPLCKFNI+K  NQS SE+ 
Sbjct  348  EDGIELRELPCHHHFHAACIDKWLYINATCPLCKFNILKYGNQSGSEEA  396



>gb|EYU32071.1| hypothetical protein MIMGU_mgv1a008136mg [Erythranthe guttata]
Length=383

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI+R P+YKFR++GDFEKQ+GEIQESFGG++TECDTDSP EHVLP EDAECCICLCAY
Sbjct  275  KEDIDRLPRYKFRKIGDFEKQSGEIQESFGGIITECDTDSPTEHVLPLEDAECCICLCAY  334

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG ELRELPCRH FH  CIDKWL+INATCPLCKFNI+KN NQ++SE+V
Sbjct  335  EDGAELRELPCRHHFHLPCIDKWLHINATCPLCKFNILKNGNQNDSEEV  383



>gb|EYU35067.1| hypothetical protein MIMGU_mgv1a008119mg [Erythranthe guttata]
Length=384

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE  P+YKF+++GDFEKQNGEIQ SF GVMTECDTDSP EH+LP EDAECCICLCAY
Sbjct  276  KEDIESLPRYKFQKIGDFEKQNGEIQGSFRGVMTECDTDSPTEHILPIEDAECCICLCAY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FH ACIDKWLYINATCPLCK NI+KN NQS SE+V
Sbjct  336  DDGTELRELPCSHHFHSACIDKWLYINATCPLCKLNILKNGNQSGSEEV  384



>emb|CDP08874.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PKYKFRR GD EKQNGEIQESFGG+MTECDT +P+EHVLP EDAECCICLC Y
Sbjct  286  KEDIEQLPKYKFRRFGDSEKQNGEIQESFGGIMTECDTSTPVEHVLPLEDAECCICLCTY  345

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPCRH FH ACI+KWLYINATCPLCK NI+KN N S  E+ 
Sbjct  346  DDGTELRELPCRHHFHSACIEKWLYINATCPLCKLNILKNGNLSGGEEA  394



>emb|CAN65431.1| hypothetical protein VITISV_017099 [Vitis vinifera]
Length=342

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+IER PKYKFRR+G+ EK NGEIQESFGG+MTECDTD+P+EHV+P EDAECCICL AY
Sbjct  234  KEEIERLPKYKFRRIGESEKLNGEIQESFGGIMTECDTDTPMEHVIPQEDAECCICLSAY  293

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +D  ELRELPCRHRFHC CIDKWLYINATCPLCK NI+KN +QS  E
Sbjct  294  EDETELRELPCRHRFHCTCIDKWLYINATCPLCKLNILKNASQSGCE  340



>ref|XP_011093163.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Sesamum 
indicum]
Length=376

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI+R P+ KFR++ DFEK NGE Q SFGG++TECDTDSP EHVLPPEDAECCICLCAY
Sbjct  268  KEDIQRLPRLKFRKISDFEKHNGESQGSFGGILTECDTDSPTEHVLPPEDAECCICLCAY  327

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FH ACIDKWL INA CPLCKFNI+KN NQS  E+V
Sbjct  328  DDGAELRELPCSHHFHSACIDKWLVINAICPLCKFNILKNGNQSRREEV  376



>emb|CBI38762.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+IER PKYKFRR+G+ EK NGEIQESFGG+MTECDTD+P+EHV+P EDAECCICL AY
Sbjct  221  KEEIERLPKYKFRRIGESEKLNGEIQESFGGIMTECDTDTPMEHVIPQEDAECCICLSAY  280

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +D  ELRELPCRHRFHC CIDKWLYINATCPLCK NI+KN +QS  E
Sbjct  281  EDETELRELPCRHRFHCTCIDKWLYINATCPLCKLNILKNASQSGCE  327



>ref|XP_002271651.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Vitis vinifera]
Length=382

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+IER PKYKFRR+G+ EK NGEIQESFGG+MTECDTD+P+EHV+P EDAECCICL AY
Sbjct  274  KEEIERLPKYKFRRIGESEKLNGEIQESFGGIMTECDTDTPMEHVIPQEDAECCICLSAY  333

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +D  ELRELPCRHRFHC CIDKWLYINATCPLCK NI+KN +QS  E
Sbjct  334  EDETELRELPCRHRFHCTCIDKWLYINATCPLCKLNILKNASQSGCE  380



>ref|XP_007211433.1| hypothetical protein PRUPE_ppa007140mg [Prunus persica]
 gb|EMJ12632.1| hypothetical protein PRUPE_ppa007140mg [Prunus persica]
Length=380

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+  PKYKFR + DFEK NGEIQESFGG+MTECDT++P EHVL  EDAECCICLCAY
Sbjct  272  KEEIDHLPKYKFRTISDFEKVNGEIQESFGGIMTECDTNTPTEHVLSQEDAECCICLCAY  331

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL INATCPLCKFNI+K+ +QS SE+V
Sbjct  332  DDGTELRELPCHHHFHCTCIDKWLQINATCPLCKFNILKSVSQSGSEEV  380



>ref|XP_008225188.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Prunus 
mume]
Length=380

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+  PKYKFR + DFEK NGEIQESFGG+MTECDT++P EHVL  EDAECCICLCAY
Sbjct  272  KEEIDHLPKYKFRTISDFEKVNGEIQESFGGIMTECDTNTPTEHVLSQEDAECCICLCAY  331

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL INATCPLCKFNI+K+ +QS SE+V
Sbjct  332  DDGTELRELPCHHHFHCTCIDKWLQINATCPLCKFNILKSVSQSGSEEV  380



>gb|EPS63490.1| hypothetical protein M569_11294, partial [Genlisea aurea]
Length=347

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIER PKY FRR+GDFEKQNGEIQESFGG+MTE D++SP E VLP EDAECCICLC Y
Sbjct  239  KEDIERLPKYIFRRIGDFEKQNGEIQESFGGIMTETDSESPSERVLPLEDAECCICLCTY  298

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPCRH FH  C+DKWL+INATCPLCK NI+K+ +QS S++V
Sbjct  299  DDGNELRELPCRHHFHSICVDKWLHINATCPLCKLNILKSGSQSGSDEV  347



>ref|XP_004295567.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Fragaria 
vesca subsp. vesca]
Length=418

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+  PKYKFR++ DFEK NGEIQES GG+MTECDTD+P EH L  EDAECCICLCAY
Sbjct  310  KEEIDHLPKYKFRKISDFEKVNGEIQESSGGIMTECDTDAPTEHALSQEDAECCICLCAY  369

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPCRH FHC CIDKWL INATCPLCKFNI+K+  QS+S++V
Sbjct  370  DDGTELRELPCRHHFHCTCIDKWLQINATCPLCKFNILKSAGQSSSDEV  418



>ref|XP_010255490.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Nelumbo nucifera]
Length=382

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++ PKYKFRR+ DFEK +GEIQ  FGG+MTECDT++PIEHVL  EDAECCICL  Y
Sbjct  275  KEDIDQLPKYKFRRISDFEKISGEIQGPFGGIMTECDTETPIEHVLSLEDAECCICLSTY  334

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDG ELRELPC H FHCACIDKWLYINATCPLCK+NI+K+ +Q   E
Sbjct  335  DDGAELRELPCGHHFHCACIDKWLYINATCPLCKYNIIKSGSQGREE  381



>ref|XP_010255491.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Nelumbo nucifera]
Length=381

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++ PKYKFRR+ DFEK +GEIQ  FGG+MTECDT++PIEHVL  EDAECCICL  Y
Sbjct  274  KEDIDQLPKYKFRRISDFEKISGEIQGPFGGIMTECDTETPIEHVLSLEDAECCICLSTY  333

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDG ELRELPC H FHCACIDKWLYINATCPLCK+NI+K+ +Q   E
Sbjct  334  DDGAELRELPCGHHFHCACIDKWLYINATCPLCKYNIIKSGSQGREE  380



>ref|XP_010255487.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
Length=445

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++ PKYKFRR+ DFEK +GEIQ  FGG+MTECDT++PIEHVL  EDAECCICL  Y
Sbjct  338  KEDIDQLPKYKFRRISDFEKISGEIQGPFGGIMTECDTETPIEHVLSLEDAECCICLSTY  397

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDG ELRELPC H FHCACIDKWLYINATCPLCK+NI+K+ +Q   E
Sbjct  398  DDGAELRELPCGHHFHCACIDKWLYINATCPLCKYNIIKSGSQGREE  444



>ref|XP_010255488.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Nelumbo nucifera]
Length=444

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++ PKYKFRR+ DFEK +GEIQ  FGG+MTECDT++PIEHVL  EDAECCICL  Y
Sbjct  337  KEDIDQLPKYKFRRISDFEKISGEIQGPFGGIMTECDTETPIEHVLSLEDAECCICLSTY  396

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDG ELRELPC H FHCACIDKWLYINATCPLCK+NI+K+ +Q   E
Sbjct  397  DDGAELRELPCGHHFHCACIDKWLYINATCPLCKYNIIKSGSQGREE  443



>ref|XP_007051906.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX96063.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=389

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+   +E+I+R PKYKFRR+GDFEK NGEIQES  G+MTEC+TD+P E +L  EDAECCI
Sbjct  277  REGATEEEIDRWPKYKFRRVGDFEKVNGEIQESREGIMTECNTDTPAERILSHEDAECCI  336

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            CLCAY+DG ELRELPC H FHC CIDKWLYINATCPLCKFNI+K  N S SE
Sbjct  337  CLCAYEDGSELRELPCHHHFHCTCIDKWLYINATCPLCKFNILKTCNLSGSE  388



>ref|XP_009352819.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Pyrus 
x bretschneideri]
Length=381

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+R PKYKFR++ DF+K NGEIQESFGGVMTECDT +P E+VL PEDAECCICLCAY
Sbjct  273  KEEIDRLPKYKFRKIPDFDKVNGEIQESFGGVMTECDTTTPTENVLSPEDAECCICLCAY  332

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            +DG+ELRELPC H FHC CIDKWL INATCPLCKFNI+K
Sbjct  333  EDGIELRELPCCHHFHCTCIDKWLQINATCPLCKFNILK  371



>ref|XP_009346865.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Pyrus 
x bretschneideri]
Length=380

 Score =   173 bits (438),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+  PKYKF ++ DF+K NGEIQES GGVMTECDT +P EHVL  EDAECCICLCAY
Sbjct  272  KEEIDHLPKYKFHKIPDFDKVNGEIQESSGGVMTECDTATPTEHVLSAEDAECCICLCAY  331

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG ELRELPC H FHC CIDKWL INATCPLCKFNI+K+ +QS  E+V
Sbjct  332  EDGTELRELPCCHHFHCTCIDKWLQINATCPLCKFNILKSVSQSGGEEV  380



>ref|XP_008358659.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=381

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+R PKYKFR++ DF+K +GEIQESFGGVMTECDT +P EHVL PEDAECCICLCAY
Sbjct  273  KEEIDRLPKYKFRKIPDFDKVSGEIQESFGGVMTECDTTTPTEHVLSPEDAECCICLCAY  332

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            +DG ELRELPC H FHC CIDKWL INATCPLCK+NI+K
Sbjct  333  EDGTELRELPCCHHFHCTCIDKWLQINATCPLCKYNILK  371



>ref|XP_006491024.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Citrus 
sinensis]
Length=365

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+   +E+I+R PK+KF R+   EK NGEIQE FGG+M ECDTD P+EHV+  +DAECCI
Sbjct  252  REGATEEEIDRLPKFKFSRIDGLEKVNGEIQEPFGGIMIECDTDMPMEHVISEDDAECCI  311

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AYDDG ELRELPC H FHC+C+DKWLYIN+TCPLCKFNI+K  N+  SE+V
Sbjct  312  CLSAYDDGTELRELPCLHHFHCSCLDKWLYINSTCPLCKFNILKMSNERGSEEV  365



>gb|KDO86036.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=372

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+   +E+I+R PK+KF R+   EK NGEIQE FGG+M ECDTD P+EHV+  +DAECCI
Sbjct  259  REGATEEEIDRLPKFKFSRIDGLEKVNGEIQEPFGGIMIECDTDMPMEHVISEDDAECCI  318

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AYDDG ELRELPC H FHC+C+DKWLYIN+TCPLCKFNI+K  N+  SE+V
Sbjct  319  CLSAYDDGTELRELPCLHHFHCSCLDKWLYINSTCPLCKFNILKMSNERGSEEV  372



>ref|XP_006445135.1| hypothetical protein CICLE_v10020664mg [Citrus clementina]
 gb|ESR58375.1| hypothetical protein CICLE_v10020664mg [Citrus clementina]
Length=372

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+   +E+I+R PK+KF R+   EK NGEIQE FGG+M ECDTD P+EHV+  +DAECCI
Sbjct  259  REGATEEEIDRLPKFKFSRIDGLEKVNGEIQEPFGGIMIECDTDMPMEHVISEDDAECCI  318

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AYDDG ELRELPC H FHC+C+DKWLYIN+TCPLCKFNI+K  N+  SE+V
Sbjct  319  CLSAYDDGTELRELPCLHHFHCSCLDKWLYINSTCPLCKFNILKMSNERGSEEV  372



>ref|XP_010101531.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXB88543.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=235

 Score =   167 bits (422),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI+R PK+KFR++ +FEK NGEIQESFGGVM +C+TD PIE VL  EDAECCICL AY
Sbjct  67   KEDIDRLPKFKFRKISNFEKVNGEIQESFGGVMIDCNTDPPIERVLSREDAECCICLSAY  126

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            DDG ELRELPC H FHC+CIDKWL+INA CPLCKFNI+K
Sbjct  127  DDGTELRELPCHHHFHCSCIDKWLHINAICPLCKFNILK  165



>ref|XP_008345901.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=380

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+  PKYKF ++ DF+K NGEI ES GGVMTE DT +P EHVL  EDAECCICLCAY
Sbjct  272  KEEIDHLPKYKFHKIPDFDKVNGEILESSGGVMTESDTTTPTEHVLSAEDAECCICLCAY  331

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG ELRELPC H FHC CIDKWL INATCPLCKFNI+K+ +QS SE+V
Sbjct  332  EDGTELRELPCCHHFHCTCIDKWLQINATCPLCKFNILKSVSQSGSEEV  380



>ref|XP_010278588.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Nelumbo 
nucifera]
Length=388

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTEC--DTDSPIEHVLPPEDAECCICLC  526
            KEDI++ PKYKF+R+G+FEK  GEIQ  FGG+MT+C  DT++PIEHVL  EDAECCICL 
Sbjct  279  KEDIDQLPKYKFQRIGNFEKITGEIQGPFGGIMTKCVSDTETPIEHVLSLEDAECCICLS  338

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
             YDDG ELR+LPC H FHC+CIDKWLYINATCPLCK+NI+++ NQ   E
Sbjct  339  TYDDGAELRKLPCSHHFHCSCIDKWLYINATCPLCKYNIIRSGNQGREE  387



>ref|XP_010278590.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X3 [Nelumbo 
nucifera]
Length=387

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTEC--DTDSPIEHVLPPEDAECCICLC  526
            KEDI++ PKYKF+R+G+FEK  GEIQ  FGG+MT+C  DT++PIEHVL  EDAECCICL 
Sbjct  278  KEDIDQLPKYKFQRIGNFEKITGEIQGPFGGIMTKCVSDTETPIEHVLSLEDAECCICLS  337

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
             YDDG ELR+LPC H FHC+CIDKWLYINATCPLCK+NI+++ NQ   E
Sbjct  338  TYDDGAELRKLPCSHHFHCSCIDKWLYINATCPLCKYNIIRSGNQGREE  386



>ref|XP_010278589.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Nelumbo 
nucifera]
Length=387

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTEC--DTDSPIEHVLPPEDAECCICLC  526
            KEDI++ PKYKF+R+G+FEK  GEIQ  FGG+MT+C  DT++PIEHVL  EDAECCICL 
Sbjct  278  KEDIDQLPKYKFQRIGNFEKITGEIQGPFGGIMTKCVSDTETPIEHVLSLEDAECCICLS  337

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
             YDDG ELR+LPC H FHC+CIDKWLYINATCPLCK+NI+++ NQ   E
Sbjct  338  TYDDGAELRKLPCSHHFHCSCIDKWLYINATCPLCKYNIIRSGNQGREE  386



>ref|XP_010278591.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X4 [Nelumbo 
nucifera]
Length=386

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTEC--DTDSPIEHVLPPEDAECCICLC  526
            KEDI++ PKYKF+R+G+FEK  GEIQ  FGG+MT+C  DT++PIEHVL  EDAECCICL 
Sbjct  277  KEDIDQLPKYKFQRIGNFEKITGEIQGPFGGIMTKCVSDTETPIEHVLSLEDAECCICLS  336

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
             YDDG ELR+LPC H FHC+CIDKWLYINATCPLCK+NI+++ NQ   E
Sbjct  337  TYDDGAELRKLPCSHHFHCSCIDKWLYINATCPLCKYNIIRSGNQGREE  385



>ref|XP_008799543.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Phoenix dactylifera]
Length=378

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI + PKYKFR++GD EK  GEI  SFGG+M EC  D PIEH L  EDAECCICL AY
Sbjct  271  EEDIRQLPKYKFRKIGDSEKLVGEISGSFGGIMMECGNDPPIEHALSGEDAECCICLSAY  330

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHCACIDKWL+INATCPLCKFNI+K+ NQ   E
Sbjct  331  DDGVELRQLPCGHHFHCACIDKWLFINATCPLCKFNIIKSRNQGREE  377



>ref|XP_008799545.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Phoenix dactylifera]
Length=377

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI + PKYKFR++GD EK  GEI  SFGG+M EC  D PIEH L  EDAECCICL AY
Sbjct  270  EEDIRQLPKYKFRKIGDSEKLVGEISGSFGGIMMECGNDPPIEHALSGEDAECCICLSAY  329

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHCACIDKWL+INATCPLCKFNI+K+ NQ   E
Sbjct  330  DDGVELRQLPCGHHFHCACIDKWLFINATCPLCKFNIIKSRNQGREE  376



>gb|KDP28678.1| hypothetical protein JCGZ_14449 [Jatropha curcas]
Length=329

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+   KE+I+R PKYKF R GD EK NGEIQ SFGG+MT  + D+P  H+L  EDAECCI
Sbjct  216  REGATKEEIDRLPKYKFHRTGDIEKVNGEIQASFGGMMTGYEPDTPTVHLLSHEDAECCI  275

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AY+DG ELRELPC H FHC CIDKWL INATCPLCK+NI+K  NQS  E+V
Sbjct  276  CLSAYEDGTELRELPCHHHFHCTCIDKWLCINATCPLCKYNILKAGNQSGGEEV  329



>emb|CBI34726.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            ++   KEDI++  ++KFR++GD EK +G+IQ + GG+MTEC TD+P EHVL  EDAECCI
Sbjct  157  QEGASKEDIDQLSRFKFRKVGDIEKIDGDIQGACGGIMTECGTDAPTEHVLSQEDAECCI  216

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            CL AYDDGVELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ +    E
Sbjct  217  CLSAYDDGVELRELPCGHHFHCTCVDKWLYINATCPLCKYNILKSSSNGREE  268



>ref|XP_004511598.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=393

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KF+R+   +KQ G IQ   GG+MTEC  DSPIEHVL  EDAECCICLC+Y
Sbjct  286  KEDIEQLSKFKFQRVESNDKQTGNIQGPVGGIMTECRADSPIEHVLAEEDAECCICLCSY  345

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  346  DDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSNLGQEE  392



>ref|XP_008438087.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Cucumis 
melo]
Length=385

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+IER PKYKF R GD EK NG+IQES GG+MT CDT++P E  L PED+ECCICL AY
Sbjct  278  KEEIERLPKYKFNRTGDVEKVNGDIQESSGGIMTNCDTEAPTERFLRPEDSECCICLSAY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            ++G ELRELPC H FHC CIDKWL++NATCPLCKFNI+K  N S+SE+V
Sbjct  338  ENGAELRELPCNHHFHCNCIDKWLHMNATCPLCKFNILK-PNSSSSEEV  385



>ref|XP_010661149.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Vitis vinifera]
Length=384

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            ++   KEDI++  ++KFR++GD EK +G+IQ + GG+MTEC TD+P EHVL  EDAECCI
Sbjct  272  QEGASKEDIDQLSRFKFRKVGDIEKIDGDIQGACGGIMTECGTDAPTEHVLSQEDAECCI  331

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            CL AYDDGVELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ +    E
Sbjct  332  CLSAYDDGVELRELPCGHHFHCTCVDKWLYINATCPLCKYNILKSSSNGREE  383



>ref|XP_003631422.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Vitis vinifera]
Length=383

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            ++   KEDI++  ++KFR++GD EK +G+IQ + GG+MTEC TD+P EHVL  EDAECCI
Sbjct  271  QEGASKEDIDQLSRFKFRKVGDIEKIDGDIQGACGGIMTECGTDAPTEHVLSQEDAECCI  330

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            CL AYDDGVELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ +    E
Sbjct  331  CLSAYDDGVELRELPCGHHFHCTCVDKWLYINATCPLCKYNILKSSSNGREE  382



>gb|KHN35002.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=302

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            ++   KEDIE+  K+KFRR+   EK  G IQ   GG+MTEC  DSPIEH L  EDAECCI
Sbjct  190  QEGASKEDIEQLSKFKFRRIESNEKLTGTIQGPVGGIMTECQADSPIEHALAEEDAECCI  249

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            CL +YDDGVELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N S  E
Sbjct  250  CLSSYDDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSSNLSQEE  301



>ref|XP_007158469.1| hypothetical protein PHAVU_002G155000g [Phaseolus vulgaris]
 gb|ESW30463.1| hypothetical protein PHAVU_002G155000g [Phaseolus vulgaris]
Length=390

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFRR+   EK  G IQ   GGVMTEC  +SPIEHVL  EDAECCICL +Y
Sbjct  283  KEDIEQLSKFKFRRIESNEKHTGTIQGPVGGVMTECQAESPIEHVLAEEDAECCICLSSY  342

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N S  E
Sbjct  343  DDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSSNISQEE  389



>ref|XP_008800795.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Phoenix 
dactylifera]
Length=384

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            EDI + PKYKFRR+GD EK +G+I    GG+MTEC  D PIEHVL  ED ECCICL +Y+
Sbjct  278  EDIRQLPKYKFRRIGDPEKPSGDISRPSGGIMTECGHDPPIEHVLSAEDVECCICLSSYE  337

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DGVELRELPC H FHCACIDKWLYINATCPLCKFNI+K+ N    E
Sbjct  338  DGVELRELPCSHHFHCACIDKWLYINATCPLCKFNIIKSSNHGREE  383



>ref|XP_006590532.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Glycine max]
Length=388

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFRR+   EK  G IQ   GG+MTEC  DSPIEH L  EDAECCICL +Y
Sbjct  281  KEDIEQLSKFKFRRIESNEKLTGTIQGPVGGIMTECQADSPIEHALAEEDAECCICLSSY  340

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N S  E
Sbjct  341  DDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSSNLSQEE  387



>ref|XP_003538385.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Glycine max]
Length=387

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFRR+   EK  G IQ   GG+MTEC  DSPIEH L  EDAECCICL +Y
Sbjct  280  KEDIEQLSKFKFRRIESNEKLTGTIQGPVGGIMTECQADSPIEHALAEEDAECCICLSSY  339

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N S  E
Sbjct  340  DDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSSNLSQEE  386



>ref|XP_010533709.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Tarenaya hassleriana]
Length=401

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+   KEDIE   K+KFRR+GD +K  GE+Q + GGV+TEC TDSPIEH L  EDAECCI
Sbjct  290  REGATKEDIEELSKFKFRRVGDSDK--GEVQGNIGGVLTECGTDSPIEHTLLQEDAECCI  347

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AY+DG ELRELPC H FHCAC+DKWL+IN+TCPLCKFNI+K+ N   +E V
Sbjct  348  CLSAYEDGDELRELPCGHHFHCACVDKWLFINSTCPLCKFNILKSSNDDRAEQV  401



>ref|XP_003517458.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=385

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFRR+   EK  G IQ   GG+MTEC  DSPIEHVL  EDAECCICL +Y
Sbjct  278  KEDIEQLSKFKFRRIESNEKLTGTIQGPVGGIMTECQADSPIEHVLAEEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHC C+DKWLYINATCPLCK+NI+K++  S  E
Sbjct  338  DDGVELRELPCGHHFHCVCVDKWLYINATCPLCKYNILKSNTLSQEE  384



>gb|KDO63537.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=325

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  216  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  275

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  276  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  325



>gb|KDO63536.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=324

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  215  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  274

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  275  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  324



>gb|KDO63535.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=323

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  214  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  273

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  274  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  323



>ref|XP_002301335.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE80608.1| zinc finger family protein [Populus trichocarpa]
Length=378

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+R  KYKF R+G+ EK N E QESFGG+MTECDTD+PIE  L  ED ECCICL AY
Sbjct  270  KEEIDRLLKYKFHRIGNCEKVNDESQESFGGMMTECDTDTPIERALSREDTECCICLSAY  329

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG ELRELPC H FHC CIDKWL INATCPLCKF+I+K D+QS SE+ 
Sbjct  330  EDGSELRELPCGHHFHCMCIDKWLCINATCPLCKFDILKADSQSGSEEA  378



>ref|XP_006440563.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53803.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=382

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  273  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  332

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  333  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  382



>ref|XP_006477420.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Citrus sinensis]
Length=382

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  273  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  332

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  333  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  382



>ref|XP_004133878.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 ref|XP_004155812.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 gb|KGN56546.1| hypothetical protein Csa_3G123190 [Cucumis sativus]
Length=385

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+IER PKY F R GD EK NG+IQES GG+M+ CDTD+P E  L PED+ECCICL AY
Sbjct  278  KEEIERLPKYTFNRTGDVEKVNGDIQESSGGIMSNCDTDAPTERFLRPEDSECCICLSAY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            ++G ELRELPC H FHC CIDKWL++NATCPLCKFNI+K  N S+SE+V
Sbjct  338  ENGAELRELPCNHHFHCNCIDKWLHMNATCPLCKFNILK-PNSSSSEEV  385



>ref|XP_006440560.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53800.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=380

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  271  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  330

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  331  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  380



>ref|XP_006440561.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53801.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=381

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  272  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  331

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  332  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  381



>ref|XP_006477421.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Citrus sinensis]
Length=381

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  272  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  331

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  332  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  381



>ref|XP_006477422.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Citrus sinensis]
Length=380

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  271  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  330

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  331  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  380



>ref|XP_006477419.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Citrus sinensis]
Length=386

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  277  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  336

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  337  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  386



>ref|XP_006477418.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Citrus sinensis]
Length=387

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  278  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  337

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  338  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  387



>ref|XP_006440562.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53802.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=386

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDIER  K+KFRR+ D EK + + Q S GG+MTEC T++P EHVL  EDAECCICL A
Sbjct  277  SKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSA  336

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            YDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ +  + E+V
Sbjct  337  YDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV  386



>ref|XP_011023403.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Populus euphratica]
Length=378

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+R  KYKF R+G+ EK N E QESFGG+MTECD D+PIE  L  ED ECCICL AY
Sbjct  270  KEEIDRLLKYKFHRIGNCEKVNDESQESFGGIMTECDADTPIERALSREDTECCICLSAY  329

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
            +DG ELRELPC H FHC CIDKWL INATCPLCKF+I+K D+QS SE+
Sbjct  330  EDGSELRELPCGHHFHCMCIDKWLCINATCPLCKFDILKADSQSGSEE  377



>ref|XP_010053666.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
 gb|KCW78019.1| hypothetical protein EUGRSUZ_D02250 [Eucalyptus grandis]
Length=401

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +E+I + P+YKFR +GD++K N E Q S GG+M ECD  + IE  L  EDAECCICL AY
Sbjct  292  QEEINQLPRYKFRSVGDYDKTNEETQPSSGGIMMECDGGTSIERALSQEDAECCICLSAY  351

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +DG ELRELPCRH FHC CIDKWLYINA CPLCKFNI+K+ NQS SE++
Sbjct  352  EDGSELRELPCRHHFHCGCIDKWLYINAICPLCKFNILKSQNQSGSEEI  400



>ref|XP_010671755.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Beta vulgaris 
subsp. vulgaris]
Length=404

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI+R PKYKFR LG  +K++G+IQESFGG+MT+C TD PIEH L  EDAEC ICL +Y
Sbjct  298  REDIDRLPKYKFRSLGQTDKKSGDIQESFGGIMTQCGTDPPIEHTLSAEDAECVICLSSY  357

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DG +LRELPC+H FHCACIDKWL++NATCPLCK+NI+K    
Sbjct  358  EDGSDLRELPCQHNFHCACIDKWLHLNATCPLCKYNILKGSQS  400



>gb|KJB39631.1| hypothetical protein B456_007G022500 [Gossypium raimondii]
Length=381

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDI++ PKYKFR++G+ +K  G++Q S GGVMTEC TDSP+E  L  +DAECCICL +
Sbjct  275  SKEDIDQLPKYKFRKIGNDDKVAGDVQGSIGGVMTECGTDSPMERALSEDDAECCICLSS  334

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            YDDGVELRELPC H FHCAC+DKWL+INATCPLCK+NI+K+   
Sbjct  335  YDDGVELRELPCGHHFHCACVDKWLHINATCPLCKYNILKSSTH  378



>gb|KHN34425.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=215

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            ++   KEDIE+  K+KF+R    EK  G  Q + GG+M ECD DSPIEHVL  EDAECCI
Sbjct  103  QEGASKEDIEQLSKFKFQRTETNEKHAGNTQGAAGGIMIECDADSPIEHVLSDEDAECCI  162

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            CL AYDDGVELR+LPC H FHCAC+DKWL+INATCPLCK+NI+K+ + +  E
Sbjct  163  CLSAYDDGVELRQLPCGHHFHCACVDKWLHINATCPLCKYNILKSTSHAQDE  214



>ref|XP_008383660.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=381

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I+R PKYKFR++ DF+K +GEIQESFGGVMTECDT +P EHVL PEDAECCICLCAY
Sbjct  273  KEEIDRLPKYKFRKIPDFDKVSGEIQESFGGVMTECDTTTPTEHVLSPEDAECCICLCAY  332

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
             DG +L ELPC H FH  CIDKWL INATCPLCK NI+K
Sbjct  333  KDGTKLCELPCCHHFHGTCIDKWLQINATCPLCKXNILK  371



>ref|XP_010934468.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=383

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            EDI + PKYKFRR+GD EK  G+I    GG+MTEC +D PIE+VL  ED ECCICL +Y+
Sbjct  277  EDIRQLPKYKFRRIGDPEKIGGDISRPSGGIMTECGSDPPIENVLSAEDVECCICLSSYE  336

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DGVELRELPC H FHC CIDKWLYINATCPLCKFNI+K+ N    E
Sbjct  337  DGVELRELPCSHHFHCTCIDKWLYINATCPLCKFNIIKSSNHGREE  382



>ref|XP_010934467.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=384

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            EDI + PKYKFRR+GD EK  G+I    GG+MTEC +D PIE+VL  ED ECCICL +Y+
Sbjct  278  EDIRQLPKYKFRRIGDPEKIGGDISRPSGGIMTECGSDPPIENVLSAEDVECCICLSSYE  337

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DGVELRELPC H FHC CIDKWLYINATCPLCKFNI+K+ N    E
Sbjct  338  DGVELRELPCSHHFHCTCIDKWLYINATCPLCKFNIIKSSNHGREE  383



>ref|XP_010919263.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI + PKYKF ++G+ EK  GEI  SFGG+M EC ++ P+EH L  EDAECCICL AY
Sbjct  270  EEDIRQLPKYKFCKIGESEKLAGEISGSFGGIMMECGSNPPMEHALSGEDAECCICLSAY  329

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHCACIDKWL+INATCPLCKFNI+K+ N    E
Sbjct  330  DDGVELRQLPCGHHFHCACIDKWLFINATCPLCKFNIIKSSNHGREE  376



>ref|XP_010919264.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Elaeis 
guineensis]
Length=378

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI + PKYKF ++G+ EK  GEI  SFGG+M EC ++ P+EH L  EDAECCICL AY
Sbjct  271  EEDIRQLPKYKFCKIGESEKLAGEISGSFGGIMMECGSNPPMEHALSGEDAECCICLSAY  330

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHCACIDKWL+INATCPLCKFNI+K+ N    E
Sbjct  331  DDGVELRQLPCGHHFHCACIDKWLFINATCPLCKFNIIKSSNHGREE  377



>gb|KDP25486.1| hypothetical protein JCGZ_20642 [Jatropha curcas]
Length=389

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 2/107 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K+KFRR+GD EK   + Q   GG+MTEC TDSP+EHVL  EDAECCICL AY
Sbjct  284  KEDIDQLSKFKFRRIGDSEKLADDAQG--GGIMTECSTDSPVEHVLSEEDAECCICLSAY  341

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ ++   E
Sbjct  342  DDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSRDREE  388



>ref|XP_002509740.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF51127.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=383

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEK--QNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLC  526
            KEDIE+  K+KFRR+ + EK   NG+ Q   GGVMTEC TDSP+EH+L  EDAECCICL 
Sbjct  274  KEDIEQLSKFKFRRVDNDEKLTGNGDEQGPLGGVMTECGTDSPVEHILSEEDAECCICLS  333

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            AYDDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ ++   E
Sbjct  334  AYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSRDREE  382



>gb|KHG00577.1| hypothetical protein F383_17805 [Gossypium arboreum]
 gb|KHG12148.1| hypothetical protein F383_00012 [Gossypium arboreum]
Length=382

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I++  K+KF+++GD EK  G++Q   GG+M EC TDSP+E VL  +DAECCICL AY
Sbjct  277  KEEIDQLSKFKFQKIGDNEKPAGDVQGPVGGIMIECGTDSPMEQVLSQDDAECCICLSAY  336

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DGVELRELPCRH FHCAC+DKWLYINATCPLCK+NI+K+ +Q
Sbjct  337  EDGVELRELPCRHHFHCACVDKWLYINATCPLCKYNILKSSSQ  379



>gb|EMT12642.1| E3 ubiquitin-protein ligase [Aegilops tauschii]
Length=244

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFRR+ + EKQ+    ES GG+M EC T+ PIE VL  EDAECCICL  Y
Sbjct  136  EDDIRQIPKYKFRRMEEPEKQSVTTTESSGGIMIECGTNQPIEKVLAAEDAECCICLSVY  195

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHCACIDKWL+INATCPLCK N+ KN + S SE+V
Sbjct  196  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKLNVRKNSSSSGSEEV  244



>ref|XP_002511805.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF50474.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=375

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+   +E+IE+ P YKFRR+GDFEK N + Q +FGG+MTEC+ D+P E  L  EDAECCI
Sbjct  262  REGATQEEIEQLPMYKFRRIGDFEKVNADFQATFGGMMTECEIDTPTERRLSHEDAECCI  321

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AY+DG ELR+LPC+H FH  CIDKWLYINATCPLCK NI+K  N     +V
Sbjct  322  CLSAYEDGTELRQLPCQHHFHSTCIDKWLYINATCPLCKLNILKASNHIAGGEV  375



>ref|XP_008448958.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis 
melo]
Length=383

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+E+  K+KFR++ + EK + ++QE  GG+M+EC TDSPIE  L  EDAECCICL AY
Sbjct  276  KEDVEQLSKFKFRKVENAEKFSSDVQEPLGGIMSECCTDSPIERPLLQEDAECCICLSAY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +DGVELRELPC H FHCAC+DKWLYINATCPLCKFNI+KN N +  E
Sbjct  336  EDGVELRELPCGHHFHCACVDKWLYINATCPLCKFNILKNSNLAQEE  382



>gb|KHG14407.1| hypothetical protein F383_04260 [Gossypium arboreum]
Length=381

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
             KEDI++ PKYKFR++ + +K  G++Q S GGVMTEC TDSP+E VL  +DAECCICL  
Sbjct  275  SKEDIDQLPKYKFRKIVNDDKVAGDVQGSVGGVMTECGTDSPMERVLSEDDAECCICLSG  334

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            YDDGVELRELPC H FHCAC+DKWL+INATCPLCK+NI+K+   
Sbjct  335  YDDGVELRELPCGHHFHCACVDKWLHINATCPLCKYNILKSSTH  378



>ref|XP_008438088.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Cucumis 
melo]
Length=384

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+IER PKYKF R GD EK NG+IQES GG+MT CDT++P E  L PED+ CCICL AY
Sbjct  278  KEEIERLPKYKFNRTGDVEKVNGDIQESSGGIMTNCDTEAPTERFLRPEDS-CCICLSAY  336

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            ++G ELRELPC H FHC CIDKWL++NATCPLCKFNI+K  N S+SE+V
Sbjct  337  ENGAELRELPCNHHFHCNCIDKWLHMNATCPLCKFNILK-PNSSSSEEV  384



>ref|XP_003611137.1| E3 ubiquitin-protein ligase [Medicago truncatula]
 gb|AES94095.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
 gb|AFK41451.1| unknown [Medicago truncatula]
Length=387

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++   EKQ    Q   GG+MTEC  DSPIEHVL  EDAECCICL +Y
Sbjct  280  KEDIEQLSKFKFRKVESNEKQTDNNQGPVGGIMTECRADSPIEHVLAEEDAECCICLSSY  339

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  340  DDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSNLGQEE  386



>gb|KHG06982.1| hypothetical protein F383_33104 [Gossypium arboreum]
Length=381

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K+KF+++G  +K   ++QE  GG+MTEC TDSP+E VLP +DAECCICL AY
Sbjct  276  KEDIDQLLKFKFKKIGSDKKSAADVQEPVGGIMTECGTDSPLERVLPMDDAECCICLSAY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            D+GVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ N 
Sbjct  336  DEGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSQNH  378



>gb|EEE57561.1| hypothetical protein OsJ_07906 [Oryza sativa Japonica Group]
Length=231

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR+ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  123  EDDIRQIPRYKFRRMDEPEKQSVNMTGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY  182

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCKFN+ KN + S SE+V
Sbjct  183  DDGAELRELPCGHHFHCVCIDKWLHINATCPLCKFNVRKNSSSSGSEEV  231



>ref|XP_002320752.2| hypothetical protein POPTR_0014s07100g, partial [Populus trichocarpa]
 gb|EEE99067.2| hypothetical protein POPTR_0014s07100g, partial [Populus trichocarpa]
Length=106

 Score =   150 bits (378),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -1

Query  690  IERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDG  511
            I+R  K+KF + GD+EK NGEIQESFGG+MTECDTD+PIE   P EDAECCICL AY+DG
Sbjct  1    IDRLLKFKFHKTGDYEKVNGEIQESFGGMMTECDTDTPIERAFPLEDAECCICLSAYEDG  60

Query  510  VELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
             ELRELPC H FH  CIDKWL INAT PLCK NI+KN+
Sbjct  61   SELRELPCNHHFHRMCIDKWLCINATYPLCKLNIIKNE  98



>ref|XP_009393489.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            EDI + PKYKFRR+ + EK     Q   GG M ECDTDSPIEHVL  E+ ECCICL AYD
Sbjct  278  EDIHQLPKYKFRRISNSEKLGAGAQRPVGGSMIECDTDSPIEHVLSAENVECCICLSAYD  337

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DGVELRELPC+H FH AC+DKWL+INATCPLCK+NI K  NQ   E
Sbjct  338  DGVELRELPCKHHFHRACVDKWLFINATCPLCKYNIAKITNQGGEE  383



>ref|XP_006391774.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
 gb|ESQ29060.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
Length=389

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 3/112 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQN---GEIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD EKQ+    + Q   GGVMTEC TDSP+EH LP EDAECCICL
Sbjct  278  KEDIDQLTKFKFRKVGDSEKQSFDEEQAQGDSGGVMTECGTDSPVEHTLPHEDAECCICL  337

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N  + E+V
Sbjct  338  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEDGEEV  389



>ref|XP_006391773.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
 gb|ESQ29059.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
Length=388

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 3/112 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQN---GEIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD EKQ+    + Q   GGVMTEC TDSP+EH LP EDAECCICL
Sbjct  277  KEDIDQLTKFKFRKVGDSEKQSFDEEQAQGDSGGVMTECGTDSPVEHTLPHEDAECCICL  336

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N  + E+V
Sbjct  337  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEDGEEV  388



>gb|KJB25759.1| hypothetical protein B456_004G208600 [Gossypium raimondii]
 gb|KJB25760.1| hypothetical protein B456_004G208600 [Gossypium raimondii]
Length=381

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K+KF+++G  +K   ++QE  GG+MTEC TDSP+E VLP +DAECCICL AY
Sbjct  276  KEDIDQLSKFKFKKIGSDKKSAADVQEPVGGIMTECGTDSPLERVLPMDDAECCICLSAY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            ++GVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ N 
Sbjct  336  EEGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSQNH  378



>ref|XP_004147971.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis 
sativus]
 gb|KGN55952.1| hypothetical protein Csa_3G038740 [Cucumis sativus]
Length=383

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+E+  K+KFR++ + EK + ++QE  GGVM+EC TDSPIE  L  EDAECCICL AY
Sbjct  276  KEDVEQLSKFKFRKVENTEKFSTDVQEPLGGVMSECCTDSPIERPLLQEDAECCICLSAY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +DGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+KN N +  E
Sbjct  336  EDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKNSNLAQEE  382



>ref|XP_003550874.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=379

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KF+R    EK  G  Q + GG+M ECD DSPIEHVL  EDAECCICL AY
Sbjct  272  KEDIEQLSKFKFQRTETNEKHAGNTQGAAGGIMIECDADSPIEHVLSDEDAECCICLSAY  331

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHCAC+DKWL+INATCPLCK+NI+K+ +    E
Sbjct  332  DDGVELRKLPCSHHFHCACVDKWLHINATCPLCKYNILKSTSHGQDE  378



>ref|XP_009345443.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Pyrus 
x bretschneideri]
Length=386

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PK+KF ++G+ EK  G+ Q   GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  282  KEDIEQLPKFKFGKVGN-EKVAGDGQG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  338

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  339  DDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  385



>gb|KCW77597.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=329

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDT-DSPIEHVLPPEDAECCICLCA  523
            KEDIE+ PK+KFR++GD EK   +++   GG+MTEC T +SP  H L  +DAECCICL A
Sbjct  221  KEDIEQLPKFKFRKIGDSEKHISDVEGPLGGMMTECGTKESPTGHYLSQDDAECCICLSA  280

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            YDDGV+LRELPCRH FHC C+DKWLYINATCPLCK+NI+K+ N  + E
Sbjct  281  YDDGVDLRELPCRHHFHCTCVDKWLYINATCPLCKYNILKSTNNGSEE  328



>gb|KCW77596.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=328

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDT-DSPIEHVLPPEDAECCICLCA  523
            KEDIE+ PK+KFR++GD EK   +++   GG+MTEC T +SP  H L  +DAECCICL A
Sbjct  220  KEDIEQLPKFKFRKIGDSEKHISDVEGPLGGMMTECGTKESPTGHYLSQDDAECCICLSA  279

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            YDDGV+LRELPCRH FHC C+DKWLYINATCPLCK+NI+K+ N  + E
Sbjct  280  YDDGVDLRELPCRHHFHCTCVDKWLYINATCPLCKYNILKSTNNGSEE  327



>ref|XP_009345444.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Pyrus 
x bretschneideri]
Length=385

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PK+KF ++G+ EK  G+ Q   GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  281  KEDIEQLPKFKFGKVGN-EKVAGDGQG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  338  DDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  384



>ref|XP_009345445.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X3 [Pyrus 
x bretschneideri]
Length=385

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PK+KF ++G+ EK  G+ Q   GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  281  KEDIEQLPKFKFGKVGN-EKVAGDGQG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  338  DDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  384



>ref|XP_007155554.1| hypothetical protein PHAVU_003G211600g [Phaseolus vulgaris]
 gb|ESW27548.1| hypothetical protein PHAVU_003G211600g [Phaseolus vulgaris]
Length=378

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KF+R    EK  G  Q + GG+M ECDTDSPIEHVL  EDAECCICL AY
Sbjct  271  KEDIEQLSKFKFQRTETNEKLAGNTQGAAGGIMMECDTDSPIEHVLSDEDAECCICLSAY  330

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+C+DKWL+INATCPLCK+NI+K+ +    E
Sbjct  331  DDGVELRQLPCGHHFHCSCVDKWLHINATCPLCKYNILKSTSHGQDE  377



>gb|KJB20719.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=389

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I++  K+KF++ GD EK  G++Q   GG+M EC TDSP+E VL  +DAECCICL AY
Sbjct  284  KEEIDQLSKFKFQKNGDNEKPAGDVQGPVGGIMIECGTDSPMEQVLSQDDAECCICLSAY  343

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DGVELRELPCRH FHCAC+DKWLYINATCPLCK+NI+K+ +Q
Sbjct  344  EDGVELRELPCRHHFHCACVDKWLYINATCPLCKYNILKSSSQ  386



>ref|XP_009345446.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X4 [Pyrus 
x bretschneideri]
Length=384

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PK+KF ++G+ EK  G+ Q   GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  280  KEDIEQLPKFKFGKVGN-EKVAGDGQG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  336

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  337  DDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  383



>dbj|BAJ98696.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFRR+ + EKQ+  + ES GG+M EC T+ PIE VL  EDAECCICL  Y
Sbjct  265  EDDIRQIPKYKFRRVDEPEKQSVTMIESSGGIMIECGTNQPIEKVLAAEDAECCICLSVY  324

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHCACIDKWL+INATCPLCK N+ KN + S SE+V
Sbjct  325  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKLNVRKNSSSSGSEEV  373



>gb|KJB20720.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=381

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I++  K+KF++ GD EK  G++Q   GG+M EC TDSP+E VL  +DAECCICL AY
Sbjct  276  KEEIDQLSKFKFQKNGDNEKPAGDVQGPVGGIMIECGTDSPMEQVLSQDDAECCICLSAY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DGVELRELPCRH FHCAC+DKWLYINATCPLCK+NI+K+ +Q
Sbjct  336  EDGVELRELPCRHHFHCACVDKWLYINATCPLCKYNILKSSSQ  378



>ref|NP_001031032.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 dbj|BAH20087.1| AT1G12760 [Arabidopsis thaliana]
 gb|AEE28925.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=337

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQ-NGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR+LGD  K  N E Q +  G+MTEC TDSPIEH L  EDAECCICL A
Sbjct  229  KEDIEQLTKFKFRKLGDANKHTNDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSA  288

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  289  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  336



>ref|XP_010053324.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
 gb|KCW77595.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=406

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDT-DSPIEHVLPPEDAECCICLCA  523
            KEDIE+ PK+KFR++GD EK   +++   GG+MTEC T +SP  H L  +DAECCICL A
Sbjct  298  KEDIEQLPKFKFRKIGDSEKHISDVEGPLGGMMTECGTKESPTGHYLSQDDAECCICLSA  357

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            YDDGV+LRELPCRH FHC C+DKWLYINATCPLCK+NI+K+ N  + E
Sbjct  358  YDDGVDLRELPCRHHFHCTCVDKWLYINATCPLCKYNILKSTNNGSEE  405



>gb|AFW63358.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=205

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFR++ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  97   EDDIRQIPKYKFRKMEEPEKQSVGVPGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY  156

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCK+N+ KN + S SE+V
Sbjct  157  DDGAELRELPCGHHFHCVCIDKWLHINATCPLCKYNVRKNSSSSGSEEV  205



>ref|XP_011033783.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Populus euphratica]
Length=395

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K+KFRR GD +K  G+ Q  FGG+MTE  TDSP+EHVL  EDAECCICL AY
Sbjct  288  KEDIDQLAKFKFRRDGDIDKLTGDDQGCFGGIMTEYGTDSPMEHVLSGEDAECCICLSAY  347

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +DG ELR+LPC H FHC C+DKWLYINATCPLCK+NI+K+ +Q   E
Sbjct  348  EDGAELRQLPCGHHFHCTCVDKWLYINATCPLCKYNILKSTSQDREE  394



>ref|XP_011033785.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Populus euphratica]
Length=394

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K+KFRR GD +K  G+ Q  FGG+MTE  TDSP+EHVL  EDAECCICL AY
Sbjct  287  KEDIDQLAKFKFRRDGDIDKLTGDDQGCFGGIMTEYGTDSPMEHVLSGEDAECCICLSAY  346

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +DG ELR+LPC H FHC C+DKWLYINATCPLCK+NI+K+ +Q   E
Sbjct  347  EDGAELRQLPCGHHFHCTCVDKWLYINATCPLCKYNILKSTSQDREE  393



>ref|XP_011033784.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Populus euphratica]
Length=395

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K+KFRR GD +K  G+ Q  FGG+MTE  TDSP+EHVL  EDAECCICL AY
Sbjct  288  KEDIDQLAKFKFRRDGDIDKLTGDDQGCFGGIMTEYGTDSPMEHVLSGEDAECCICLSAY  347

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +DG ELR+LPC H FHC C+DKWLYINATCPLCK+NI+K+ +Q   E
Sbjct  348  EDGAELRQLPCGHHFHCTCVDKWLYINATCPLCKYNILKSTSQDREE  394



>ref|XP_006417201.1| hypothetical protein EUTSA_v10007780mg [Eutrema salsugineum]
 gb|ESQ35554.1| hypothetical protein EUTSA_v10007780mg [Eutrema salsugineum]
Length=408

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q S  G+MTEC TDSP+EH L  EDAECCICL A
Sbjct  300  KEDIEQLTKFKFRKVGDVNKHAGDEAQVSTEGIMTECGTDSPVEHTLLQEDAECCICLSA  359

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  360  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  407



>ref|NP_172736.2| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 sp|Q9LN71.1|RING1_ARATH RecName: Full=E3 ubiquitin-protein ligase At1g12760; AltName: 
Full=RING finger protein At1g12760 [Arabidopsis thaliana]
 gb|AAF88088.1|AC025417_16 T12C24.29 [Arabidopsis thaliana]
 gb|AAM97036.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15598.1| unknown protein [Arabidopsis thaliana]
 gb|AAY63561.1| RING domain protein [Arabidopsis thaliana]
 gb|AEE28924.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=408

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQ-NGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR+LGD  K  N E Q +  G+MTEC TDSPIEH L  EDAECCICL A
Sbjct  300  KEDIEQLTKFKFRKLGDANKHTNDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSA  359

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  360  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  407



>ref|XP_003525718.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=380

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KF+R    EK  G  Q + GG+M ECD DSPIEHVL  EDAECCICL AY
Sbjct  273  KEDIEQLSKFKFQRTETNEKLAGNTQGAAGGIMIECDADSPIEHVLSDEDAECCICLSAY  332

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHCAC+DKWL+INATCPLCK+NI+K+ + +  E
Sbjct  333  DDGVELRQLPCGHHFHCACVDKWLHINATCPLCKYNILKSTSHAQDE  379



>ref|NP_001047717.2| Os02g0674700 [Oryza sativa Japonica Group]
 dbj|BAF09631.2| Os02g0674700 [Oryza sativa Japonica Group]
Length=379

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR+ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  271  EDDIRQIPRYKFRRMDEPEKQSVNMTGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY  330

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCKFN+ KN + S SE+V
Sbjct  331  DDGAELRELPCGHHFHCVCIDKWLHINATCPLCKFNVRKNSSSSGSEEV  379



>ref|XP_003570086.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
Length=374

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR+ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  266  EDDIRQIPRYKFRRINEPEKQSVSMTGSSGGMMIECGTNQPIEKVLAAEDAECCICLSAY  325

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHCACIDKWL+INATCPLCK N+ KN + S SE+V
Sbjct  326  DDGAELRELPCAHHFHCACIDKWLHINATCPLCKLNVRKNSSSSGSEEV  374



>ref|XP_002889965.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66224.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=335

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  +  G E Q +  G+MTEC TDSPIEH L  EDAECCICL A
Sbjct  227  KEDIEQLTKFKFRKVGDANRHTGDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSA  286

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  287  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  334



>ref|XP_009369023.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Pyrus x bretschneideri]
Length=386

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ + EK  G++    GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  282  KEDIEQLSKFKFRKVAN-EKVAGDVLG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  338

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  339  DDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  385



>emb|CDY16029.1| BnaC08g40940D [Brassica napus]
Length=380

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q +  G+MTEC TDSP+EH L  EDAECCICL A
Sbjct  272  KEDIEQLTKFKFRKVGDVNKHAGDEAQGNADGIMTECGTDSPVEHTLLQEDAECCICLSA  331

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N  + E
Sbjct  332  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDHEE  379



>ref|XP_009369024.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Pyrus x bretschneideri]
Length=385

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ + EK  G++    GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  281  KEDIEQLSKFKFRKVAN-EKVAGDVLG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  338  DDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  384



>ref|XP_009369025.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Pyrus x bretschneideri]
Length=385

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ + EK  G++    GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  281  KEDIEQLSKFKFRKVAN-EKVAGDVLG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  338  DDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  384



>ref|XP_009369026.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Pyrus x bretschneideri]
Length=384

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ + EK  G++    GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  280  KEDIEQLSKFKFRKVAN-EKVAGDVLG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  336

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  337  DDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  383



>ref|XP_010494577.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=399

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q +  G+MTEC TDSPIEH L  EDAECCICL A
Sbjct  291  KEDIEQLTKFKFRKVGDANKHTGDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSA  350

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  351  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  398



>ref|XP_010476241.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=405

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q +  G+MTEC TDSPIEH L  EDAECCICL A
Sbjct  297  KEDIEQLTKFKFRKVGDANKHTGDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSA  356

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  357  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  404



>dbj|BAD29468.1| ring zinc finger protein-like [Oryza sativa Japonica Group]
Length=399

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR+ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  291  EDDIRQIPRYKFRRMDEPEKQSVNMTGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY  350

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCKFN+ KN + S SE+V
Sbjct  351  DDGAELRELPCGHHFHCVCIDKWLHINATCPLCKFNVRKNSSSSGSEEV  399



>ref|XP_010458710.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Camelina sativa]
Length=408

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q +  G+MTEC TDSPIEH L  EDAECCICL A
Sbjct  300  KEDIEQLTKFKFRKVGDANKHTGDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSA  359

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  360  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  407



>ref|XP_011463818.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=387

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFRR+ + +   GE Q   GGVMTEC TDSPIEHVL PEDAECCICL +Y
Sbjct  281  KEDIEQLSKFKFRRVSNEKIAAGE-QGPHGGVMTECGTDSPIEHVLSPEDAECCICLSSY  339

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDG ELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +    E
Sbjct  340  DDGAELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSNEQGE  386



>gb|KFK43535.1| hypothetical protein AALP_AA1G139400 [Arabis alpina]
Length=397

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q +  GVMTEC TDSP+EH L  EDAECCICL A
Sbjct  289  KEDIEQLTKFKFRKVGDVNKHAGDEAQGNTEGVMTECGTDSPVEHTLLQEDAECCICLSA  348

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  349  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  396



>ref|XP_011463819.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFRR+ + +   GE Q   GGVMTEC TDSPIEHVL PEDAECCICL +Y
Sbjct  280  KEDIEQLSKFKFRRVSNEKIAAGE-QGPHGGVMTECGTDSPIEHVLSPEDAECCICLSSY  338

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDG ELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +    E
Sbjct  339  DDGAELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSNEQGE  385



>ref|XP_008392388.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Malus domestica]
Length=386

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ + EK  G +    GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  282  KEDIEQLSKFKFRKVAN-EKVAGNVLG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  338

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  339  DDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  385



>ref|XP_008392389.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Malus domestica]
Length=385

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ + EK  G +    GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  281  KEDIEQLSKFKFRKVAN-EKVAGNVLG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  338  DDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  384



>ref|XP_008392390.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Malus domestica]
Length=385

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ + EK  G +    GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  281  KEDIEQLSKFKFRKVAN-EKVAGNVLG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  338  DDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  384



>ref|XP_008238809.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Prunus 
mume]
Length=383

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++G+ EK  G+ Q   GGVMTEC TDSPIEHVL  +DAECCICL +Y
Sbjct  279  KEDIEQLSKFKFRKVGN-EKVAGDTQG--GGVMTECGTDSPIEHVLSQDDAECCICLSSY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWLYINATCPLCK+NI+K+ +    E
Sbjct  336  DDGVELRQLPCGHHFHCSCIDKWLYINATCPLCKYNILKSTSHDQVE  382



>ref|XP_008238810.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Prunus 
mume]
Length=382

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++G+ EK  G+ Q   GGVMTEC TDSPIEHVL  +DAECCICL +Y
Sbjct  278  KEDIEQLSKFKFRKVGN-EKVAGDTQG--GGVMTECGTDSPIEHVLSQDDAECCICLSSY  334

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWLYINATCPLCK+NI+K+ +    E
Sbjct  335  DDGVELRQLPCGHHFHCSCIDKWLYINATCPLCKYNILKSTSHDQVE  381



>ref|XP_008392391.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Malus domestica]
Length=384

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ + EK  G +    GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  280  KEDIEQLSKFKFRKVAN-EKVAGNVLG--GGVMTECGTDSPIEHVLSQEDAECCICLSSY  336

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  337  DDGVELRQLPCSHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  383



>ref|XP_010940871.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=383

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            EDI + PKYKFRR+GD EK  G+I    GG+MTE  +D PIEHVL  EDAECCICL +YD
Sbjct  278  EDICQLPKYKFRRIGDPEKLAGDISRPSGGIMTESGSDQPIEHVLSAEDAECCICLSSYD  337

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN  385
            DGVELRELPC H FHC+CIDKWL I+ATCPLCKFNI K  N   
Sbjct  338  DGVELRELPCSHHFHCSCIDKWLRISATCPLCKFNITKRSNHGT  381



>ref|XP_008232745.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Prunus mume]
Length=365

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            E+I+R PK+KFRR G+FEK NGE Q S  G+MTEC+T +P EHV+  +DAECCICL  YD
Sbjct  259  EEIDRLPKFKFRRTGNFEKLNGEAQAS-EGLMTECNTHAPTEHVISQDDAECCICLSVYD  317

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +G ELR LPC H FHC+CIDKWLYINATCPLCKFNI+K  NQ  +  V
Sbjct  318  NGAELRGLPCHHHFHCSCIDKWLYINATCPLCKFNILKPSNQIGTGVV  365



>dbj|BAK01729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFRR+ + EK + +  ES GG+MTEC T+ PIE  L  EDAECCIC+ AY
Sbjct  269  EDDIRQIPKYKFRRVDEPEKDSADATESSGGIMTECGTNQPIEKALAAEDAECCICISAY  328

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHCACIDKWL+INATCPLCKF+I K  + S SE+V
Sbjct  329  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFSIRKGGSSSGSEEV  377



>ref|XP_007209235.1| hypothetical protein PRUPE_ppa007012mg [Prunus persica]
 gb|EMJ10434.1| hypothetical protein PRUPE_ppa007012mg [Prunus persica]
Length=386

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KED+E+  K+KFR++G+ EK  G+ Q   GGVMTEC TDSPIEHVL  +DAECCICL +Y
Sbjct  282  KEDVEQLSKFKFRKVGN-EKVAGDTQG--GGVMTECGTDSPIEHVLSQDDAECCICLSSY  338

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWLYINATCPLCK+NI+K+ +    E
Sbjct  339  DDGVELRQLPCGHHFHCSCIDKWLYINATCPLCKYNILKSTSHDQVE  385



>ref|XP_010940872.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=382

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            EDI + PKYKFRR+GD EK  G+I    GG+MTE  +D PIEHVL  EDAECCICL +YD
Sbjct  277  EDICQLPKYKFRRIGDPEKLAGDISRPSGGIMTESGSDQPIEHVLSAEDAECCICLSSYD  336

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN  385
            DGVELRELPC H FHC+CIDKWL I+ATCPLCKFNI K  N   
Sbjct  337  DGVELRELPCSHHFHCSCIDKWLRISATCPLCKFNITKRSNHGT  380



>ref|XP_002303571.2| hypothetical protein POPTR_0003s12350g [Populus trichocarpa]
 gb|EEE78550.2| hypothetical protein POPTR_0003s12350g [Populus trichocarpa]
Length=397

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K+KFRR GD +K  G+ Q   GG+MTEC TDSP+EHVL  EDAECCICL AY
Sbjct  290  KEDIDQLAKFKFRRDGDIDKLTGDDQGCSGGIMTECGTDSPMEHVLSGEDAECCICLSAY  349

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +DG ELR+LPC H FHC C+DKWLYINATCPLCK++I+K+ +Q   E
Sbjct  350  EDGAELRQLPCGHHFHCTCVDKWLYINATCPLCKYDILKSTSQDREE  396



>ref|XP_009112972.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Brassica 
rapa]
Length=348

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = -1

Query  726  Q*QIRKEQPKEDIERPPKYKFRRLGDFEKQNGEIQES-----FGGVMTECDTDSPIEHVL  562
            Q ++++   KEDI++  K+KFR++G+ EK   + +E       GGVMTEC TDSP++H L
Sbjct  226  QLKMQEGASKEDIDQLTKFKFRKVGESEKHTVDEEEEQAKGDSGGVMTECGTDSPLQHTL  285

Query  561  PPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS  382
            P EDAECCICL AY D  ELRELPC H FHC+C+DKWLYINATCPLCK+NI+KN N  + 
Sbjct  286  PHEDAECCICLSAYADETELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKNSNYEDG  345

Query  381  EDV  373
            E+V
Sbjct  346  EEV  348



>gb|EMT20198.1| E3 ubiquitin-protein ligase [Aegilops tauschii]
Length=267

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFRR+ + EK + +  ES GG+M EC T+ PIE  L  EDAECCIC+ AY
Sbjct  159  EDDIRQIPKYKFRRMDEPEKDSADATESSGGIMIECGTNQPIEKALAAEDAECCICISAY  218

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHCACIDKWL+INATCPLCKF+I K  + S SE+V
Sbjct  219  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFSIRKGGSSSGSEEV  267



>gb|ACF87715.1| unknown [Zea mays]
 gb|ACF88243.1| unknown [Zea mays]
Length=324

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFR++ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  216  EDDIRQIPKYKFRKMEEPEKQSVGVPGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY  275

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCK+N+ KN + S SE+V
Sbjct  276  DDGAELRELPCGHHFHCVCIDKWLHINATCPLCKYNVRKNSSSSGSEEV  324



>ref|XP_006304987.1| hypothetical protein CARUB_v10009353mg [Capsella rubella]
 gb|EOA37885.1| hypothetical protein CARUB_v10009353mg [Capsella rubella]
Length=397

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGE-IQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G+  Q +  G+MTEC TDSPIEH L  EDAECCICL A
Sbjct  289  KEDIEQLTKFKFRKVGDANKHTGDDAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSA  348

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  349  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  396



>gb|KHG00725.1| hypothetical protein F383_22058 [Gossypium arboreum]
Length=381

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR+  D  K    +QE  GG+MTEC TDSP EHVL P+DAECCICL AY
Sbjct  276  KEDIEQLSKFKFRKTDDDGKSAVNVQEPVGGIMTECGTDSPREHVLSPDDAECCICLSAY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            DDGVELRELPC H FHCAC+DKWL+INA CPLCK+NI+K+ + 
Sbjct  336  DDGVELRELPCGHHFHCACVDKWLHINANCPLCKYNILKSSSH  378



>dbj|BAK00653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFRR+ + EK +    ES GG+MTEC T+ PIE  L  EDAECCIC+ AY
Sbjct  269  EDDIRQIPKYKFRRVDEPEKDSAGATESSGGIMTECGTNQPIEKALAAEDAECCICISAY  328

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHCACIDKWL+INATCPLCKF+I K  + S SE+V
Sbjct  329  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFSIRKGGSSSGSEEV  377



>gb|KJB52052.1| hypothetical protein B456_008G244300 [Gossypium raimondii]
Length=381

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KFR++ +  K    +QE  GG+MTEC TDSP EHVL P+DAECCICL AY
Sbjct  276  KEDIEQLSKFKFRKIDNDGKSAVNVQEPVGGIMTECGTDSPREHVLSPDDAECCICLSAY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            DDGVELRELPC H FHCAC+DKWL INATCPLCK+NI+K+ + 
Sbjct  336  DDGVELRELPCGHHFHCACVDKWLRINATCPLCKYNILKSSSH  378



>ref|NP_001130198.1| uncharacterized LOC100191292 [Zea mays]
 gb|ACF78345.1| unknown [Zea mays]
 gb|ACF85407.1| unknown [Zea mays]
 gb|AFW59269.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=380

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR  + EKQ+ +    FGG+MTEC T+ PIE VL  EDAECCICL AY
Sbjct  272  EDDIRQIPRYKFRRTDEPEKQDVDPMGPFGGIMTECGTNQPIEKVLAAEDAECCICLSAY  331

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCK+NI K+++ S SE+V
Sbjct  332  DDGAELRELPCGHHFHCTCIDKWLHINATCPLCKYNIRKSNSSSGSEEV  380



>ref|XP_009411463.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI +  KYKFR++GD EK + EI   FGG+MTEC +D P+E  L  +DAECCICLC Y
Sbjct  268  EDDISQLSKYKFRKIGDSEKID-EISGPFGGIMTECGSDPPVERTLSADDAECCICLCTY  326

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            +DGVELRELPC H FHC CIDKWL+INATCPLCKFNI+KN+N    E
Sbjct  327  EDGVELRELPCGHHFHCGCIDKWLHINATCPLCKFNIIKNNNHGREE  373



>ref|XP_010540663.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Tarenaya hassleriana]
Length=404

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFG-GVMTECDTDSPIEHVLPPEDAECCICLCA  523
            K+DIE+ PK+ FR +GD EK +G+ Q S   G+MTE  TDSPIEH L  EDAECCICLC 
Sbjct  300  KDDIEQLPKFIFRSIGDDEKSSGDAQRSTARGIMTENGTDSPIEHALSAEDAECCICLCD  359

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN  394
            Y+DGVELRELPC H FHCACIDKWL+IN+ CPLCKFNI+KN N
Sbjct  360  YEDGVELRELPCGHHFHCACIDKWLHINSHCPLCKFNILKNTN  402



>ref|XP_007220471.1| hypothetical protein PRUPE_ppa007521mg [Prunus persica]
 gb|EMJ21670.1| hypothetical protein PRUPE_ppa007521mg [Prunus persica]
Length=365

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +E+I+R PK+KFR+ G+FEK NGE Q S  G+MTEC+T +P EHV+  +DAECCICL  Y
Sbjct  258  EEEIDRLPKFKFRKTGNFEKLNGEAQAS-EGLMTECNTHAPAEHVISQDDAECCICLSVY  316

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            D+G ELR LPC H FHC+CIDKWLYINATCPLCKFNI+K  NQ  +  V
Sbjct  317  DNGAELRGLPCHHHFHCSCIDKWLYINATCPLCKFNILKPSNQIGTGVV  365



>ref|XP_010540671.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X3 [Tarenaya hassleriana]
Length=404

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFG-GVMTECDTDSPIEHVLPPEDAECCICLCA  523
            K+DIE+ PK+ FR +GD EK +G+ Q S   G+MTE  TDSPIEH L  EDAECCICLC 
Sbjct  300  KDDIEQLPKFIFRSIGDDEKSSGDAQRSTARGIMTENGTDSPIEHALSAEDAECCICLCD  359

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN  394
            Y+DGVELRELPC H FHCACIDKWL+IN+ CPLCKFNI+KN N
Sbjct  360  YEDGVELRELPCGHHFHCACIDKWLHINSHCPLCKFNILKNTN  402



>ref|XP_010540654.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Tarenaya hassleriana]
Length=405

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFG-GVMTECDTDSPIEHVLPPEDAECCICLCA  523
            K+DIE+ PK+ FR +GD EK +G+ Q S   G+MTE  TDSPIEH L  EDAECCICLC 
Sbjct  301  KDDIEQLPKFIFRSIGDDEKSSGDAQRSTARGIMTENGTDSPIEHALSAEDAECCICLCD  360

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN  394
            Y+DGVELRELPC H FHCACIDKWL+IN+ CPLCKFNI+KN N
Sbjct  361  YEDGVELRELPCGHHFHCACIDKWLHINSHCPLCKFNILKNTN  403



>ref|XP_010540680.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X4 [Tarenaya hassleriana]
Length=403

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFG-GVMTECDTDSPIEHVLPPEDAECCICLCA  523
            K+DIE+ PK+ FR +GD EK +G+ Q S   G+MTE  TDSPIEH L  EDAECCICLC 
Sbjct  299  KDDIEQLPKFIFRSIGDDEKSSGDAQRSTARGIMTENGTDSPIEHALSAEDAECCICLCD  358

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN  394
            Y+DGVELRELPC H FHCACIDKWL+IN+ CPLCKFNI+KN N
Sbjct  359  YEDGVELRELPCGHHFHCACIDKWLHINSHCPLCKFNILKNTN  401



>ref|NP_001147541.1| protein binding protein [Zea mays]
 gb|ACG27868.1| protein binding protein [Zea mays]
Length=375

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFR++ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  267  EDDIRQIPKYKFRKMEEPEKQSVGVPGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY  326

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCK+N+ KN + S SE+V
Sbjct  327  DDGAELRELPCGHHFHCVCIDKWLHINATCPLCKYNVRKNSSSSGSEEV  375



>ref|XP_009118058.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Brassica 
rapa]
Length=382

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q +  G+M EC TDSP+EH L  EDAECCICL A
Sbjct  274  KEDIEQLTKFKFRKVGDVNKHAGDEAQGNTDGIMIECGTDSPVEHTLLQEDAECCICLSA  333

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  334  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  381



>gb|ACF78887.1| unknown [Zea mays]
 gb|AFW63359.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=375

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + PKYKFR++ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  267  EDDIRQIPKYKFRKMEEPEKQSVGVPGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY  326

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCK+N+ KN + S SE+V
Sbjct  327  DDGAELRELPCGHHFHCVCIDKWLHINATCPLCKYNVRKNSSSSGSEEV  375



>ref|XP_003570089.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
 ref|XP_010235813.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
Length=374

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFR + + EK +  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct  266  EDDIRQIPRYKFRTMDETEKNSVSLTGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY  325

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDGV+LRELPC H FHCACIDKWL+INATCPLCK N+ KN + S SE+V
Sbjct  326  DDGVDLRELPCGHHFHCACIDKWLHINATCPLCKLNVRKNSSSSGSEEV  374



>ref|XP_009112973.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Brassica 
rapa]
Length=344

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQES-----FGGVMTECDTDSPIEHVLPPEDAECCI  535
            KEDI++  K+KFR++G+ EK   + +E       GGVMTEC TDSP++H LP EDAECCI
Sbjct  231  KEDIDQLTKFKFRKVGESEKHTVDEEEEQAKGDSGGVMTECGTDSPLQHTLPHEDAECCI  290

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AY D  ELRELPC H FHC+C+DKWLYINATCPLCK+NI+KN N  + E+V
Sbjct  291  CLSAYADETELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKNSNYEDGEEV  344



>emb|CDY49194.1| BnaA09g10840D [Brassica napus]
Length=344

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQES-----FGGVMTECDTDSPIEHVLPPEDAECCI  535
            KEDI++  K+KFR++G+ EK   + +E       GGVMTEC TDSP++H LP EDAECCI
Sbjct  231  KEDIDQLTKFKFRKVGESEKHTVDEEEEQAKGDSGGVMTECGTDSPLQHTLPHEDAECCI  290

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AY D  ELRELPC H FHC+C+DKWLYINATCPLCK+NI+KN N  + E+V
Sbjct  291  CLSAYADETELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKNSNYEDGEEV  344



>ref|XP_002887973.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64232.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQN-GEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDI++  K+KFR++GD  K    E Q   GG+MTEC TDSP+EH LP EDAECCICL A
Sbjct  264  KEDIDQLTKFKFRKVGDSVKHTVDEEQGDSGGLMTECGTDSPVEHTLPHEDAECCICLSA  323

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N    E+V
Sbjct  324  YEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEEGEEV  373



>ref|XP_009118057.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Brassica 
rapa]
Length=383

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q +  G+M EC TDSP+EH L  EDAECCICL A
Sbjct  275  KEDIEQLTKFKFRKVGDVNKHAGDEAQGNTDGIMIECGTDSPVEHTLLQEDAECCICLSA  334

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  335  YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  382



>gb|AGG16262.1| C3HC4 type RING finger, partial [Oryza sativa Japonica Group]
Length=187

 Score =   147 bits (371),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR  + EKQ  +    FGG+MTEC T+ PIE VL PEDAECCICL AY
Sbjct  79   EDDIRQIPRYKFRRTDEPEKQTADETGPFGGIMTECGTNQPIEKVLAPEDAECCICLSAY  138

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            DDG ELRELPC H FHCACIDKWL+INATCPLCKFNI K
Sbjct  139  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFNIRK  177



>emb|CDY47347.1| BnaCnng14840D [Brassica napus]
Length=344

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 5/114 (4%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEK-----QNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            KEDI++  K+KFR++G+ EK     ++ + +   GGVMTEC TDSP++H LP EDAECCI
Sbjct  231  KEDIDQLTKFKFRKVGESEKHTVDEEDEQAKGDSGGVMTECGTDSPLQHTLPHEDAECCI  290

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CL AY D  ELRELPC H FHC+C+DKWLYINATCPLCK+NI+KN N  + E+V
Sbjct  291  CLSAYADETELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKNSNYEDGEEV  344



>gb|AAO72540.1| ring zinc finger protein-like protein [Oryza sativa Japonica 
Group]
Length=250

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR  + EKQ  +    FGG+MTEC T+ PIE VL PEDAECCICL AY
Sbjct  142  EDDIRQIPRYKFRRTDEPEKQTADETGPFGGIMTECGTNQPIEKVLAPEDAECCICLSAY  201

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            DDG ELRELPC H FHCACIDKWL+INATCPLCKFNI K
Sbjct  202  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFNIRK  240



>emb|CDY60265.1| BnaC05g49290D [Brassica napus]
Length=359

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLG-DFEKQNG--EIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDIE+  K+KFR++G D  K  G  E Q +  G+MTEC TDSP+EH L  EDAECCICL
Sbjct  249  KEDIEQLTKFKFRKVGGDVNKHGGDDEAQGNTEGIMTECGTDSPVEHTLLQEDAECCICL  308

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            CAY+DG ELRELPC H FHCAC+DKWLYINATCPLCK++I+K+ N    E
Sbjct  309  CAYEDGSELRELPCGHHFHCACVDKWLYINATCPLCKYDILKSSNLDGEE  358



>ref|XP_008803037.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Phoenix dactylifera]
Length=385

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  678  PKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELR  499
            PKYKFRR+GD EK  G+I    GG+MTE  +D PIEHVL  EDAECCICL +YDDGVELR
Sbjct  285  PKYKFRRIGDSEKLGGDISRPSGGIMTESGSDQPIEHVLSAEDAECCICLSSYDDGVELR  344

Query  498  ELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            ELPC H FHC CIDKWL I+ATCPLCKFN++K  +    E
Sbjct  345  ELPCSHHFHCTCIDKWLRISATCPLCKFNVIKRSDDGIEE  384



>ref|XP_006402511.1| hypothetical protein EUTSA_v10006041mg [Eutrema salsugineum]
 gb|ESQ43964.1| hypothetical protein EUTSA_v10006041mg [Eutrema salsugineum]
Length=374

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            P E+IER  K+KF  + + EK NGE++E+ GG+MTE   DS  E V+  +DAEC ICLCA
Sbjct  265  PDEEIERLSKFKFLTVKNSEKVNGEVRETQGGIMTELGVDSQTERVIASDDAECSICLCA  324

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPCRH FH  C+DKWL INATCPLCKFNI+KN   S SE V
Sbjct  325  YEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEHSGSEQV  374



>ref|XP_008803038.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Phoenix dactylifera]
Length=384

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -1

Query  678  PKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELR  499
            PKYKFRR+GD EK  G+I    GG+MTE  +D PIEHVL  EDAECCICL +YDDGVELR
Sbjct  284  PKYKFRRIGDSEKLGGDISRPSGGIMTESGSDQPIEHVLSAEDAECCICLSSYDDGVELR  343

Query  498  ELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            ELPC H FHC CIDKWL I+ATCPLCKFN++K  +    E
Sbjct  344  ELPCSHHFHCTCIDKWLRISATCPLCKFNVIKRSDDGIEE  383



>gb|KFK40526.1| hypothetical protein AALP_AA2G007300 [Arabis alpina]
Length=359

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQES-FGGVMTECDTDSPIEHVLPPEDAECCICLC  526
             KEDI++  KYKFR++ D EK   + +E   GGVMTEC TDSPIEH LP +DAECCICL 
Sbjct  249  SKEDIDQLTKYKFRKVADSEKHTVDEEEGEAGGVMTECGTDSPIEHTLPHDDAECCICLS  308

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            AY+D  ELRELPC H FHC C+DKWLY+NATCPLCK+NI+K+ N    E+V
Sbjct  309  AYEDETELRELPCGHHFHCNCVDKWLYLNATCPLCKYNILKSSNYEEGEEV  359



>ref|NP_564810.1| zinc finger, C3HC4 type (RING finger) family protein [Arabidopsis 
thaliana]
 sp|Q8LDB8.2|RING2_ARATH RecName: Full=E3 ubiquitin-protein ligase At1g63170; AltName: 
Full=RING finger protein At1g63170 [Arabidopsis thaliana]
 gb|AAG51597.1|AC010795_1 hypothetical protein; 76801-78300 [Arabidopsis thaliana]
 gb|AEE34064.1| zinc finger, C3HC4 type (RING finger) family protein [Arabidopsis 
thaliana]
Length=381

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 84/112 (75%), Gaps = 3/112 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQN---GEIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD  K      + Q   GGVMTEC TDSP+EH LP EDAECCICL
Sbjct  270  KEDIDQLTKFKFRKVGDTMKHTVDEEQGQGDSGGVMTECGTDSPVEHALPHEDAECCICL  329

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N    E+V
Sbjct  330  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEEGEEV  381



>ref|NP_001053593.2| Os04g0568900 [Oryza sativa Japonica Group]
 gb|EAY95206.1| hypothetical protein OsI_17025 [Oryza sativa Indica Group]
 gb|EAZ31676.1| hypothetical protein OsJ_15824 [Oryza sativa Japonica Group]
 dbj|BAF15507.2| Os04g0568900 [Oryza sativa Japonica Group]
Length=267

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR  + EKQ  +    FGG+MTEC T+ PIE VL PEDAECCICL AY
Sbjct  159  EDDIRQIPRYKFRRTDEPEKQTADETGPFGGIMTECGTNQPIEKVLAPEDAECCICLSAY  218

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            DDG ELRELPC H FHCACIDKWL+INATCPLCKFNI K
Sbjct  219  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFNIRK  257



>ref|NP_567110.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 gb|AAL24312.1| putative protein [Arabidopsis thaliana]
 gb|AAL47351.1| putative protein [Arabidopsis thaliana]
 gb|AEE80168.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=379

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            P E+IER  K+KF  + + EK NGEI+E+ GG+MT  DT+S  E +L  EDAEC ICLCA
Sbjct  270  PDEEIERLLKFKFLTVKNSEKVNGEIRETQGGIMTGLDTESQTERMLLSEDAECSICLCA  329

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPCRH FH  C+DKWL INATCPLCKFNI+KN   S SE V
Sbjct  330  YEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSEQV  379



>emb|CAB71048.1| putative protein [Arabidopsis thaliana]
Length=362

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            P E+IER  K+KF  + + EK NGEI+E+ GG+MT  DT+S  E +L  EDAEC ICLCA
Sbjct  253  PDEEIERLLKFKFLTVKNSEKVNGEIRETQGGIMTGLDTESQTERMLLSEDAECSICLCA  312

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPCRH FH  C+DKWL INATCPLCKFNI+KN   S SE V
Sbjct  313  YEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSEQV  362



>tpg|DAA39681.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=199

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -1

Query  705  QPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLC  526
              ++D+    K+KFR + D +K    I    GGVMTEC T+ P+EH+L  EDAECCICLC
Sbjct  91   ASEDDVNNLSKFKFRTMSDADKLAAGIAAPVGGVMTECGTNPPVEHILSAEDAECCICLC  150

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
             Y+DGVELRELPC H FHC+CIDKWL+INATCPLCKFNIVK++
Sbjct  151  PYEDGVELRELPCNHHFHCSCIDKWLHINATCPLCKFNIVKSN  193



>emb|CAE02249.2| OSJNBb0032E06.5 [Oryza sativa Japonica Group]
 emb|CAH67032.1| OSIGBa0139P06.5 [Oryza sativa Indica Group]
Length=324

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR  + EKQ  +    FGG+MTEC T+ PIE VL PEDAECCICL AY
Sbjct  216  EDDIRQIPRYKFRRTDEPEKQTADETGPFGGIMTECGTNQPIEKVLAPEDAECCICLSAY  275

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            DDG ELRELPC H FHCACIDKWL+INATCPLCKFNI K
Sbjct  276  DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFNIRK  314



>ref|XP_010112554.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXC34101.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=378

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+KF +    EK  G+ Q   GG+MTEC TDSP+EHVL  EDAECCICL AY
Sbjct  273  KEDIEQLSKFKFSKRCSNEKLAGDAQGPCGGIMTECGTDSPVEHVLSQEDAECCICLTAY  332

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN  394
            DDGVELR+LPC H FHC+C+DKWL+INATCPLCK+NI+K+ +
Sbjct  333  DDGVELRQLPCGHHFHCSCVDKWLFINATCPLCKYNILKSSS  374



>gb|AAM63303.1| unknown [Arabidopsis thaliana]
Length=381

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQES---FGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD  K   + ++     GGVMTEC TDSP+EH LP EDAECCICL
Sbjct  270  KEDIDQLTKFKFRKVGDTMKHTVDEEQGEGDSGGVMTECGTDSPVEHALPHEDAECCICL  329

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N    E+V
Sbjct  330  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEEGEEV  381



>emb|CDY26592.1| BnaA09g46850D [Brassica napus]
Length=384

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++GD  K  G E Q +  G+M EC TDSP+EH L  EDAECCICL A
Sbjct  276  KEDIEQLTKFKFRKVGDVNKHAGDEAQGNTDGIMIECGTDSPVEHTLLQEDAECCICLSA  335

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK NI+K+ N    E
Sbjct  336  YEDGAELRELPCGHHFHCSCVDKWLYINATCPLCKHNILKSSNLDREE  383



>ref|XP_010529546.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Tarenaya 
hassleriana]
Length=401

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESF-GGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            K+DI+  PK+ FRR+GD +K  GE Q S  GG+MTEC TDSPIEH + PEDAECCICLC 
Sbjct  297  KDDIDHLPKFIFRRIGDDDKLPGEAQRSTAGGIMTECGTDSPIEHSISPEDAECCICLCD  356

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            Y++GVELRELPC H FHCACI+KWL IN+ CPLCKFNIV + N 
Sbjct  357  YEEGVELRELPCGHHFHCACIEKWLRINSKCPLCKFNIVNDSNH  400



>ref|XP_006302394.1| hypothetical protein CARUB_v10020462mg [Capsella rubella]
 gb|EOA35292.1| hypothetical protein CARUB_v10020462mg [Capsella rubella]
Length=382

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG---EIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD  K      + Q   GGVMTEC TDSPIEH LP +DAECCICL
Sbjct  270  KEDIDQLTKFKFRKVGDSVKHTVDEEQAQGDSGGVMTECGTDSPIEHTLPHDDAECCICL  329

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+KN N   +++
Sbjct  330  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKNGNYEGADE  380



>ref|XP_010529547.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Tarenaya 
hassleriana]
Length=400

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESF-GGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            K+DI+  PK+ FRR+GD +K  GE Q S  GG+MTEC TDSPIEH + PEDAECCICLC 
Sbjct  296  KDDIDHLPKFIFRRIGDDDKLPGEAQRSTAGGIMTECGTDSPIEHSISPEDAECCICLCD  355

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            Y++GVELRELPC H FHCACI+KWL IN+ CPLCKFNIV + N 
Sbjct  356  YEEGVELRELPCGHHFHCACIEKWLRINSKCPLCKFNIVNDSNH  399



>ref|XP_011035074.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X4 [Populus euphratica]
Length=374

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            E+I+R PKYKF R   FEK +GE  E  GG+MTECDTD+PIE  +  EDAECCICL AY+
Sbjct  267  EEIDRLPKYKFCRAEAFEKVDGENPEICGGMMTECDTDTPIERAVSHEDAECCICLSAYE  326

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +G ELRELPC H FHC CIDKWL INATCPLCKFNIVK  N+S +E+ 
Sbjct  327  NGSELRELPCNHHFHCMCIDKWLCINATCPLCKFNIVKAGNRSGNEEA  374



>ref|XP_011035066.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X3 [Populus euphratica]
Length=375

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            E+I+R PKYKF R   FEK +GE  E  GG+MTECDTD+PIE  +  EDAECCICL AY+
Sbjct  268  EEIDRLPKYKFCRAEAFEKVDGENPEICGGMMTECDTDTPIERAVSHEDAECCICLSAYE  327

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +G ELRELPC H FHC CIDKWL INATCPLCKFNIVK  N+S +E+ 
Sbjct  328  NGSELRELPCNHHFHCMCIDKWLCINATCPLCKFNIVKAGNRSGNEEA  375



>emb|CDY31275.1| BnaC08g15700D [Brassica napus]
Length=394

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+KFR++G   K  G E Q +  G+MTEC TDSP+EH +  EDAECCICL A
Sbjct  286  KEDIEQLTKFKFRKVGGVNKHAGDEAQANTVGIMTECGTDSPLEHTILQEDAECCICLSA  345

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            Y+DG ELRELPC H FHC C+DKWLY+NATCPLCK+NI+K+ N    E
Sbjct  346  YEDGTELRELPCGHHFHCLCVDKWLYVNATCPLCKYNILKSSNLDREE  393



>emb|CDY66607.1| BnaA06g38090D [Brassica napus]
Length=399

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLG-DFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLC  526
            KEDIE+  K+KFR++G D  K  G E Q +  GVMTEC TDSP+EH +  EDAECCICLC
Sbjct  290  KEDIEQLTKFKFRKVGGDVNKHAGDEAQGNAEGVMTECGTDSPVEHTILQEDAECCICLC  349

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            AY+DG ELRELPC H FHC+C+DKWLYINATCPLCK++I+K+ N    E
Sbjct  350  AYEDGSELRELPCGHHFHCSCVDKWLYINATCPLCKYDILKSSNLDREE  398



>ref|XP_004956145.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Setaria italica]
Length=352

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI    K+KFR +GD +K    I    GGVMTEC T+ P+EH+L  EDAECCICLC Y
Sbjct  246  EEDINNLSKFKFRTMGDHDKLVAGIAAPVGGVMTECGTNPPVEHILSAEDAECCICLCPY  305

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
            +DG ELRELPC H FHC+CIDKWL+INATCPLCKFNIVK++
Sbjct  306  EDGAELRELPCNHHFHCSCIDKWLHINATCPLCKFNIVKSN  346



>ref|XP_004956144.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Setaria italica]
Length=353

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI    K+KFR +GD +K    I    GGVMTEC T+ P+EH+L  EDAECCICLC Y
Sbjct  247  EEDINNLSKFKFRTMGDHDKLVAGIAAPVGGVMTECGTNPPVEHILSAEDAECCICLCPY  306

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
            +DG ELRELPC H FHC+CIDKWL+INATCPLCKFNIVK++
Sbjct  307  EDGAELRELPCNHHFHCSCIDKWLHINATCPLCKFNIVKSN  347



>ref|XP_010430403.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Camelina sativa]
Length=383

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQ---NGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD  K      + Q   GGVMTEC TDSP+EH LP EDAECCICL
Sbjct  271  KEDIDQLTKFKFRKVGDSVKHAVDEEQAQGDSGGVMTECGTDSPVEHTLPHEDAECCICL  330

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N   +++
Sbjct  331  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSGNYEGADE  381



>ref|XP_007040144.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
 gb|EOY24645.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
Length=381

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K++FR+  + EK  G+ +   GG+MTEC TDSP+EHVL  +DAECCICL  Y
Sbjct  276  KEDIDQLSKFRFRKTCNDEKIAGDAEGPVGGIMTECSTDSPMEHVLSQDDAECCICLSPY  335

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            DDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ + 
Sbjct  336  DDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSH  378



>ref|XP_007040145.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
2 [Theobroma cacao]
 gb|EOY24646.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
2 [Theobroma cacao]
Length=380

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDI++  K++FR+  + EK  G+ +   GG+MTEC TDSP+EHVL  +DAECCICL  Y
Sbjct  275  KEDIDQLSKFRFRKTCNDEKIAGDAEGPVGGIMTECSTDSPMEHVLSQDDAECCICLSPY  334

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            DDGVELRELPC H FHCAC+DKWLYINATCPLCK+NI+K+ + 
Sbjct  335  DDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSH  377



>ref|XP_009148567.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Brassica rapa]
Length=400

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLG-DFEKQNG-EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLC  526
            KEDIE+  K+KFR++G D  K  G E Q +  GVMTEC TDSP+EH +  EDAECCICLC
Sbjct  291  KEDIEQLTKFKFRKVGGDVNKHAGDEAQGNAEGVMTECGTDSPVEHTILQEDAECCICLC  350

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            AY+DG ELRELPC H FHC+C+DKWLYINATCPLCK++I+K+ N    E
Sbjct  351  AYEDGSELRELPCGHHFHCSCVDKWLYINATCPLCKYDILKSSNLDREE  399



>ref|XP_010545919.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Tarenaya hassleriana]
Length=413

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEK-QNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+ FRR+ D +K  + E+Q + GGVMTEC TD+PIEH L  ED+ECCICL A
Sbjct  304  KEDIEQLTKFNFRRVCDTDKLASDEVQGNVGGVMTECGTDTPIEHTLLQEDSECCICLSA  363

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPC H FHC C+DKWL+INATCPLCK+NI+K+ +    E V
Sbjct  364  YEDGVELRELPCGHHFHCECVDKWLFINATCPLCKYNILKSTDSHADEQV  413



>ref|XP_010545936.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Tarenaya hassleriana]
Length=412

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEK-QNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+ FRR+ D +K  + E+Q + GGVMTEC TD+PIEH L  ED+ECCICL A
Sbjct  303  KEDIEQLTKFNFRRVCDTDKLASDEVQGNVGGVMTECGTDTPIEHTLLQEDSECCICLSA  362

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPC H FHC C+DKWL+INATCPLCK+NI+K+ +    E V
Sbjct  363  YEDGVELRELPCGHHFHCECVDKWLFINATCPLCKYNILKSTDSHADEQV  412



>ref|XP_010545928.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Tarenaya hassleriana]
Length=412

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEK-QNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+ FRR+ D +K  + E+Q + GGVMTEC TD+PIEH L  ED+ECCICL A
Sbjct  303  KEDIEQLTKFNFRRVCDTDKLASDEVQGNVGGVMTECGTDTPIEHTLLQEDSECCICLSA  362

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPC H FHC C+DKWL+INATCPLCK+NI+K+ +    E V
Sbjct  363  YEDGVELRELPCGHHFHCECVDKWLFINATCPLCKYNILKSTDSHADEQV  412



>ref|XP_010545944.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X4 [Tarenaya hassleriana]
Length=411

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEK-QNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            KEDIE+  K+ FRR+ D +K  + E+Q + GGVMTEC TD+PIEH L  ED+ECCICL A
Sbjct  302  KEDIEQLTKFNFRRVCDTDKLASDEVQGNVGGVMTECGTDTPIEHTLLQEDSECCICLSA  361

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPC H FHC C+DKWL+INATCPLCK+NI+K+ +    E V
Sbjct  362  YEDGVELRELPCGHHFHCECVDKWLFINATCPLCKYNILKSTDSHADEQV  411



>ref|XP_004515807.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=379

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+  K+ F+R    EK  G  Q   GG+MTEC  DSPIEHVL  EDAECCICL AY
Sbjct  273  KEDIEQLSKFTFQRKSK-EKLAGNTQGPIGGIMTECQADSPIEHVLADEDAECCICLSAY  331

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHCAC+DKWL+INATCPLCK+NI+K+      E
Sbjct  332  DDGVELRQLPCGHHFHCACVDKWLHINATCPLCKYNILKSTIHGQEE  378



>ref|XP_006279087.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
 gb|EOA11985.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
Length=362

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            P E+IER  K+KF  + + EK NGEI+E+ GG+MT    +S  E VL  EDAEC ICLCA
Sbjct  253  PDEEIERLLKFKFLTVKNSEKVNGEIRETQGGIMTGLGAESQTERVLSSEDAECSICLCA  312

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPCRH FH  C+DKWL INATCPLCKFNI+KN   S SE V
Sbjct  313  YEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSEQV  362



>ref|XP_010473550.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=382

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQ---NGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD  K      + Q   GGVMTEC TDSP+EH LP EDAECCICL
Sbjct  270  KEDIDQLTKFKFRKVGDSVKHAVDEEQAQGDSGGVMTECGTDSPVEHTLPHEDAECCICL  329

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N   +++
Sbjct  330  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSGNYEGADE  380



>ref|XP_003563155.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Brachypodium 
distachyon]
Length=359

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI    KYKFR +G+ +K    I    GGVMTEC T+ P+EH+L  EDAECCICLC Y
Sbjct  253  EEDINNLSKYKFRTMGEADKLVAGIAAPVGGVMTECGTNPPVEHILSAEDAECCICLCPY  312

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQS  388
            +DG ELRELPC H FHC CIDKWL+INATCPLCKFNIVK +  S
Sbjct  313  EDGTELRELPCNHHFHCTCIDKWLHINATCPLCKFNIVKGNLGS  356



>ref|XP_010418331.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=382

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQ---NGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD  K      + Q   GGVMTEC TDSP+EH LP EDAECCICL
Sbjct  270  KEDIDQLTKFKFRKVGDSVKHAVDEEQAQGDSGGVMTECGTDSPVEHTLPHEDAECCICL  329

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED  376
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N   +++
Sbjct  330  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSGNYEGADE  380



>ref|XP_006652656.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Oryza 
brachyantha]
Length=266

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR  + EKQ  + +  FGG+MTEC T+ PIE VL PEDAECCICL AY
Sbjct  159  EDDIRQIPRYKFRRTDEPEKQTTD-ETPFGGIMTECGTNQPIEKVLAPEDAECCICLSAY  217

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            DDG ELRELPC H FHCACIDKWL+INATCPLCKFNI K
Sbjct  218  DDGAELRELPCEHHFHCACIDKWLHINATCPLCKFNIRK  256



>emb|CDY70309.1| BnaCnng67740D [Brassica napus]
Length=366

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+    E+IER PK+KF  L + EK NGEI+E+ GG+MT+   DSP E VL  ++AECCI
Sbjct  253  REGASDEEIERLPKFKFLTLKNSEKVNGEIRETHGGIMTQLGVDSPSERVLSSDEAECCI  312

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CLC Y+DG ELREL CRH FH ACIDKWL INATCPLCKFNI+K   QS ++ V
Sbjct  313  CLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKFNILKTGEQSCNDAV  366



>ref|XP_002876598.1| hypothetical protein ARALYDRAFT_486593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52857.1| hypothetical protein ARALYDRAFT_486593 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            P E+IER  K+KF  + + EK NGEI+E+ GG+MT    +S  E VL  EDAEC ICLCA
Sbjct  268  PDEEIERLLKFKFLVVKNSEKVNGEIRETQGGIMTGLGAESQTERVLSSEDAECSICLCA  327

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            Y+DGVELRELPCRH FH  C+DKWL INATCPLCKFNI+KN   S SE V
Sbjct  328  YEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSEQV  377



>emb|CDY21061.1| BnaA08g24640D [Brassica napus]
Length=324

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGE-IQESFGGVMTECDTDSPIEHVLPPEDAECCICLC  526
             KEDIE+  K+KFR++G   K  G+  Q +  G MTEC TDSP+EH +  EDAECCICL 
Sbjct  215  SKEDIEQLTKFKFRKVGRVNKHAGDDAQANTEGKMTECGTDSPLEHTILQEDAECCICLS  274

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            AY+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  275  AYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  323



>ref|XP_002320753.2| hypothetical protein POPTR_0014s07110g [Populus trichocarpa]
 gb|EEE99068.2| hypothetical protein POPTR_0014s07110g [Populus trichocarpa]
Length=375

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            E+I+R PKYKF R   FEK +GE  E  GG+MTECD D+PIE  +  EDAECCICL AY+
Sbjct  268  EEIDRLPKYKFCRAEAFEKVDGENPEICGGMMTECDNDTPIERAVSHEDAECCICLSAYE  327

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            +G ELRELPC H FHC CIDKWL INATCPLCKFNIVK  N+S +E+ 
Sbjct  328  NGSELRELPCNHHFHCMCIDKWLCINATCPLCKFNIVKAGNRSGNEEA  375



>ref|XP_006396865.1| hypothetical protein EUTSA_v10028703mg [Eutrema salsugineum]
 gb|ESQ38318.1| hypothetical protein EUTSA_v10028703mg [Eutrema salsugineum]
Length=402

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFG-GVMTECDTDSPIEHVLPPEDAECCICLCA  523
            K DI++ PK++FR++G+ EK  G+ Q +   G+MTEC TDSPIE  + PEDAECCICLC 
Sbjct  298  KNDIDQMPKFRFRKIGNDEKLPGKAQATSDRGIMTECGTDSPIERSISPEDAECCICLCE  357

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            Y+DGVELRELPC H FHC CIDKWL+IN+ CPLCKFNI+KN N+
Sbjct  358  YEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNVNE  401



>emb|CDX74763.1| BnaA05g05090D [Brassica napus]
Length=363

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+    E+IE+ PK+KF  + + EK NGEI+E+ GG+MT+   DSP E VL  ++AECCI
Sbjct  250  REGASDEEIEKLPKFKFLTVRNSEKVNGEIRETRGGIMTQLGVDSPTERVLSSDEAECCI  309

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CLC Y+DG ELREL CRH FH ACIDKWL INATCPLCKFNI+K   QS ++ V
Sbjct  310  CLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKFNILKTGEQSGNDAV  363



>ref|XP_002459812.1| hypothetical protein SORBIDRAFT_02g011130 [Sorghum bicolor]
 gb|EER96333.1| hypothetical protein SORBIDRAFT_02g011130 [Sorghum bicolor]
Length=357

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI    K+KFR + D +K    I    GGVMTEC T+ P+EH+L  EDAECCICLC Y
Sbjct  251  EDDINNLSKFKFRTMSDADKLAAGIAAPVGGVMTECGTNPPVEHILSAEDAECCICLCPY  310

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
            +DGVELRELPC H FHC+CIDKWL+INATCPLCKFNIVK++
Sbjct  311  EDGVELRELPCNHHFHCSCIDKWLHINATCPLCKFNIVKSN  351



>ref|XP_010544693.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Tarenaya 
hassleriana]
Length=375

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+    E+IER PK+KF  + + EK NGEI+E+ GG+MTE   DSP E VLP +DAECCI
Sbjct  264  REGATDEEIERIPKFKFLVVRNSEKVNGEIRETQGGIMTELGVDSPTERVLPSDDAECCI  323

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQS  388
            CLC Y+DG ELREL CRH FH  CIDKWL INATCPLCKFN++K  + S
Sbjct  324  CLCPYEDGAELRELSCRHHFHSHCIDKWLRINATCPLCKFNVIKTGDHS  372



>emb|CDX71761.1| BnaC08g31130D [Brassica napus]
Length=370

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            P E+IER  K+KF  + D EK NGE+QE+ GG+MTE   DS  E V+  +DAEC ICLCA
Sbjct  262  PDEEIERLSKFKFLTVKDSEKVNGEVQETQGGIMTELGVDSQTERVISSDDAECSICLCA  321

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            Y+DG ELRELPCRH FH  C+DKWL INATCPLCKFNI+KN++ 
Sbjct  322  YEDGAELRELPCRHHFHSVCVDKWLRINATCPLCKFNILKNEHS  365



>ref|XP_010544692.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Tarenaya 
hassleriana]
Length=379

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+    E+IER PK+KF  + + EK NGEI+E+ GG+MTE   DSP E VLP +DAECCI
Sbjct  268  REGATDEEIERIPKFKFLVVRNSEKVNGEIRETQGGIMTELGVDSPTERVLPSDDAECCI  327

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQS  388
            CLC Y+DG ELREL CRH FH  CIDKWL INATCPLCKFN++K  + S
Sbjct  328  CLCPYEDGAELRELSCRHHFHSHCIDKWLRINATCPLCKFNVIKTGDHS  376



>ref|XP_006294289.1| hypothetical protein CARUB_v10023298mg, partial [Capsella rubella]
 gb|EOA27187.1| hypothetical protein CARUB_v10023298mg, partial [Capsella rubella]
Length=417

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+    E+IER PK+KF  + + EK NGEI+ES GG+MT+   DSP E VL  ++AECCI
Sbjct  304  REGASDEEIERLPKFKFLTVRNSEKVNGEIRESHGGIMTQLSVDSPSERVLSSDEAECCI  363

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CLC Y+DG ELREL CRH FH ACIDKWL INATCPLCKFNI+K   QS ++ V
Sbjct  364  CLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKFNILKTGEQSGNDAV  417



>ref|XP_009116780.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Brassica rapa]
Length=373

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            P E+IER  K+KF  + D EK NGE+QE+ GG+MTE   DS  E V+  +DAEC ICLCA
Sbjct  265  PDEEIERLSKFKFLTVKDSEKVNGEVQETQGGIMTELGVDSQTERVISSDDAECSICLCA  324

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            Y+DG ELRELPCRH FH  C+DKWL INATCPLCKFNI+KN++ 
Sbjct  325  YEDGAELRELPCRHHFHSVCVDKWLRINATCPLCKFNILKNEHS  368



>ref|XP_008670056.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Zea mays]
Length=354

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++D+    K+KFR + D +K    I    GGVMTEC T+ P+EH+L  EDAECCICLC Y
Sbjct  248  EDDVNNLSKFKFRTMSDADKLAAGIAAPVGGVMTECGTNPPVEHILSAEDAECCICLCPY  307

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
            +DGVELRELPC H FHC+CIDKWL+INATCPLCKFNIVK++
Sbjct  308  EDGVELRELPCNHHFHCSCIDKWLHINATCPLCKFNIVKSN  348



>emb|CDY52328.1| BnaA09g38770D [Brassica napus]
Length=373

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA  523
            P E+IER  K+KF  + D EK NGE+QE+ GG+MTE   DS  E V+  +DAEC ICLCA
Sbjct  265  PDEEIERLSKFKFLTVKDSEKVNGEVQETQGGIMTELGVDSQTERVISSDDAECSICLCA  324

Query  522  YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            Y+DG ELRELPCRH FH  C+DKWL INATCPLCKFNI+KN++ 
Sbjct  325  YEDGAELRELPCRHHFHSVCVDKWLRINATCPLCKFNILKNEHS  368



>ref|XP_009110629.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Brassica rapa]
Length=389

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGE-IQESFGGVMTECDTDSPIEHVLPPEDAECCICLC  526
             KEDIE+  K+KFR++G   K  G+  Q +  G MTEC TDSP+EH +  EDAECCICL 
Sbjct  280  SKEDIEQLTKFKFRKVGRVNKHAGDDAQANTEGKMTECGTDSPLEHTILQEDAECCICLS  339

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            AY+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  340  AYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  388



>gb|ADK63393.1| C3HC4 type zinc finger protein [Brassica rapa]
Length=313

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+    E+IE+ PK+KF  + + EK NGEI+E+ GG+MT+   DSP E VL  ++AECCI
Sbjct  200  REGASDEEIEKLPKFKFLTVRNSEKVNGEIRETRGGIMTQLGVDSPSERVLSSDEAECCI  259

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CLC Y+DG ELREL CRH FH ACIDKWL INATCPLCKFNI+K   QS  + V
Sbjct  260  CLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKFNILKTGEQSGDDAV  313



>ref|XP_009110628.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Brassica rapa]
Length=390

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -1

Query  702  PKEDIERPPKYKFRRLGDFEKQNGE-IQESFGGVMTECDTDSPIEHVLPPEDAECCICLC  526
             KEDIE+  K+KFR++G   K  G+  Q +  G MTEC TDSP+EH +  EDAECCICL 
Sbjct  281  SKEDIEQLTKFKFRKVGRVNKHAGDDAQANTEGKMTECGTDSPLEHTILQEDAECCICLS  340

Query  525  AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            AY+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct  341  AYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE  389



>ref|XP_009420927.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=329

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            EDI + P YKFRR+ +FE    E+Q S GG+M EC +D PIEHVL  EDA CC+CL AY 
Sbjct  233  EDIRQLPTYKFRRIDNFEILFNEVQRSKGGMMIECGSDEPIEHVLSAEDAVCCMCLSAYK  292

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIV  406
            DGVELR  PCRH FHCACIDKWLYINATCPLCK+NIV
Sbjct  293  DGVELRVPPCRHHFHCACIDKWLYINATCPLCKYNIV  329



>ref|XP_008355581.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Malus domestica]
Length=385

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PK+KFR++G+   +        GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  281  KEDIEQLPKFKFRKVGN---EKVXGDVQGGGVMTECGTDSPIEHVLSQEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  338  DDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  384



>ref|XP_008355582.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Malus domestica]
Length=385

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PK+KFR++G+   +        GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  281  KEDIEQLPKFKFRKVGN---EKVXGDVQGGGVMTECGTDSPIEHVLSQEDAECCICLSSY  337

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  338  DDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  384



>ref|XP_008355580.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Malus domestica]
Length=386

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PK+KFR++G+   +        GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  282  KEDIEQLPKFKFRKVGN---EKVXGDVQGGGVMTECGTDSPIEHVLSQEDAECCICLSSY  338

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  339  DDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  385



>ref|XP_008355584.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Malus domestica]
Length=384

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KEDIE+ PK+KFR++G+   +        GGVMTEC TDSPIEHVL  EDAECCICL +Y
Sbjct  280  KEDIEQLPKFKFRKVGN---EKVXGDVQGGGVMTECGTDSPIEHVLSQEDAECCICLSSY  336

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELR+LPC H FHC+CIDKWL+INATCPLCK+NI+K+ +Q   E
Sbjct  337  DDGVELRQLPCGHHFHCSCIDKWLFINATCPLCKYNILKSSSQDQGE  383



>ref|NP_001059583.1| Os07g0463400 [Oryza sativa Japonica Group]
 dbj|BAC79657.1| putative RES protein [Oryza sativa Japonica Group]
 dbj|BAF21497.1| Os07g0463400 [Oryza sativa Japonica Group]
 gb|EAZ39717.1| hypothetical protein OsJ_24155 [Oryza sativa Japonica Group]
 dbj|BAG90507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            ++   +EDI    K+KFR +GD +K    I    GGVMTEC T+ P+EH L  EDAECCI
Sbjct  250  QEGASEEDINNLSKFKFRTMGDADKLVAGIAAPVGGVMTECGTNPPVEHFLSAEDAECCI  309

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
            CLC Y+DG ELRELPC H FHC CIDKWL+INATCPLCKFNI+K++
Sbjct  310  CLCPYEDGAELRELPCNHHFHCTCIDKWLHINATCPLCKFNIIKSN  355



>gb|EEC81984.1| hypothetical protein OsI_25906 [Oryza sativa Indica Group]
Length=361

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            ++   +EDI    K+KFR +GD +K    I    GGVMTEC T+ P+EH L  EDAECCI
Sbjct  250  QEGASEEDINNLSKFKFRTMGDADKLVAGIAAPVGGVMTECGTNPPVEHFLSAEDAECCI  309

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
            CLC Y+DG ELRELPC H FHC CIDKWL+INATCPLCKFNI+K++
Sbjct  310  CLCPYEDGAELRELPCNHHFHCTCIDKWLHINATCPLCKFNIIKSN  355



>gb|KFK31927.1| hypothetical protein AALP_AA6G177200 [Arabis alpina]
Length=389

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            K DI++ PK++F++LG+ EK  GE   S  G MTEC TDSPIE  L PEDAECCICLC Y
Sbjct  288  KNDIDQMPKFRFKKLGNDEKLPGE--ASNRGTMTECGTDSPIERSLSPEDAECCICLCEY  345

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DG ELRELPC H FHC CIDKWL+IN+ CPLCKFNI+KN N+
Sbjct  346  EDGAELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNTNE  388



>gb|KFK37366.1| hypothetical protein AALP_AA4G247400 [Arabis alpina]
Length=361

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+     +IE  PK+KF  +   EK NGE+QE+ GG+MT+  TDSP E VL  ++AECCI
Sbjct  248  REGASDAEIESLPKFKFITVRHSEKVNGELQETHGGIMTQLGTDSPTERVLSSDEAECCI  307

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CLC Y+DG ELREL CRH FH ACIDKWL INATCPLCKFNI+K   QS  + V
Sbjct  308  CLCDYEDGTELRELSCRHHFHDACIDKWLRINATCPLCKFNILKTGEQSGDDAV  361



>gb|KHN24279.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=184

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I++ PKYKFR + +F+K+ G+I+ES  G+MTE ++++  EHV+  EDAECCICL AY
Sbjct  79   KEEIDQLPKYKFRIIKEFKKE-GDIEESSRGIMTETESETAAEHVIALEDAECCICLSAY  137

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            D+G ELRELPC H FHC CIDKWL INATCPLCKFNI++  N 
Sbjct  138  DNGAELRELPCNHHFHCTCIDKWLLINATCPLCKFNILRTGNH  180



>gb|AAL24200.1| At1g63170/F16M19_7 [Arabidopsis thaliana]
Length=381

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNG---EIQESFGGVMTECDTDSPIEHVLPPEDAECCICL  529
            KEDI++  K+KFR++GD  K      + Q   GGVMTEC TDSP+EH LP EDAECCICL
Sbjct  270  KEDIDQLTKFKFRKVGDTMKHTVDEEQGQGDSGGVMTECGTDSPVEHALPHEDAECCICL  329

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
             AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+      E +
Sbjct  330  SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSGGGGGEKI  381



>ref|NP_567379.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 sp|Q93Z92.1|RING4_ARATH RecName: Full=E3 ubiquitin-protein ligase At4g11680; AltName: 
Full=RING finger protein At4g11680 [Arabidopsis thaliana]
 gb|AAL15343.1| AT4g11680/T5C23_110 [Arabidopsis thaliana]
 gb|AAR23720.1| At4g11680/T5C23_110 [Arabidopsis thaliana]
 gb|AAY57607.1| RING finger family protein [Arabidopsis thaliana]
 gb|AEE83038.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=390

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 81/102 (79%), Gaps = 4/102 (4%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            K DI++ PK++F + G+ EK +G+ +    G+MTEC TDSPIE  L PEDAECCICLC Y
Sbjct  290  KNDIDQMPKFRFTKTGNVEKLSGKAR----GIMTECGTDSPIERSLSPEDAECCICLCEY  345

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN  394
            +DGVELRELPC H FHC CIDKWL+IN+ CPLCKFNI+KN N
Sbjct  346  EDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNAN  387



>ref|XP_009401774.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=452

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI +  KYKF ++GD EK   EI   FGG+M EC +D P+EH L  EDAECCICL  Y
Sbjct  347  EEDIHQLSKYKFHKVGDPEKL--EISGPFGGIMIECGSDPPVEHTLSAEDAECCICLSPY  404

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHC+CIDKWL INATCPLCKFNI+K+++    E
Sbjct  405  DDGVELRELPCGHHFHCSCIDKWLRINATCPLCKFNILKSNHHGTEE  451



>ref|XP_009382298.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI +  KYKF ++GD EK + E+  SFGG+M EC +D  +E VLP EDA CCICL  Y
Sbjct  268  EEDISQLSKYKFCKIGDSEKLD-ELSSSFGGIMRECGSDPAVERVLPAEDAACCICLSPY  326

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHC CIDKWL INATCPLCKFNI K++N    E
Sbjct  327  DDGVELRELPCGHHFHCGCIDKWLRINATCPLCKFNIAKSNNHGREE  373



>ref|XP_009401775.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=451

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI +  KYKF ++GD EK   EI   FGG+M EC +D P+EH L  EDAECCICL  Y
Sbjct  346  EEDIHQLSKYKFHKVGDPEKL--EISGPFGGIMIECGSDPPVEHTLSAEDAECCICLSPY  403

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHC+CIDKWL INATCPLCKFNI+K+++    E
Sbjct  404  DDGVELRELPCGHHFHCSCIDKWLRINATCPLCKFNILKSNHHGTEE  450



>ref|XP_004976528.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Setaria 
italica]
Length=379

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            ++DI + P+YKFRR  + EKQ+ +    FGG+MTEC T+ PIE VL  EDAECCICL AY
Sbjct  271  EDDIRQIPRYKFRRTDEPEKQDVDPMGPFGGIMTECGTNQPIEKVLAAEDAECCICLSAY  330

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DDG ELRELPC H FHC CIDKWL+INATCPLCK+NI K+ + S SE+V
Sbjct  331  DDGAELRELPCGHHFHCTCIDKWLHINATCPLCKYNIRKSSSSSGSEEV  379



>ref|XP_008363169.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase At1g12760-like, 
partial [Malus domestica]
Length=180

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            EDIE+  K++F+++ + EK   ++Q   GGVMTEC TDSPI+HVL  EDAECCICL  YD
Sbjct  82   EDIEQLSKFRFKKVAN-EKVADDVQ---GGVMTECGTDSPIKHVLSXEDAECCICLSCYD  137

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQS  388
            DGVELR+LPC H FHC+CI+KWL+INA+CPLCK+NI+K+ +Q+
Sbjct  138  DGVELRQLPCAHHFHCSCINKWLFINASCPLCKYNILKSSSQN  180



>tpg|DAA60522.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=359

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -1

Query  720  QIRKEQPKED-IERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAE  544
            Q+ +E   ED I    K+KF+ + D +K    I    GGVMTEC T+ P+EH+L  EDAE
Sbjct  245  QVSQEGASEDDINNLSKFKFQTMSDADKLAAGIAAPVGGVMTECGTNPPVEHILSAEDAE  304

Query  543  CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
            CCICLC Y+DGVELRELPC H FHC+CIDKWL+INATCPLCKF+I+K++
Sbjct  305  CCICLCPYEDGVELRELPCNHHFHCSCIDKWLHINATCPLCKFDIIKSN  353



>emb|CDY57781.1| BnaCnng32440D [Brassica napus]
Length=391

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            K+DI++ PK+++R++ + EK  GE      G+MTEC TDSPIE  L  EDAECCICLC Y
Sbjct  290  KKDIDQMPKFRYRKISNDEKLQGETTNR--GIMTECGTDSPIERSLSSEDAECCICLCEY  347

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DGVELRELPC H FHC CIDKWL+IN+ CPLCKFNI+KN+N+
Sbjct  348  EDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNENE  390



>ref|NP_001151256.1| protein binding protein [Zea mays]
 gb|ACG42147.1| protein binding protein [Zea mays]
Length=359

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -1

Query  720  QIRKEQPKED-IERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAE  544
            Q+ +E   ED I    K+KF+ + D +K    I    GGVMTEC T+ P+EH+L  EDAE
Sbjct  245  QVSQEGASEDDINNLSKFKFQTMSDADKLAAGIAAPVGGVMTECGTNPPVEHILSAEDAE  304

Query  543  CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND  397
            CCICLC Y+DGVELRELPC H FHC+CIDKWL+INATCPLCKF+I+K++
Sbjct  305  CCICLCPYEDGVELRELPCNHHFHCSCIDKWLHINATCPLCKFDIIKSN  353



>ref|XP_009143169.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=364

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R+    E+IE+ PK+KF  + + EK NGEI+E+ GG+MT+   DSP E VL  ++AECCI
Sbjct  251  REGASDEEIEKLPKFKFLTVRNSEKVNGEIRETRGGIMTQLGVDSPTERVLSSDEAECCI  310

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CLC Y+DG ELREL CRH FH ACIDKWL INATCPLCK NI+K   QS  + V
Sbjct  311  CLCDYEDGTELRELSCRHHFHEACIDKWLRINATCPLCKLNILKTGEQSGDDAV  364



>ref|XP_008389094.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Malus 
domestica]
Length=227

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +E+I+  PK+KFRR+GD EK NGE+Q +F G M ECDT++P E  +   DAECCICL  Y
Sbjct  120  EEEIDGLPKFKFRRVGDSEKVNGEVQ-AFEGFMIECDTNAPTERPISLVDAECCICLSVY  178

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK  403
            ++G ELRELPC H FHC CIDKWLYINATCP+CKFNI+K
Sbjct  179  ENGAELRELPCLHHFHCTCIDKWLYINATCPMCKFNILK  217



>ref|XP_010434567.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=391

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 8/103 (8%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            K DIE+ PK++FR+  + EK          G+MTEC TDSPIEH L PEDAECCICLC Y
Sbjct  295  KNDIEQMPKFRFRKSSNDEK--------LSGIMTECGTDSPIEHSLSPEDAECCICLCEY  346

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DGVELRELPC H FHC CIDKWL+IN+ CPLCKFNI+KN N+
Sbjct  347  EDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNANE  389



>gb|ACN40787.1| unknown [Picea sitchensis]
Length=397

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            +EDI   PKYKF+ +G  EK +GE    FGG+M  C  +S  E VL  EDAECCICL  Y
Sbjct  290  EEDIGLLPKYKFKSIGGSEKISGEKSGPFGGIMNLCTGESSTERVLSAEDAECCICLSTY  349

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
            DDGVELRELPC H FHC CIDKWL INATCPLCK+NI+K+ N +  E
Sbjct  350  DDGVELRELPCSHHFHCTCIDKWLRINATCPLCKYNIIKSSNNAREE  396



>ref|XP_010422123.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=391

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 78/103 (76%), Gaps = 8/103 (8%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            K DIE+ PK++FR+    EK          G+MTEC TDSPIEH L PEDAECCICLC Y
Sbjct  295  KNDIEQMPKFRFRKSSSDEK--------LSGIMTECGTDSPIEHSLSPEDAECCICLCEY  346

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DGVELRELPC H FHC CIDKWL+IN+ CPLCKFNI+KN N+
Sbjct  347  EDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNANE  389



>gb|KHN29414.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=289

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            ++   KE+IE+ PKYKF  + +F+K+ G+I+ES  G+MTE ++++  EHV+  EDAECCI
Sbjct  179  QEGATKEEIEQLPKYKFIIIKEFKKE-GDIEESSRGIMTESESETATEHVIALEDAECCI  237

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            CL AYDDG ELRELPC H FHC CIDKWL INATCPLCKFNI++  N 
Sbjct  238  CLSAYDDGAELRELPCNHHFHCTCIDKWLLINATCPLCKFNILRTGNH  285



>ref|XP_004493023.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=355

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 78/102 (76%), Gaps = 7/102 (7%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            KE+I++ PKYKF       K+ G+ QES  GVMTECD+D+  EHV+  EDAECCICL AY
Sbjct  256  KEEIDQLPKYKF-------KKEGDAQESSRGVMTECDSDTASEHVIASEDAECCICLSAY  308

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN  394
            DDG ELRELPC H FHC CIDKWL INATCPLCKFNI+  DN
Sbjct  309  DDGAELRELPCNHHFHCTCIDKWLLINATCPLCKFNILNTDN  350



>emb|CDY37062.1| BnaA04g26400D [Brassica napus]
Length=367

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -1

Query  696  EDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD  517
            E+IER P++KF  + + EK NGEI E+ GG+MT+   DSP E VL  ++AECC+CLC Y+
Sbjct  260  EEIERLPRFKFLTVRNSEKVNGEILETHGGIMTQLGVDSPSERVLSSDEAECCVCLCEYE  319

Query  516  DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            DG ELREL CRH FH ACIDKWL INATCPLCK NI+K D QS ++ V
Sbjct  320  DGTELRELWCRHHFHEACIDKWLRINATCPLCKSNILKTDEQSGNDAV  367



>ref|XP_002880197.1| hypothetical protein ARALYDRAFT_322232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56456.1| hypothetical protein ARALYDRAFT_322232 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  714  RKEQPKEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCI  535
            R     E+IER PK+KF  + + EK NGEI+E+ GG+MT+   DSP E VL  ++AECCI
Sbjct  268  RGGASDEEIERLPKFKFLTVRNSEKVNGEIRETHGGIMTQLGVDSPTERVLSSDEAECCI  327

Query  534  CLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV  373
            CLC Y+DG ELRE+ CRH FH ACIDKWL INATCPLCKFNI+K   +S ++ V
Sbjct  328  CLCDYEDGTELREMSCRHHFHEACIDKWLRINATCPLCKFNILKTGERSGNDAV  381



>ref|XP_010092737.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXB52082.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=393

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 82/110 (75%), Gaps = 3/110 (3%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPP---EDAECCICL  529
            KE+I+  P +KF  + + EK +GEIQESF G+M EC+ DS       P   EDAECCICL
Sbjct  264  KEEIDNLPMFKFCAVSNSEKVSGEIQESFRGIMVECNIDSRHSSTKRPLFEEDAECCICL  323

Query  528  CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE  379
             AYDDG ELRELPC H FHC CIDKWL+INATCPLCKFNI+K  NQS+SE
Sbjct  324  SAYDDGTELRELPCGHHFHCTCIDKWLHINATCPLCKFNILKASNQSSSE  373



>ref|XP_009124794.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=387

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = -1

Query  699  KEDIERPPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY  520
            K+DI++ PK+++R++ + EK  GE      G+MTEC TDSPIE  L  EDAECCICLC Y
Sbjct  286  KKDIDQMPKFRYRKISNDEKLPGETTNR--GIMTECGTDSPIERSLTSEDAECCICLCEY  343

Query  519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ  391
            +DGVELRELPC H FHC CIDKWL+IN+ CPLCKFNI+KN+N+
Sbjct  344  EDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNENE  386



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485