BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003K13

Length=689
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46296.1|  cytochrome P450                                        261   3e-80   Ipomoea nil [qian niu]
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like               218   4e-64   Sesamum indicum [beniseed]
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like               218   6e-64   Nicotiana tomentosiformis
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like               214   4e-62   Solanum tuberosum [potatoes]
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like               214   4e-62   Nicotiana sylvestris
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg                212   5e-62   Erythranthe guttata [common monkey flower]
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like               209   8e-61   
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like               209   2e-60   
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg                207   9e-60   Erythranthe guttata [common monkey flower]
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like               207   1e-59   Nicotiana tomentosiformis
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like               207   1e-59   Nicotiana tomentosiformis
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg                206   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like               206   3e-59   Solanum tuberosum [potatoes]
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like               205   8e-59   Solanum lycopersicum
gb|AJD25225.1|  cytochrome P450 CYP96A85                                204   9e-59   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like               204   1e-58   Solanum tuberosum [potatoes]
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like               204   2e-58   Solanum lycopersicum
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like               202   4e-58   Nicotiana sylvestris
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like               202   8e-58   
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like               201   2e-57   Solanum lycopersicum
emb|CDP18605.1|  unnamed protein product                                199   2e-57   Coffea canephora [robusta coffee]
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like               199   1e-56   Nicotiana tomentosiformis
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like               198   2e-56   
ref|XP_008441106.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    197   8e-56   
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like               196   2e-55   Nicotiana sylvestris
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg                194   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like               195   4e-55   Nicotiana tomentosiformis
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg                191   3e-54   Erythranthe guttata [common monkey flower]
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like               191   1e-53   Nicotiana tomentosiformis
gb|KGN48434.1|  hypothetical protein Csa_6G487550                       191   2e-53   Cucumis sativus [cucumbers]
ref|XP_004173396.1|  PREDICTED: cytochrome P450 86B1-like               191   2e-53   
ref|XP_004142037.1|  PREDICTED: cytochrome P450 86B1-like               190   4e-53   
gb|KDP35260.1|  hypothetical protein JCGZ_09419                         189   9e-53   Jatropha curcas
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                    188   1e-52   Solanum lycopersicum
ref|XP_006374652.1|  cytochrome P450 family protein                     188   1e-52   
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like               188   1e-52   Solanum tuberosum [potatoes]
ref|XP_010027331.1|  PREDICTED: cytochrome P450 86B1-like               188   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010027339.1|  PREDICTED: cytochrome P450 86B1-like               187   2e-52   Eucalyptus grandis [rose gum]
gb|EPS60789.1|  hypothetical protein M569_14012                         187   2e-52   Genlisea aurea
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like               187   3e-52   Populus euphratica
ref|XP_004166589.1|  PREDICTED: cytochrome P450 86B1-like               187   3e-52   
gb|KGN48435.1|  hypothetical protein Csa_6G487560                       187   3e-52   Cucumis sativus [cucumbers]
gb|KDP35257.1|  hypothetical protein JCGZ_09416                         187   4e-52   Jatropha curcas
gb|AES86633.2|  cytochrome P450 family protein                          179   5e-52   Medicago truncatula
ref|XP_011095705.1|  PREDICTED: cytochrome P450 86B1-like               186   6e-52   Sesamum indicum [beniseed]
ref|XP_010027341.1|  PREDICTED: cytochrome P450 86B1-like               186   8e-52   Eucalyptus grandis [rose gum]
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like               186   8e-52   Eucalyptus grandis [rose gum]
gb|EYU27553.1|  hypothetical protein MIMGU_mgv1a006542mg                184   8e-52   Erythranthe guttata [common monkey flower]
gb|AEI59774.1|  cytochrome P450                                         186   1e-51   Helianthus annuus
ref|XP_004489210.1|  PREDICTED: cytochrome P450 86B1-like               186   1e-51   
ref|XP_008440140.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    186   1e-51   Cucumis melo [Oriental melon]
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like               185   2e-51   Nicotiana tomentosiformis
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like               185   2e-51   Nicotiana sylvestris
gb|KEH24777.1|  cytochrome P450 family protein                          185   2e-51   Medicago truncatula
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like               185   2e-51   Nicotiana sylvestris
ref|XP_008440139.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    185   2e-51   
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                    185   2e-51   
ref|XP_008441105.1|  PREDICTED: cytochrome P450 86B1-like               182   3e-51   Cucumis melo [Oriental melon]
ref|XP_004157876.1|  PREDICTED: cytochrome P450 86B1-like               181   4e-51   
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like               184   5e-51   Sesamum indicum [beniseed]
emb|CDP12888.1|  unnamed protein product                                183   5e-51   Coffea canephora [robusta coffee]
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like               184   5e-51   Cucumis melo [Oriental melon]
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like               184   6e-51   Sesamum indicum [beniseed]
gb|EYU43136.1|  hypothetical protein MIMGU_mgv1a007195mg                182   7e-51   Erythranthe guttata [common monkey flower]
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like               183   1e-50   Nicotiana tomentosiformis
ref|XP_004160508.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    183   1e-50   
gb|KGN48432.1|  hypothetical protein Csa_6G487530                       183   1e-50   Cucumis sativus [cucumbers]
emb|CDP12890.1|  unnamed protein product                                181   1e-50   Coffea canephora [robusta coffee]
gb|KGN48429.1|  hypothetical protein Csa_6G487010                       182   2e-50   Cucumis sativus [cucumbers]
ref|XP_010681243.1|  PREDICTED: cytochrome P450 86B1-like               177   2e-50   
ref|XP_004160509.1|  PREDICTED: cytochrome P450 86B1-like               182   2e-50   
gb|KCW62190.1|  hypothetical protein EUGRSUZ_H04847                     182   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010027329.1|  PREDICTED: cytochrome P450 86B1-like               182   2e-50   Eucalyptus grandis [rose gum]
gb|KEH22137.1|  cytochrome P450 family protein                          182   2e-50   Medicago truncatula
ref|XP_011025593.1|  PREDICTED: cytochrome P450 86B1-like               182   2e-50   Populus euphratica
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                    182   2e-50   
ref|XP_004142039.1|  PREDICTED: cytochrome P450 86B1-like               181   2e-50   
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like               182   3e-50   Cicer arietinum [garbanzo]
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g             182   3e-50   Phaseolus vulgaris [French bean]
ref|NP_195658.3|  cytochrome P450, family 96, subfamily A, polype...    182   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KCW62191.1|  hypothetical protein EUGRSUZ_H04849                     181   4e-50   Eucalyptus grandis [rose gum]
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg                181   6e-50   Erythranthe guttata [common monkey flower]
gb|KEH40828.1|  cytochrome P450 family protein                          181   7e-50   Medicago truncatula
gb|KEH40839.1|  cytochrome P450 family protein                          181   8e-50   Medicago truncatula
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like               181   8e-50   Glycine max [soybeans]
gb|KFK30508.1|  hypothetical protein AALP_AA7G271100                    179   9e-50   Arabis alpina [alpine rockcress]
ref|XP_010431920.1|  PREDICTED: cytochrome P450 86B1-like               179   9e-50   Camelina sativa [gold-of-pleasure]
gb|KHN27470.1|  Cytochrome P450 86B1                                    178   1e-49   Glycine soja [wild soybean]
gb|KDO37383.1|  hypothetical protein CISIN_1g042798mg                   174   1e-49   Citrus sinensis [apfelsine]
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like               180   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like               180   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like               180   1e-49   Solanum lycopersicum
gb|KEH40811.1|  cytochrome P450 family protein                          180   1e-49   Medicago truncatula
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                    180   2e-49   Vitis vinifera
ref|XP_002310605.1|  hypothetical protein POPTR_0007s06670g             180   2e-49   
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg                180   2e-49   Erythranthe guttata [common monkey flower]
gb|KEH40819.1|  cytochrome P450 family protein                          179   2e-49   Medicago truncatula
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g             180   2e-49   Phaseolus vulgaris [French bean]
ref|XP_003604436.1|  Cytochrome P450                                    179   2e-49   
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like               179   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004492144.1|  PREDICTED: cytochrome P450 86B1-like               179   2e-49   
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like               179   3e-49   Beta vulgaris subsp. vulgaris [field beet]
emb|CAB44684.1|  cytochrome P450-like protein                           179   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KEH40835.1|  cytochrome P450 family protein                          179   3e-49   Medicago truncatula
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like               179   3e-49   Camelina sativa [gold-of-pleasure]
gb|KEH40823.1|  cytochrome P450 family protein                          179   3e-49   Medicago truncatula
gb|KEH40821.1|  cytochrome P450 family protein                          179   4e-49   Medicago truncatula
gb|KHN19678.1|  Cytochrome P450 86B1                                    177   4e-49   Glycine soja [wild soybean]
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg             179   4e-49   Capsella rubella
ref|XP_010027344.1|  PREDICTED: cytochrome P450 86B1-like               179   5e-49   Eucalyptus grandis [rose gum]
gb|KHN19669.1|  Cytochrome P450 86B1                                    177   5e-49   Glycine soja [wild soybean]
ref|XP_010681238.1|  PREDICTED: cytochrome P450 86A1-like               169   5e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004157875.1|  PREDICTED: cytochrome P450 86B1-like               178   5e-49   
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1         179   6e-49   
ref|XP_010027335.1|  PREDICTED: cytochrome P450 86B1-like               178   6e-49   
ref|XP_004142038.1|  PREDICTED: cytochrome P450 86B1-like               178   6e-49   Cucumis sativus [cucumbers]
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like               179   6e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008440137.1|  PREDICTED: cytochrome P450 86B1-like               177   6e-49   
ref|XP_010025513.1|  PREDICTED: cytochrome P450 86B1-like               178   7e-49   Eucalyptus grandis [rose gum]
gb|KEH40805.1|  cytochrome P450 family protein                          178   7e-49   Medicago truncatula
gb|KEH22136.1|  cytochrome P450 family protein                          178   7e-49   Medicago truncatula
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g             178   8e-49   Phaseolus vulgaris [French bean]
ref|XP_002869292.1|  CYP96A2                                            178   8e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_009400927.1|  PREDICTED: cytochrome P450 86B1-like               178   9e-49   
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...    178   9e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like               178   9e-49   
ref|XP_004151610.1|  PREDICTED: cytochrome P450 86B1-like               178   9e-49   Cucumis sativus [cucumbers]
ref|XP_004160507.1|  PREDICTED: cytochrome P450 86B1-like               178   9e-49   
ref|NP_195660.1|  cytochrome P450, family 96, subfamily A, polype...    177   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888363.1|  hypothetical protein ARALYDRAFT_338681             172   1e-48   
gb|EPS65366.1|  hypothetical protein M569_09411                         177   1e-48   Genlisea aurea
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like               177   1e-48   Glycine max [soybeans]
ref|XP_002866853.1|  CYP96A10                                           177   1e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like               177   1e-48   Sesamum indicum [beniseed]
emb|CDP12889.1|  unnamed protein product                                177   1e-48   Coffea canephora [robusta coffee]
ref|XP_006446605.1|  hypothetical protein CICLE_v10017795mg             177   2e-48   
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg             177   2e-48   
gb|KDP46411.1|  hypothetical protein JCGZ_10251                         176   2e-48   Jatropha curcas
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg                177   2e-48   Erythranthe guttata [common monkey flower]
gb|KGN48430.1|  hypothetical protein Csa_6G487020                       177   2e-48   Cucumis sativus [cucumbers]
gb|KEH24772.1|  cytochrome P450 family protein                          177   2e-48   Medicago truncatula
ref|XP_002888362.1|  hypothetical protein ARALYDRAFT_894004             169   3e-48   
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like               176   3e-48   Glycine max [soybeans]
gb|KEH40818.1|  cytochrome P450 family protein                          176   3e-48   Medicago truncatula
emb|CDY53179.1|  BnaA06g40580D                                          177   3e-48   Brassica napus [oilseed rape]
gb|KEH40822.1|  cytochrome P450 family protein                          176   3e-48   Medicago truncatula
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg             176   3e-48   Capsella rubella
ref|NP_176086.1|  alkane hydroxylase CYP96A15                           176   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                    176   4e-48   Brassica rapa
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like               176   4e-48   Populus euphratica
ref|XP_002866852.1|  CYP96A9                                            176   4e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_010510801.1|  PREDICTED: cytochrome P450 86B1-like               176   4e-48   Camelina sativa [gold-of-pleasure]
gb|KHM99046.1|  Cytochrome P450 86B1                                    175   4e-48   Glycine soja [wild soybean]
ref|XP_002529227.1|  cytochrome P450, putative                          176   5e-48   Ricinus communis
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g             176   6e-48   
ref|XP_006411750.1|  hypothetical protein EUTSA_v10024958mg             176   7e-48   Eutrema salsugineum [saltwater cress]
gb|KHN27468.1|  Cytochrome P450 86B1                                    175   7e-48   Glycine soja [wild soybean]
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like               176   7e-48   
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g             175   7e-48   Phaseolus vulgaris [French bean]
gb|KFK30509.1|  hypothetical protein AALP_AA7G271200                    174   8e-48   Arabis alpina [alpine rockcress]
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg                175   8e-48   Erythranthe guttata [common monkey flower]
ref|XP_003556827.2|  PREDICTED: cytochrome P450 86B1-like               175   8e-48   Glycine max [soybeans]
ref|XP_010472324.1|  PREDICTED: cytochrome P450 86B1-like               169   9e-48   
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg             175   9e-48   Eutrema salsugineum [saltwater cress]
ref|XP_010429268.1|  PREDICTED: cytochrome P450 86B1-like               174   1e-47   
ref|XP_004515481.1|  PREDICTED: cytochrome P450 86B1-like               175   1e-47   
ref|XP_007048137.1|  Cytochrome P450                                    175   1e-47   
gb|KJB44293.1|  hypothetical protein B456_007G244800                    175   1e-47   Gossypium raimondii
emb|CDM81752.1|  unnamed protein product                                175   1e-47   Triticum aestivum [Canadian hard winter wheat]
gb|KEH40830.1|  cytochrome P450 family protein                          174   2e-47   Medicago truncatula
ref|XP_002521474.1|  cytochrome P450, putative                          174   2e-47   Ricinus communis
ref|NP_001048917.1|  Os03g0140100                                       174   2e-47   
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like               174   2e-47   Glycine max [soybeans]
gb|AGV40485.1|  hypothetical protein                                    176   2e-47   Phaseolus vulgaris [French bean]
ref|XP_004513611.1|  PREDICTED: cytochrome P450 86B1-like               173   2e-47   
gb|KJB44331.1|  hypothetical protein B456_007G246400                    174   2e-47   Gossypium raimondii
gb|KHM99045.1|  Cytochrome P450 86B1                                    166   2e-47   Glycine soja [wild soybean]
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg                174   3e-47   Erythranthe guttata [common monkey flower]
ref|XP_007134109.1|  hypothetical protein PHAVU_010G019600g             174   3e-47   Phaseolus vulgaris [French bean]
gb|KEH24775.1|  cytochrome P450 family protein                          174   3e-47   Medicago truncatula
gb|KEH24773.1|  cytochrome P450 family protein                          174   3e-47   Medicago truncatula
ref|NP_179899.1|  cytochrome P450, family 96, subfamily A, polype...    174   3e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39928.1|  BnaA09g15100D                                          173   3e-47   Brassica napus [oilseed rape]
emb|CDY46088.1|  BnaA09g42120D                                          174   3e-47   Brassica napus [oilseed rape]
ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like               174   3e-47   Nicotiana sylvestris
ref|XP_002888361.1|  predicted protein                                  170   4e-47   
gb|EAY88476.1|  hypothetical protein OsI_09947                          173   4e-47   Oryza sativa Indica Group [Indian rice]
gb|KEH40842.1|  cytochrome P450 family protein                          173   4e-47   Medicago truncatula
ref|XP_002521476.1|  cytochrome P450, putative                          173   5e-47   
ref|XP_010527154.1|  PREDICTED: cytochrome P450 86B1-like               172   6e-47   
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859             173   6e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_009113346.1|  PREDICTED: cytochrome P450 86B1-like               172   6e-47   Brassica rapa
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like               173   6e-47   
gb|EPS59359.1|  hypothetical protein M569_15450                         170   7e-47   Genlisea aurea
ref|XP_002878665.1|  CYP96A1                                            173   8e-47   
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g             172   8e-47   Phaseolus vulgaris [French bean]
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg                172   8e-47   Erythranthe guttata [common monkey flower]
emb|CAN80536.1|  hypothetical protein VITISV_035975                     172   8e-47   Vitis vinifera
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g             172   9e-47   Phaseolus vulgaris [French bean]
ref|NP_001140984.1|  putative cytochrome P450 superfamily protein       168   1e-46   
ref|XP_010660343.1|  PREDICTED: cytochrome P450 86B1                    172   1e-46   Vitis vinifera
emb|CDY39927.1|  BnaA09g15090D                                          172   1e-46   Brassica napus [oilseed rape]
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like               172   1e-46   Populus euphratica
gb|KHN19680.1|  Cytochrome P450 86B1                                    173   1e-46   Glycine soja [wild soybean]
ref|XP_003629932.1|  Cytochrome P450                                    172   1e-46   Medicago truncatula
gb|EPS67771.1|  hypothetical protein M569_06997                         172   1e-46   Genlisea aurea
ref|XP_006470473.1|  PREDICTED: cytochrome P450 86B1-like               172   1e-46   
ref|XP_010520636.1|  PREDICTED: cytochrome P450 86B1-like               172   1e-46   Tarenaya hassleriana [spider flower]
gb|KDO37689.1|  hypothetical protein CISIN_1g047842mg                   171   1e-46   Citrus sinensis [apfelsine]
emb|CDM81753.1|  unnamed protein product                                172   2e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like               172   2e-46   Phoenix dactylifera
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                    172   2e-46   Vitis vinifera
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                    172   2e-46   Brassica rapa
emb|CDY53181.1|  BnaA06g40600D                                          172   2e-46   Brassica napus [oilseed rape]
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...    172   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113344.1|  PREDICTED: cytochrome P450 86B1-like               171   2e-46   Brassica rapa
dbj|BAD94304.1|  cytochrome p450 - like protein                         171   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    172   2e-46   
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                    172   2e-46   Arabis alpina [alpine rockcress]
ref|XP_009117295.1|  PREDICTED: cytochrome P450 86B1                    172   2e-46   Brassica rapa
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like               171   2e-46   Nicotiana sylvestris
gb|KDP35255.1|  hypothetical protein JCGZ_09414                         166   2e-46   Jatropha curcas
gb|AJD25224.1|  cytochrome P450 CYP96A84                                171   2e-46   Salvia miltiorrhiza [Chinese salvia]
gb|KEH24774.1|  cytochrome P450 family protein                          171   2e-46   Medicago truncatula
gb|KEH41380.1|  cytochrome P450 family protein                          171   3e-46   Medicago truncatula
ref|XP_004515489.1|  PREDICTED: cytochrome P450 86B1-like               172   3e-46   Cicer arietinum [garbanzo]
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g             171   3e-46   Populus trichocarpa [western balsam poplar]
gb|EPS72790.1|  hypothetical protein M569_01963                         171   3e-46   Genlisea aurea
ref|XP_010681240.1|  PREDICTED: cytochrome P450 86A7-like               169   4e-46   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX72695.1|  BnaC07g47170D                                          171   4e-46   
ref|XP_010666954.1|  PREDICTED: cytochrome P450 86B1-like               167   4e-46   
gb|KDP46408.1|  hypothetical protein JCGZ_10248                         171   4e-46   Jatropha curcas
emb|CDY12435.1|  BnaC08g09240D                                          171   5e-46   Brassica napus [oilseed rape]
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                    170   5e-46   Arabis alpina [alpine rockcress]
ref|XP_002534255.1|  conserved hypothetical protein                     163   5e-46   
ref|XP_006294031.1|  hypothetical protein CARUB_v10023023mg             170   6e-46   Capsella rubella
gb|KDP35252.1|  hypothetical protein JCGZ_09411                         170   6e-46   Jatropha curcas
ref|XP_006283561.1|  hypothetical protein CARUB_v10004619mg             170   6e-46   
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                    170   7e-46   Arabis alpina [alpine rockcress]
ref|XP_007134103.1|  hypothetical protein PHAVU_010G019100g             170   7e-46   Phaseolus vulgaris [French bean]
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like               170   9e-46   Nicotiana tomentosiformis
ref|NP_176713.1|  cytochrome P450, family 96, subfamily A, polype...    170   9e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like               170   9e-46   Setaria italica
gb|KHN27469.1|  Cytochrome P450 86B1                                    169   1e-45   Glycine soja [wild soybean]
ref|XP_006446602.1|  hypothetical protein CICLE_v10014930mg             170   1e-45   Citrus clementina [clementine]
ref|XP_006396175.1|  hypothetical protein EUTSA_v10002359mg             162   1e-45   
gb|KJB33823.1|  hypothetical protein B456_006G032600                    169   1e-45   Gossypium raimondii
gb|EYU33750.1|  hypothetical protein MIMGU_mgv1a020734mg                165   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like               169   2e-45   Camelina sativa [gold-of-pleasure]
gb|EYU27555.1|  hypothetical protein MIMGU_mgv1a020397mg                169   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_004515488.1|  PREDICTED: cytochrome P450 86B1-like               168   2e-45   
gb|EPS60696.1|  hypothetical protein M569_14105                         168   2e-45   Genlisea aurea
emb|CDY27160.1|  BnaA08g07980D                                          169   2e-45   Brassica napus [oilseed rape]
gb|ACR38435.1|  unknown                                                 169   2e-45   Zea mays [maize]
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like               169   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like               169   2e-45   Glycine max [soybeans]
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like               169   3e-45   Elaeis guineensis
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like               169   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY39934.1|  BnaA09g15160D                                          167   3e-45   Brassica napus [oilseed rape]
ref|XP_010447431.1|  PREDICTED: cytochrome P450 86B1                    168   4e-45   Camelina sativa [gold-of-pleasure]
gb|KDO45858.1|  hypothetical protein CISIN_1g047974mg                   168   4e-45   Citrus sinensis [apfelsine]
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like               168   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002468540.1|  hypothetical protein SORBIDRAFT_01g047610          168   4e-45   Sorghum bicolor [broomcorn]
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like               168   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590          168   5e-45   
gb|EAZ25521.1|  hypothetical protein OsJ_09345                          167   5e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...    167   7e-45   
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like               167   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g             167   7e-45   Phaseolus vulgaris [French bean]
ref|XP_010526618.1|  PREDICTED: cytochrome P450 86B1-like               167   7e-45   Tarenaya hassleriana [spider flower]
gb|EMT05588.1|  Cytochrome P450 86A2                                    167   8e-45   
emb|CAN68037.1|  hypothetical protein VITISV_011827                     168   9e-45   Vitis vinifera
gb|KJB33822.1|  hypothetical protein B456_006G032500                    167   9e-45   Gossypium raimondii
emb|CDP04331.1|  unnamed protein product                                166   9e-45   Coffea canephora [robusta coffee]
emb|CDY38914.1|  BnaA03g12650D                                          160   1e-44   Brassica napus [oilseed rape]
gb|EMT01870.1|  Cytochrome P450 86A2                                    163   1e-44   
emb|CDX76867.1|  BnaC08g34530D                                          167   1e-44   
ref|XP_010474120.1|  PREDICTED: cytochrome P450 86B1-like               167   1e-44   
ref|XP_006301880.1|  hypothetical protein CARUB_v10022359mg             165   2e-44   
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg             166   2e-44   
ref|XP_006464845.1|  PREDICTED: cytochrome P450 86B1-like               166   2e-44   
gb|KEH42495.1|  cytochrome P450 family protein                          167   2e-44   
emb|CDY37891.1|  BnaC04g31150D                                          163   2e-44   
ref|XP_006339338.1|  PREDICTED: cytochrome P450 86B1-like               165   2e-44   
gb|EEC74485.1|  hypothetical protein OsI_09945                          166   2e-44   
ref|XP_006404465.1|  hypothetical protein EUTSA_v10010970mg             166   2e-44   
gb|EMT01671.1|  Cytochrome P450 86A2                                    167   3e-44   
gb|KHN45347.1|  Cytochrome P450 86B1                                    165   3e-44   
ref|XP_009108130.1|  PREDICTED: cytochrome P450 86B1-like               166   3e-44   
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944             169   3e-44   
emb|CDY68678.1|  BnaCnng60030D                                          165   3e-44   
gb|KFK22353.1|  hypothetical protein AALP_AAs42226U000100               165   3e-44   
emb|CDY39926.1|  BnaA09g15080D                                          165   3e-44   
ref|XP_006427985.1|  hypothetical protein CICLE_v10025385mg             166   3e-44   
ref|XP_011005604.1|  PREDICTED: cytochrome P450 86B1-like               166   4e-44   
ref|XP_010513495.1|  PREDICTED: cytochrome P450 86B1-like               160   4e-44   
ref|XP_003555023.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    165   4e-44   
gb|EPS57870.1|  hypothetical protein M569_16947                         165   5e-44   
dbj|BAJ89570.1|  predicted protein                                      165   6e-44   
ref|XP_006604019.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    165   6e-44   
emb|CBH32607.1|  cytochrome P450, putative, expressed                   165   6e-44   
gb|ABF93891.1|  Cytochrome P450 family protein                          165   7e-44   
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like               165   7e-44   
ref|XP_009113345.1|  PREDICTED: cytochrome P450 86B1-like               164   7e-44   
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like               164   7e-44   
emb|CDY39931.1|  BnaA09g15130D                                          164   9e-44   
emb|CDY58383.1|  BnaC09g51620D                                          164   1e-43   
ref|XP_009113349.1|  PREDICTED: cytochrome P450 86B1-like               164   1e-43   
emb|CDY71054.1|  BnaAnng35910D                                          159   2e-43   
ref|NP_175193.1|  cytochrome P450, family 96, subfamily A, polype...    164   2e-43   
ref|XP_006301804.1|  hypothetical protein CARUB_v10022270mg             163   2e-43   
emb|CDY29175.1|  BnaC09g15720D                                          163   2e-43   
ref|XP_006279822.1|  hypothetical protein CARUB_v10028124mg             164   2e-43   
gb|EMT22279.1|  Cytochrome P450 86A1                                    164   2e-43   
ref|XP_006404787.1|  hypothetical protein EUTSA_v10000131mg             163   2e-43   
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like               163   2e-43   
ref|XP_006651021.1|  PREDICTED: cytochrome P450 86B1-like               163   3e-43   
gb|EMS45869.1|  Cytochrome P450 86B1                                    163   3e-43   
gb|EMT10522.1|  Cytochrome P450 86A1                                    163   3e-43   
ref|XP_010474420.1|  PREDICTED: cytochrome P450 86A4-like               160   3e-43   
gb|EEC70068.1|  hypothetical protein OsI_00672                          155   3e-43   
ref|XP_010463248.1|  PREDICTED: cytochrome P450 86A8-like               155   4e-43   
ref|XP_004237152.1|  PREDICTED: cytochrome P450 86B1-like               162   4e-43   
ref|XP_010554710.1|  PREDICTED: cytochrome P450 86B1-like               162   5e-43   
gb|KFK38027.1|  hypothetical protein AALP_AA3G060700                    162   5e-43   
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...    162   5e-43
ref|NP_001042227.2|  Os01g0183500                                       155   5e-43   
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg             162   5e-43   
dbj|BAJ85246.1|  predicted protein                                      162   5e-43   
gb|EMS48808.1|  Cytochrome P450 86B1                                    161   6e-43   
emb|CDM86413.1|  unnamed protein product                                162   6e-43   
ref|XP_002322211.1|  hypothetical protein POPTR_0015s09840g             162   6e-43   
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                    162   6e-43   
gb|KDP35253.1|  hypothetical protein JCGZ_09412                         162   6e-43   
ref|XP_002894061.1|  CYP96A8                                            162   7e-43   
emb|CBH32604.1|  cytochrome P450, putative, expressed                   161   7e-43   
dbj|BAJ86572.1|  predicted protein                                      162   8e-43   
ref|XP_010473758.1|  PREDICTED: cytochrome P450 86B1-like               160   9e-43   
emb|CDY32582.1|  BnaC03g15500D                                          160   1e-42   
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like               161   1e-42   
ref|XP_009113348.1|  PREDICTED: cytochrome P450 86B1-like               161   1e-42   
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like               161   1e-42   
emb|CDX74502.1|  BnaA04g08870D                                          157   2e-42   
gb|KDP35251.1|  hypothetical protein JCGZ_09410                         160   2e-42   
ref|XP_010513569.1|  PREDICTED: cytochrome P450 86A2-like               157   2e-42   
ref|XP_009400990.1|  PREDICTED: cytochrome P450 86B1-like               156   2e-42   
ref|NP_179782.1|  cytochrome P450, family 96, subfamily A, polype...    160   2e-42   
ref|XP_006392373.1|  hypothetical protein EUTSA_v10023421mg             159   2e-42   
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                    160   2e-42   
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg             160   2e-42   
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg             160   3e-42   
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like               160   3e-42   
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100               160   3e-42   
ref|XP_006392374.1|  hypothetical protein EUTSA_v10023421mg             160   3e-42   
ref|XP_010531420.1|  PREDICTED: cytochrome P450 86B1-like               160   4e-42   
emb|CDX90338.1|  BnaA08g16460D                                          160   4e-42   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like               160   4e-42   
tpg|DAA43291.1|  TPA: putative cytochrome P450 superfamily protein      160   4e-42   
ref|XP_002894062.1|  CYP96A8                                            160   4e-42   
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg             160   5e-42   
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like               159   5e-42   
ref|NP_001048918.1|  Os03g0140200                                       153   5e-42   
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like               160   5e-42   
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like               160   5e-42   
gb|AIE57505.1|  MAH1                                                    159   6e-42   
emb|CDX72690.1|  BnaC07g47120D                                          159   6e-42   
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                    159   6e-42   
ref|XP_009139809.1|  PREDICTED: cytochrome P450 86B1-like               159   6e-42   
gb|KFK33109.1|  hypothetical protein AALP_AA6G332200                    159   6e-42   
ref|XP_006282428.1|  hypothetical protein CARUB_v100285721mg            155   6e-42   
ref|XP_006404644.1|  hypothetical protein EUTSA_v10000679mg             159   7e-42   
ref|XP_010555325.1|  PREDICTED: cytochrome P450 86B1-like               159   7e-42   
ref|XP_006282055.1|  hypothetical protein CARUB_v10028299mg             159   7e-42   
ref|XP_010442757.1|  PREDICTED: cytochrome P450 86B1-like               159   7e-42   
ref|XP_007019555.1|  Cytochrome P450                                    159   7e-42   
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                    159   8e-42   
ref|XP_006397210.1|  hypothetical protein EUTSA_v10029295mg             159   8e-42   
emb|CDY39035.1|  BnaA02g17240D                                          159   1e-41   
ref|XP_009128105.1|  PREDICTED: cytochrome P450 86B1-like               159   1e-41   
gb|EMS50674.1|  Cytochrome P450 86B1                                    159   1e-41   
ref|XP_010444711.1|  PREDICTED: cytochrome P450 86B1-like               159   1e-41   
ref|XP_009117361.1|  PREDICTED: cytochrome P450 86B1                    159   1e-41   
ref|XP_002307182.1|  cytochrome P450 family protein                     158   1e-41   
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like               158   2e-41   
ref|XP_003558845.1|  PREDICTED: cytochrome P450 86B1-like               158   2e-41   
emb|CDX79038.1|  BnaA01g11050D                                          157   2e-41   
ref|NP_001141467.1|  uncharacterized protein LOC100273577               158   2e-41   
gb|EAY88479.1|  hypothetical protein OsI_09950                          158   2e-41   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like               158   2e-41   
ref|XP_006280314.1|  hypothetical protein CARUB_v10026237mg             158   2e-41   
ref|XP_002865881.1|  hypothetical protein ARALYDRAFT_331566             157   2e-41   
gb|EAY88475.1|  hypothetical protein OsI_09946                          157   3e-41   
ref|XP_006649381.1|  PREDICTED: cytochrome P450 86B1-like               158   3e-41   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522             157   3e-41   
emb|CDY53177.1|  BnaA06g40560D                                          157   3e-41   
gb|ABF93896.1|  Cytochrome P450 family protein, expressed               157   3e-41   
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                    157   3e-41   
ref|NP_200045.1|  cytochrome P450, family 96, subfamily A, polype...    157   4e-41   
ref|XP_009134418.1|  PREDICTED: cytochrome P450 86B1-like               157   4e-41   
ref|XP_006651022.1|  PREDICTED: cytochrome P450 86B1-like               157   4e-41   
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like               157   4e-41   
gb|KDP35254.1|  hypothetical protein JCGZ_09413                         157   5e-41   
ref|XP_006294050.1|  hypothetical protein CARUB_v10023041mg             157   5e-41   
ref|XP_007019556.1|  Cytochrome P450                                    157   5e-41   
ref|XP_010482588.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    157   5e-41   
ref|XP_006411748.1|  hypothetical protein EUTSA_v10026837mg             152   5e-41   
ref|XP_009109465.1|  PREDICTED: cytochrome P450 86B1-like               157   5e-41   
ref|XP_002878579.1|  CYP96A5                                            157   5e-41   
ref|XP_010479164.1|  PREDICTED: cytochrome P450 86B1                    157   6e-41   
ref|XP_006405350.1|  hypothetical protein EUTSA_v10027722mg             157   7e-41   
ref|XP_010482535.1|  PREDICTED: cytochrome P450 86B1-like               157   7e-41   
ref|XP_009614109.1|  PREDICTED: cytochrome P450 86B1-like               155   7e-41   
emb|CDX72693.1|  BnaC07g47150D                                          156   7e-41   
ref|XP_010431923.1|  PREDICTED: cytochrome P450 86B1-like               156   7e-41   
ref|XP_010416946.1|  PREDICTED: cytochrome P450 86B1-like               156   8e-41   
ref|XP_009400643.1|  PREDICTED: cytochrome P450 86B1-like               156   8e-41   
ref|XP_009101869.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    155   9e-41   
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like               156   1e-40   
gb|EMT14219.1|  Cytochrome P450 86A2                                    156   1e-40   
ref|XP_009107985.1|  PREDICTED: cytochrome P450 86B1-like               156   1e-40   
ref|XP_010417232.1|  PREDICTED: cytochrome P450 86A8-like               148   1e-40   
gb|ABF93892.1|  Cytochrome P450 family protein                          156   1e-40   
ref|XP_009101867.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    156   1e-40   
ref|XP_002465889.1|  hypothetical protein SORBIDRAFT_01g047640          156   1e-40   
ref|XP_010444890.1|  PREDICTED: cytochrome P450 86A8-like               151   1e-40   
ref|XP_002868909.1|  CYP96A12                                           155   1e-40   
ref|XP_007031595.1|  Cytochrome P450, putative                          155   1e-40   
emb|CDY53178.1|  BnaA06g40570D                                          155   1e-40   
dbj|BAA99522.1|  putative cytochrome P450                               155   2e-40   
ref|XP_010446498.1|  PREDICTED: cytochrome P450 86B1-like               155   2e-40   
emb|CDX90336.1|  BnaA08g16480D                                          155   2e-40   
dbj|BAC42841.1|  putative cytochrome P450                               155   2e-40   
emb|CDX76962.1|  BnaC08g35480D                                          155   3e-40   
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg             155   3e-40   
ref|XP_011022068.1|  PREDICTED: cytochrome P450 86B1-like               155   3e-40   
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...    155   3e-40   
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    154   4e-40   
emb|CDX82804.1|  BnaC01g12540D                                          154   4e-40   
ref|XP_003568803.1|  PREDICTED: cytochrome P450 86B1-like               154   4e-40   
gb|ABF93894.1|  Cytochrome P450 family protein, expressed               154   4e-40   
ref|XP_009795080.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    150   4e-40   
ref|XP_006281509.1|  hypothetical protein CARUB_v10027607mg             148   4e-40   
gb|EMT29854.1|  Cytochrome P450 86A2                                    154   5e-40   
ref|XP_009389287.1|  PREDICTED: cytochrome P450 86B1-like               154   5e-40   
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like               154   5e-40   
gb|EAY88477.1|  hypothetical protein OsI_09948                          154   6e-40   
ref|XP_007019638.1|  Cytochrome P450                                    153   9e-40   
gb|KJB47429.1|  hypothetical protein B456_008G026100                    153   9e-40   
ref|XP_002865907.1|  CYP96A4                                            153   1e-39   
emb|CDY66735.1|  BnaC03g60620D                                          153   1e-39   
ref|XP_009795074.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    150   1e-39   
ref|XP_010437072.1|  PREDICTED: cytochrome P450 86B1-like               153   1e-39   
emb|CDX90337.1|  BnaA08g16470D                                          153   1e-39   
ref|XP_003558844.1|  PREDICTED: cytochrome P450 86B1-like               153   1e-39   
ref|XP_006287519.1|  hypothetical protein CARUB_v10000726mg             153   1e-39   
gb|KJB80246.1|  hypothetical protein B456_013G088800                    152   2e-39   
ref|XP_007041219.1|  Cytochrome P450, putative                          152   2e-39   
emb|CDY70657.1|  BnaAnng34520D                                          144   2e-39   
gb|AHF22086.1|  CYP96A68                                                152   2e-39   
ref|XP_009109462.1|  PREDICTED: cytochrome P450 86B1-like               152   2e-39   
ref|XP_006283573.1|  hypothetical protein CARUB_v10004625mg             152   2e-39   
ref|XP_006405689.1|  hypothetical protein EUTSA_v10028261mg             152   2e-39   
gb|AFW89633.1|  putative cytochrome P450 superfamily protein            152   3e-39   
gb|AFG63156.1|  hypothetical protein 2_7870_01                          143   3e-39   
emb|CDY42628.1|  BnaC01g00400D                                          152   3e-39   
dbj|BAK06179.1|  predicted protein                                      152   3e-39   
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like               152   3e-39   
gb|KJB71270.1|  hypothetical protein B456_011G113900                    152   4e-39   
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like               152   4e-39   
gb|EMS50899.1|  Cytochrome P450 86B1                                    152   4e-39   
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                    151   4e-39   
ref|XP_004968445.1|  PREDICTED: cytochrome P450 86B1-like               151   4e-39   
gb|EMT17849.1|  Cytochrome P450 86A2                                    151   5e-39   
ref|XP_002312417.2|  cytochrome P450 family protein                     151   5e-39   
ref|XP_010513571.1|  PREDICTED: cytochrome P450 86B1-like               151   5e-39   
ref|XP_002465888.1|  hypothetical protein SORBIDRAFT_01g047630          151   5e-39   
gb|KFK43173.1|  hypothetical protein AALP_AA1G089200                    153   5e-39   
gb|EMT16734.1|  Cytochrome P450 704C1                                   149   6e-39   
dbj|BAK07250.1|  predicted protein                                      151   6e-39   
emb|CDY44658.1|  BnaA08g06820D                                          150   8e-39   
ref|XP_010482590.1|  PREDICTED: cytochrome P450 86B1-like isoform X3    150   1e-38   
ref|XP_004985762.1|  PREDICTED: cytochrome P450 86B1-like               150   2e-38   
ref|XP_009351729.1|  PREDICTED: cytochrome P450 86B1-like               150   2e-38   
ref|XP_009109463.1|  PREDICTED: cytochrome P450 86B1-like               150   2e-38   
gb|EMS49628.1|  Cytochrome P450 86B1                                    150   2e-38   
gb|KJB47427.1|  hypothetical protein B456_008G025900                    149   2e-38   
gb|KCW62197.1|  hypothetical protein EUGRSUZ_H04855                     145   2e-38   
ref|XP_011022663.1|  PREDICTED: cytochrome P450 86B1-like               149   2e-38   
gb|EMS50900.1|  Cytochrome P450 86B1                                    149   2e-38   
ref|XP_002439386.1|  hypothetical protein SORBIDRAFT_09g005590          150   2e-38   
ref|XP_011025646.1|  PREDICTED: cytochrome P450 86B1-like               149   2e-38   
ref|XP_010473744.1|  PREDICTED: cytochrome P450 86B1-like               149   3e-38   
ref|XP_004960856.1|  PREDICTED: cytochrome P450 86B1-like               149   3e-38   
gb|EMT17850.1|  Cytochrome P450 86A1                                    149   3e-38   
ref|XP_007042368.1|  Cytochrome P450-like protein                       149   3e-38   
ref|XP_009402197.1|  PREDICTED: cytochrome P450 86B1-like               149   3e-38   
ref|XP_010446497.1|  PREDICTED: cytochrome P450 86B1-like               149   4e-38   
ref|XP_006412935.1|  hypothetical protein EUTSA_v10027133mg             148   5e-38   
ref|XP_003564427.1|  PREDICTED: cytochrome P450 86B1-like               148   6e-38   
ref|XP_010269253.1|  PREDICTED: cytochrome P450 86B1-like               148   6e-38   



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EEC KLVYLH ALCE+ RLFPP+AI+HKVS  MDVLPSGHLVKPNTR+IL FYSSGRMD
Sbjct  372  LEECHKLVYLHAALCETLRLFPPLAIQHKVSTAMDVLPSGHLVKPNTRIILLFYSSGRMD  431

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWGEDCMEFKPERWIS  GRIKHEPSYKFPAFNAGPRTCLGKEM  VQMKMIAAIILHH
Sbjct  432  SIWGEDCMEFKPERWISGNGRIKHEPSYKFPAFNAGPRTCLGKEMSFVQMKMIAAIILHH  491

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            YEFQVVDSHSVSPSDSIIIQAKHGLKVKFTKR+
Sbjct  492  YEFQVVDSHSVSPSDSIIIQAKHGLKVKFTKRS  524



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KL+YLHGALCES RLFPPVA+EHK     D LPSG+ ++PNT++I+SFYS+GRM+
Sbjct  350  VEESRKLIYLHGALCESLRLFPPVALEHKAPIAPDTLPSGNYLEPNTKIIVSFYSTGRME  409

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EFKPERWIS  G  KHEPSYKFPAFNAGPRTCLGKEM  VQMKM+AA I++H
Sbjct  410  SVWGKDCLEFKPERWISKGGGTKHEPSYKFPAFNAGPRTCLGKEMAFVQMKMVAAAIIYH  469

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y  Q+V+ H V+PSDS+I+QAKHGLKV+  +RN 
Sbjct  470  YNLQLVEDHPVTPSDSVILQAKHGLKVRLFRRNV  503



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLH ALCE+ RLFP V++EHKVS   D+LPSGH V PNTR++LSFY+ GRM+
Sbjct  358  IEETRKLVYLHCALCETLRLFPSVSLEHKVSLEFDILPSGHRVNPNTRIVLSFYTMGRME  417

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWG+DC+EFKPERWIS +G+IKHEPS+KFPAFNAGPRTCLGKEM L+QMKMIAA I++ 
Sbjct  418  NIWGKDCLEFKPERWISEQGKIKHEPSFKFPAFNAGPRTCLGKEMALIQMKMIAATIIYS  477

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  Q++++ ++SPS SII+Q KHGLKV+  KR
Sbjct  478  YHIQLMEAQTISPSASIIVQMKHGLKVRIVKR  509



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE ++LVYLHGALCE+ R FP VAIEHK+    D+LPSGH V PNTR++LSFY+ GRM+
Sbjct  359  IEETKRLVYLHGALCETLRFFPSVAIEHKLPLEFDILPSGHHVSPNTRVVLSFYTMGRME  418

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPSYKFPAFNAGPRTC+GKEM  +QMK++AA I+++
Sbjct  419  SIWGKDCLEFKPERWISERGGIKHEPSYKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYN  478

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  Q+ +   + P+ S+IIQ KHGLKV+  KR
Sbjct  479  YHIQLGEDQIILPNSSVIIQMKHGLKVRLVKR  510



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KL+YLH ALCE+ RLFP V++EHKV    D+LPSGH V PNTR++LSFY+ GRM+
Sbjct  358  IEETRKLIYLHAALCETLRLFPSVSLEHKVPLESDILPSGHRVNPNTRIVLSFYTMGRME  417

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWG+DC+EFKPERWIS KG+IKHEPS+KFPAFNAGPRTCLGKEM  +QMKM+ A I+H 
Sbjct  418  TIWGKDCLEFKPERWISEKGKIKHEPSFKFPAFNAGPRTCLGKEMAFIQMKMMVATIIHS  477

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  Q+V+  ++SPS SII+Q KHGLKV+  KR
Sbjct  478  YHIQLVEGQTISPSASIIVQMKHGLKVRLFKR  509



>gb|EYU32453.1| hypothetical protein MIMGU_mgv1a005630mg [Erythranthe guttata]
Length=476

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 130/156 (83%), Gaps = 3/156 (2%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KL+YLHGALCES RLFPPVA+EHK     D+LPSG+ +KPNT++I+SFYS+GRM+
Sbjct  320  VEESRKLIYLHGALCESLRLFPPVALEHKAPIEPDILPSGNQLKPNTKVIVSFYSTGRME  379

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EFKPERWIS  GR KHEPSYKFPAFNAGPRTCLGKEM   QMKM+AA I++ 
Sbjct  380  SVWGKDCLEFKPERWISDSGRTKHEPSYKFPAFNAGPRTCLGKEMAFAQMKMVAATIIYR  439

Query  289  YEFQvvd---shsvspsdsiiIQAKHGLKVKFTKRN  191
            Y+ ++++      VSP DSII+QAKHGLKV+ + RN
Sbjct  440  YKIELLEGRGYPVVSPRDSIILQAKHGLKVRLSTRN  475



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE  KL+YLHGALCES RLFPPVA+EHK     D+LPSGH +  N ++I SFYS GRM+
Sbjct  339  VEESHKLIYLHGALCESLRLFPPVALEHKAPTKPDILPSGHYLPANAKLIFSFYSVGRME  398

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            ++WG+DC+EF+P+RWI+  GRIKHEPSYKFPAFN GPRTCLGKEM  +QMKM+AA I++H
Sbjct  399  TVWGKDCLEFRPDRWIAPGGRIKHEPSYKFPAFNVGPRTCLGKEMAFIQMKMVAAAIIYH  458

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y  ++V+ + VSP  SII+QAK GLKV+ TKR+
Sbjct  459  YRIELVEGNQVSPRVSIILQAKPGLKVRLTKRD  491



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ R FP VAIEHK+    D+LPSGH V PNTR++LSFY+ GRM+
Sbjct  345  IEEARKLVYLHGALCETLRFFPSVAIEHKLPLEFDILPSGHHVSPNTRVVLSFYTMGRME  404

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPSYKFPAFNAGPRTC+GKEM  +QMK++AA I+++
Sbjct  405  SIWGKDCLEFKPERWISERGGIKHEPSYKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYN  464

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  + ++   + P+ S+IIQ KHGLKV+  KR
Sbjct  465  YHIK-LEDQIILPNSSVIIQMKHGLKVRLVKR  495



>gb|EYU27551.1| hypothetical protein MIMGU_mgv1a027070mg [Erythranthe guttata]
Length=508

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE+  KLVYLHGALCES RLFPPVA+EHK     D LPSG  VK N ++I+ FYS+GRM+
Sbjct  355  VEDSHKLVYLHGALCESLRLFPPVALEHKAPIQPDNLPSGDYVKSNAKVIVCFYSTGRME  414

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EFKPERWIS+ G IKHEPSYKFPAFNAGPRTCLGK+M  VQMKM+AA I++H
Sbjct  415  SVWGKDCLEFKPERWISASGGIKHEPSYKFPAFNAGPRTCLGKQMAFVQMKMLAATIVYH  474

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y+ ++V+ H V+P DS+I+ AK+GLKV  +KRN 
Sbjct  475  YKIELVEGHVVAPRDSVILHAKNGLKVTLSKRNV  508



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE +KLVYLH A CE+ R FP V++EHKV    D+LPSGH V P TRMI+ FYS GRM++
Sbjct  359  EETRKLVYLHAAFCETLRFFPSVSLEHKVPLEHDILPSGHRVTPKTRMIIPFYSMGRMET  418

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC+EFKPERWIS +G IKHEPS+KFPAFNAGPRTC+GKEM  VQMK++AAIIL++Y
Sbjct  419  IWGKDCLEFKPERWISERGGIKHEPSFKFPAFNAGPRTCIGKEMAFVQMKIVAAIILYNY  478

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + Q+V++ + SP+ SII+Q KHGL V+  KR
Sbjct  479  DIQLVEAQNSSPTTSIIMQMKHGLMVRVVKR  509



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE +KLVYLH A CE+ R FP V++EHKV    D+LPSGH V P TRMI+ FYS GRM++
Sbjct  359  EETRKLVYLHAAFCETLRFFPSVSLEHKVPLEHDILPSGHRVTPKTRMIIPFYSMGRMET  418

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC+EFKPERWIS +G IKHEPS+KFPAFNAGPRTC+GKEM  VQMK++AAIIL++Y
Sbjct  419  IWGKDCLEFKPERWISERGGIKHEPSFKFPAFNAGPRTCIGKEMAFVQMKIVAAIILYNY  478

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + Q+V++ + SP+ SII+Q KHGL V+  KR
Sbjct  479  DIQLVEAQNSSPTTSIIMQMKHGLMVRVVKR  509



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 128/156 (82%), Gaps = 3/156 (2%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE ++L+YLHGALCES RLFPPVA+EHK     D LPSG  VK N ++I+SFYS+GRM+
Sbjct  356  VEESRRLIYLHGALCESLRLFPPVALEHKAPIQPDNLPSGDYVKSNAKVIVSFYSTGRME  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EFKPERWIS+ G IKHEPSYKFPAFNAGPRTCLGKEM   QMKM+AA I++ 
Sbjct  416  SVWGKDCLEFKPERWISASGGIKHEPSYKFPAFNAGPRTCLGKEMAFAQMKMVAATIIYR  475

Query  289  YEFQvvd---shsvspsdsiiIQAKHGLKVKFTKRN  191
            Y+ ++++      VSP DSII+QAKHGLKV+ ++RN
Sbjct  476  YKIELLEGGGYPVVSPRDSIILQAKHGLKVRLSRRN  511



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KLVYLHGALCE+ R FP VAIEHK+    D+LPSGH V PN R++LS Y+ GRM+
Sbjct  359  IQETRKLVYLHGALCETLRFFPSVAIEHKLPHDFDILPSGHHVSPNMRIVLSLYTMGRME  418

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWGEDC+EFKPERWIS +G IKHEPS+KF AFNAGPRTC+GKEM  +QMK++AA I+++
Sbjct  419  SIWGEDCLEFKPERWISKRGGIKHEPSFKFSAFNAGPRTCIGKEMAFIQMKIVAATIIYN  478

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  Q+ +   +SPS SIIIQ KHGLKV+  KR
Sbjct  479  YHIQLGEDQIISPSASIIIQMKHGLKVRLVKR  510



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFP VAIEHK+    D+LPSGH V PNTR++LSFY+ GRM+
Sbjct  359  IEEARKLVYLHGALCETLRLFPSVAIEHKLPLEFDLLPSGHRVSPNTRVVLSFYTMGRME  418

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPS+KFPAFNAGPRTC+GKEM  +QMK++AA I+++
Sbjct  419  SIWGKDCLEFKPERWISERGGIKHEPSFKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYN  478

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y +  ++   + P+ S+IIQ K+GLKV+  KR
Sbjct  479  Y-YIKLEDQIILPNSSVIIQMKNGLKVRVFKR  509



>gb|AJD25225.1| cytochrome P450 CYP96A85 [Salvia miltiorrhiza]
Length=502

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             +E  KLVYLHGALCES RLFPPVA+EHK     D LPSGH +  + ++I+SFYS GRM+
Sbjct  341  AQESHKLVYLHGALCESLRLFPPVALEHKAPVRADNLPSGHHLPRDAKLIISFYSVGRME  400

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EFKPERWIS  G+IKHE SYKFPAFNAGPRTCLGKEM  VQMKM+AA I+  
Sbjct  401  SVWGKDCLEFKPERWISGSGKIKHEASYKFPAFNAGPRTCLGKEMAFVQMKMVAAAIICD  460

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y+ Q+V+ H VSP DS+I+QAKHGLKVK ++RN
Sbjct  461  YQVQLVEGHPVSPRDSVILQAKHGLKVKLSRRN  493



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE +KL+YLHGALCE+ RLFP V++EHKV    D+LPSGH V P TRMIL FY  GRM++
Sbjct  357  EESRKLIYLHGALCETLRLFPSVSLEHKVPLDHDILPSGHRVSPKTRMILPFYVMGRMET  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG+DC+EFKPERWIS +G IKHEPS+KFPAFNAGPRTCLGKEM  VQMK+++AII+H+Y
Sbjct  417  LWGKDCLEFKPERWISERGGIKHEPSFKFPAFNAGPRTCLGKEMAFVQMKIVSAIIIHNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              QVV+  +V P+ SII+Q K+GL V   K+
Sbjct  477  NIQVVEPENVYPTTSIIMQVKNGLMVNVVKK  507



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE +KL+YLHGALCE+ RL+P V++EHKV    D+LP+GH V P TRMIL FY  GRM++
Sbjct  357  EESRKLIYLHGALCETLRLYPSVSLEHKVPLDHDILPTGHRVSPKTRMILPFYVMGRMET  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG+DC+EFKPERWIS +G IKHEPS+KFPAFNAGPRTCLGKEM  +QMK++AA I+H+Y
Sbjct  417  LWGKDCLEFKPERWISERGGIKHEPSFKFPAFNAGPRTCLGKEMAFIQMKIVAATIIHNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              QVV+  +V P+ SII+Q K+GL VK  KR
Sbjct  477  NIQVVEPQNVYPTTSIIMQVKNGLMVKVVKR  507



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV+IEHK    +DVLPSGH V P+ ++++SFY+ GRM 
Sbjct  355  IEESRKLVYLHGALCEALRLFPPVSIEHKAPLELDVLPSGHRVTPDMKILISFYTMGRMQ  414

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            ++WG+DC+EFKPERWIS +G IKH PSY+FPAFNAGPRTC+GK+MG +QMKM+AA I+++
Sbjct  415  TLWGKDCLEFKPERWISERGGIKHVPSYQFPAFNAGPRTCIGKDMGFIQMKMVAATIVYN  474

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  Q+V+  ++SP+ +++I+  +GLKV+  KR
Sbjct  475  YHIQLVEGQAISPTATVVIRMTNGLKVRVVKR  506



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KLVYLH A CE+ RLFP VAIEHK+    D+LPSGH V PNTR++LSFY+ GRM+
Sbjct  345  IQETRKLVYLHAAFCETLRLFPSVAIEHKLPLEFDILPSGHRVSPNTRVMLSFYTMGRME  404

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EFKPERWIS +G IKHEPS+KF AFNAGPR C+GKEM   QMK++AA I+H+
Sbjct  405  SLWGKDCLEFKPERWISKRGEIKHEPSFKFTAFNAGPRACIGKEMAFTQMKIVAATIIHN  464

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y  Q V+   +SPS S+IIQ KHGLKV+  KR T
Sbjct  465  YHIQ-VEDQIISPSSSVIIQVKHGLKVRLIKRVT  497



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KLVYLHGALCE+ RLFPPV+IEHK    +DVLPSGH V PNT++++SFY+ GRM+
Sbjct  359  IQESRKLVYLHGALCEALRLFPPVSIEHKSPLQLDVLPSGHRVSPNTKILISFYTMGRME  418

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EF+PERWI+ +G +KHEPSYKFPAF AGPRTC+GKEM  +QMKM+AA ++H+
Sbjct  419  SLWGKDCLEFRPERWITERGGLKHEPSYKFPAFLAGPRTCVGKEMAFIQMKMVAATMIHN  478

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  Q+V++ ++SP+ +++I+  +GL VK  K+
Sbjct  479  YNIQLVEAQTISPTATVVIRMTNGLMVKVGKK  510



>emb|CDP18605.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V++  KLVYLH ALCE+ RL+PPVA+EHK      +LPSG  V+PNT++IL FYS GRM+
Sbjct  279  VQQSHKLVYLHAALCEALRLYPPVALEHKAPVQAVILPSGVRVEPNTKLILFFYSMGRME  338

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WGEDC+EFKPERWIS +GR++HEPS+KFPAFNAGPRTCLGKEM  VQMKM+AA I+++
Sbjct  339  SLWGEDCLEFKPERWISERGRVRHEPSFKFPAFNAGPRTCLGKEMAFVQMKMVAASIIYN  398

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y  +VVD H +SPSDSIIIQ K GL V+  +RN
Sbjct  399  YHVRVVDGHPISPSDSIIIQMKQGLMVRLFQRN  431



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV++EHK    +DVLPSGH V P+ ++++SFY+ GR+ 
Sbjct  356  IEESRKLVYLHGALCEALRLFPPVSLEHKSPLELDVLPSGHRVTPDMKILISFYTMGRLQ  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWG+DC+EFKPERWIS +  IKH PSY+FPAFNAGPRTC+GK+MG +QMKM+AA I+++
Sbjct  416  TIWGKDCLEFKPERWISERRGIKHVPSYQFPAFNAGPRTCIGKDMGFIQMKMVAATIIYN  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y  Q+V+  ++SP+ +++I+  +GLKV+  KR+ 
Sbjct  476  YHIQLVEGQTISPTATVVIRMTNGLKVRVVKRDV  509



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV+IEHK    +DVLPSGH V PN ++++SFY+ GRM+
Sbjct  356  IEESRKLVYLHGALCEALRLFPPVSIEHKSPLKLDVLPSGHRVSPNMKILISFYTMGRME  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EF+PERWI+ +G +KHEPSYKFPAF AGPRTC+GKEM  +QMKM+AA ++++
Sbjct  416  SLWGKDCLEFRPERWITERGGLKHEPSYKFPAFLAGPRTCVGKEMAFIQMKMVAATMIYN  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  Q++++ ++SP+ +++I+  +GL  K  KR
Sbjct  476  YNIQLLEAQTISPTATVVIRMTNGLMAKVVKR  507



>ref|XP_008441106.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
melo]
Length=513

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE +KLVY HGALCE+ RL+P V  +HKV +  D+LPSGH V PNT+++ S Y+ GRM  
Sbjct  360  EELKKLVYFHGALCETLRLYPVVPFQHKVPSKPDILPSGHRVDPNTKILFSLYALGRMSD  419

Query  466  IWGEDCMEFKPERWISSK-GRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +WGEDCMEFKPERWI+SK G+IKHEPSYKF AFNAGPRTCLGKE+  ++MK++AA ILH+
Sbjct  420  VWGEDCMEFKPERWINSKNGKIKHEPSYKFLAFNAGPRTCLGKEVAFIEMKLLAAAILHN  479

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            +       H V  + SII+Q KHG KVK TKR T
Sbjct  480  FNITRQTEHEVVSNASIILQMKHGFKVKVTKRWT  513



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE  KLVYLHGALCE+ R FP +++EHKV    D+LPSGH V P T+MI+ FY+ GRM++
Sbjct  357  EEMLKLVYLHGALCETLRFFPSLSLEHKVPLAHDILPSGHHVTPKTKMIIPFYTMGRMET  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+D +EFKPERWIS +G+IKHEPS+KFPAFNAGPRTC+GK M   Q+K++AA I+H+Y
Sbjct  417  IWGKDYLEFKPERWISEQGKIKHEPSFKFPAFNAGPRTCIGKNMAFTQLKIVAATIIHNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              Q+V++ ++SP+ SII+  KHGLKV+  KR
Sbjct  477  HIQLVEAQNISPTTSIIMLVKHGLKVRVVKR  507



>gb|EYU33779.1| hypothetical protein MIMGU_mgv1a018283mg [Erythranthe guttata]
Length=454

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLH  LCES RLFPP+A+E+K     D LPSGH V  N+++++SFY+ GR +
Sbjct  301  IEESKKLVYLHACLCESLRLFPPLALEYKSPIESDTLPSGHFVSRNSKVVISFYTVGRSE  360

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC+EFKPERWI+ +G IKHEPSYKFPAFN GPRTCLGKEM  +QMKM+AA I++ 
Sbjct  361  SVWGKDCLEFKPERWITPRGGIKHEPSYKFPAFNVGPRTCLGKEMSFIQMKMVAATIVYR  420

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y  ++VD H V P DS+++ AK+GLKV+  +RN 
Sbjct  421  YRVRLVDGHLVVPRDSLMLHAKNGLKVRLFERNV  454



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE  KLVYLHGALCE+ R FP +++EHKV    D+LPSGH V P TR+I+ FYS+GRM++
Sbjct  357  EEMLKLVYLHGALCETLRFFPSLSLEHKVPLAHDILPSGHHVTPKTRLIIPFYSTGRMET  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+D +EFKPERWIS +G IKHEPS+KFPAFNAGPRTC+GK M    +K++AA I+H+Y
Sbjct  417  IWGKDYLEFKPERWISERGGIKHEPSFKFPAFNAGPRTCIGKNMAFTHLKIVAATIIHNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              Q+V++ ++SP+ SII+  KHGLKV+  KR
Sbjct  477  HIQLVEAQNISPTTSIIMLVKHGLKVRVVKR  507



>gb|EYU33778.1| hypothetical protein MIMGU_mgv1a020242mg [Erythranthe guttata]
Length=458

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +E+ +KLVYLH  LCES RLFPP+A+E+K     D+LPSGH V+ N+++++SFY+ GR +
Sbjct  305  IEKSKKLVYLHACLCESLRLFPPLALEYKSPIESDILPSGHFVRRNSKVVISFYTVGRTE  364

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG DC+EFKPERWI+ +G IKHEPSYKFPAFN GPRTCLGKEM  +QMKM+AA I++ 
Sbjct  365  SVWGGDCLEFKPERWITPRGGIKHEPSYKFPAFNVGPRTCLGKEMSFIQMKMVAATIVYR  424

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y  ++VD HSV P DS+++ AK+GL V+ + RN 
Sbjct  425  YRVRLVDGHSVIPRDSLMLHAKNGLMVRLSYRNV  458



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 123/158 (78%), Gaps = 4/158 (3%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E ++LVYLHGALCES RLFPP+ +EHK++   D+LPSGH + P  R+ILSFY+ GRM+
Sbjct  376  VQESRELVYLHGALCESLRLFPPIPLEHKIATETDILPSGHHLCPGKRVILSFYTMGRME  435

Query  469  SIWGEDCMEFKPERWIS-SKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
            ++WG DC++FKPERWIS  +G+IKHEPS+KFP FNAGPRTCLGK++   QMKM+AA I+ 
Sbjct  436  TLWGNDCLDFKPERWISGGRGKIKHEPSFKFPVFNAGPRTCLGKDISFFQMKMVAATIIF  495

Query  292  HYEFQvvd---shsvspsdsiiIQAKHGLKVKFTKRNT  188
            +Y+ Q+V+       S S  + ++ KHGLKV+  +R++
Sbjct  496  NYQVQLVEGQHLDFPSASILLQLKMKHGLKVRLIQRSS  533



>gb|KGN48434.1| hypothetical protein Csa_6G487550 [Cucumis sativus]
Length=509

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE  KLVY HG+LCES RL+PPV + HKV+   D+LPSGH +KP T+++LS Y+ GRM 
Sbjct  356  IEEVDKLVYFHGSLCESLRLYPPVPVNHKVAVQPDILPSGHHIKPKTKILLSIYALGRMS  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             +WG+DC+EFKPERWIS  G+IKH PSYKF +FNAGPRTCLGK++   ++K++AA I+H+
Sbjct  416  DVWGKDCLEFKPERWISENGKIKHFPSYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHN  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y       H V P  S+++  KHG KVK TKR T
Sbjct  476  YNIIQQTGHQVIPKTSVVLHMKHGFKVKVTKRWT  509



>ref|XP_004173396.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE  KLVY HG+LCES RL+PPV + HKV+   D+LPSGH +KP T+++LS Y+ GRM 
Sbjct  356  IEEVDKLVYFHGSLCESLRLYPPVPVNHKVAVQPDILPSGHHIKPKTKILLSIYALGRMS  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             +WG+DC+EFKPERWIS  G+IKH PSYKF +FNAGPRTCLGK++   ++K++AA I+H+
Sbjct  416  DVWGKDCLEFKPERWISENGKIKHFPSYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHN  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y       H V P  S+++  KHG KVK TKR T
Sbjct  476  YNIIQQTGHQVIPKTSVVLHMKHGFKVKVTKRWT  509



>ref|XP_004142037.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE  KLVY HG+LCES RL+PPV + HKV+   D+LPSGH +KP T+++ S Y+ GRM 
Sbjct  356  IEEVDKLVYFHGSLCESLRLYPPVPVNHKVAVQPDILPSGHHIKPKTKIVFSLYALGRMS  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             +WG+DC+EFKPERWIS  G+IKH PSYKF +FNAGPRTCLGK++   ++K++AA I+H+
Sbjct  416  DVWGKDCLEFKPERWISENGKIKHFPSYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHN  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y       H V P  S+++  KHG KVK TKR T
Sbjct  476  YNIIQQTGHQVIPKTSVVLHMKHGFKVKVTKRWT  509



>gb|KDP35260.1| hypothetical protein JCGZ_09419 [Jatropha curcas]
Length=506

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E   LVYLH ALCES RL+PPV  +HK     DVLPSGH V P  +++   YS GRM 
Sbjct  353  VQEVNSLVYLHAALCESLRLYPPVPFQHKSPLQNDVLPSGHEVSPEMKIVFCLYSMGRMA  412

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWGEDC+EFKPERWIS  G+IKHEPSYKF AFNAGPRTCLGKE+   QMK++AA ILH+
Sbjct  413  SIWGEDCLEFKPERWISGGGKIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKIVAASILHN  472

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  +VV+ H V+PS SII+  KHGLKV  ++R
Sbjct  473  YNVKVVEDHPVTPSASIILHMKHGLKVNVSRR  504



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E  KLVYLHGALC+S RL+PPV  +HK     D+LPSGH V P  +++ S Y+ GRM+
Sbjct  353  VQELNKLVYLHGALCDSLRLYPPVPFQHKEPLEEDILPSGHKVHPKLKIMFSLYAMGRME  412

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+
Sbjct  413  SIWGKDCLEFKPERWISERGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHN  472

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y+ ++V  H V P+ SII+  +HG KVK  KR T
Sbjct  473  YQVELVKGHIVEPNASIILYMRHGFKVKINKRWT  506



>ref|XP_006374652.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52449.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCES RL+PP+  E K     D+LPSGH V P T+++ S Y+ GRM 
Sbjct  353  IEEIKKLVYLHGALCESLRLYPPIHSEFKSPVRQDILPSGHRVNPKTKIVFSLYAMGRMS  412

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC EFKPERWI+ +G +KHEPSYKF +FNAGPRTCLGK++   QMK + A I+++
Sbjct  413  SVWGDDCFEFKPERWITDRGGMKHEPSYKFFSFNAGPRTCLGKDVAFTQMKAVVAAIIYN  472

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+ QVVD H+V+PS S+I+  KHG+KVK TKR
Sbjct  473  YQVQVVDEHTVTPSQSVILHMKHGMKVKLTKR  504



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E  KLVYLHGALC+S RL+PPV  +HK     D+LPSGH V P  +++ S Y+ GRM+
Sbjct  352  VQELNKLVYLHGALCDSLRLYPPVPFQHKEPLEEDILPSGHKVHPKLKIMFSLYAMGRME  411

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+
Sbjct  412  SIWGKDCLEFKPERWISERGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHN  471

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y+ ++V  H V P+ SII+  +HG KV+  KR T
Sbjct  472  YQVELVKGHIVEPNASIILYMRHGFKVRINKRWT  505



>ref|XP_010027331.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62195.1| hypothetical protein EUGRSUZ_H04853 [Eucalyptus grandis]
Length=507

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E    +VYLHGALCES RL+PP+  EHK     DVLPSGH V P+T++++  Y+ GRM S
Sbjct  355  EHVHNMVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVNPSTKILILLYAMGRMKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EF+PERWIS +G I+HEPSYKF AFNAGPRTCLGKE+   QMKMIAA ++++Y
Sbjct  415  VWGEDCFEFRPERWISERGGIRHEPSYKFLAFNAGPRTCLGKEVAFTQMKMIAAAMIYNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  +V+SH V PS+SII+  KHGL+VKF +R
Sbjct  475  EVHLVESHPVRPSNSIILHIKHGLRVKFARR  505



>ref|XP_010027339.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62202.1| hypothetical protein EUGRSUZ_H04860 [Eucalyptus grandis]
Length=507

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E    +VYLHGALCES RL+PP+  EHK     DVLPSGH V P+T++++  Y+ GRM S
Sbjct  355  EHVHNMVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVNPSTKILILLYAMGRMKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EF+PERWIS +G I+HEPSYKF AFNAGPRTCLGKE+   QMKMIAA ++++Y
Sbjct  415  VWGEDCFEFRPERWISERGGIRHEPSYKFLAFNAGPRTCLGKEVAFTQMKMIAAAMIYNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  +V+SH V PS+SII+  KHGL+VKF +R
Sbjct  475  EVHLVESHPVRPSNSIILHIKHGLRVKFARR  505



>gb|EPS60789.1| hypothetical protein M569_14012, partial [Genlisea aurea]
Length=489

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE ++L YLHGAL ES RLFPPVA+EHK  A  D LP+G+ ++ NT++I SFYS GRM+
Sbjct  337  VEESRRLSYLHGALSESLRLFPPVALEHKAPADGDTLPTGNRIEKNTKIIFSFYSMGRME  396

Query  469  SIWGEDCMEFKPERWISS-KGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
            SIWG+DC++FKPERWIS   G + H PSY FPAFN GPRTCLGK+M  +QMKM+AA I+ 
Sbjct  397  SIWGKDCLKFKPERWISDVTGGVVHAPSYYFPAFNVGPRTCLGKDMAFIQMKMVAAAIVF  456

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            HY+ ++VD     P DSII+Q K+GL+V+ +KR
Sbjct  457  HYQVEIVDGAVALPRDSIILQTKNGLRVRLSKR  489



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCES RL+PPV  E K     D+LPSGH V P T+++ S Y+ GRM 
Sbjct  354  IEEIKKLVYLHGALCESLRLYPPVHSEFKSPLRRDILPSGHQVNPKTKIVFSLYAMGRMS  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+DC EFKPERWI+ +G +KHEPSYKF +FNAGPRTCLGK++   QMK + A I+++
Sbjct  414  SVWGDDCFEFKPERWITDRGGMKHEPSYKFFSFNAGPRTCLGKDVAFTQMKAVVAAIIYN  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+ QVVD H+V PS S+I+  KHG+KVK TKR
Sbjct  474  YQVQVVDEHTVPPSQSVILHMKHGMKVKLTKR  505



>ref|XP_004166589.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=507

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KLVY HGA CE+ RL+PPV  +HKV+   D LPSGH +KP T+++ S Y+ GRM 
Sbjct  354  IDELKKLVYFHGAWCEALRLYPPVPFQHKVAMQHDTLPSGHHIKPKTKIVFSLYALGRMS  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             +WG+DC+EFKPERWIS KG IKH PSYKF AFNAGPRTCLGKE+   +MK++AA ++H+
Sbjct  414  EVWGKDCLEFKPERWISEKGSIKHVPSYKFLAFNAGPRTCLGKEVAFTEMKLVAAAMIHN  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y       H V P+ SII+  KHG KVK TKR
Sbjct  474  YNITQQIGHKVVPNPSIILHMKHGFKVKVTKR  505



>gb|KGN48435.1| hypothetical protein Csa_6G487560 [Cucumis sativus]
Length=507

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KLVY HGA CE+ RL+PPV  +HKV+   D LPSGH +KP T+++ S Y+ GRM 
Sbjct  354  IDELKKLVYFHGAWCEALRLYPPVPFQHKVAMQHDTLPSGHHIKPKTKIVFSLYALGRMS  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             +WG+DC+EFKPERWIS KG IKH PSYKF AFNAGPRTCLGKE+   +MK++AA ++H+
Sbjct  414  EVWGKDCLEFKPERWISEKGSIKHVPSYKFLAFNAGPRTCLGKEVAFTEMKLVAAAMIHN  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y       H V P+ SII+  KHG KVK TKR
Sbjct  474  YNITQQIGHKVVPNPSIILHMKHGFKVKVTKR  505



>gb|KDP35257.1| hypothetical protein JCGZ_09416 [Jatropha curcas]
Length=502

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E   LVYLH ALCE+ RL+PPV  +HK     DVLPSGH V P  ++++  Y+ GRM 
Sbjct  349  VQEVNSLVYLHAALCETLRLYPPVPFQHKSPLQKDVLPSGHEVNPEMKIVICSYAMGRMA  408

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWGEDC+EFKPERWI+  G+IKHEPSYKF AFNAGPRTCLGKE+   QMK++AA I+H+
Sbjct  409  SIWGEDCLEFKPERWITEGGKIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKIVAASIIHN  468

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  +VV+ H VSP+ SII+  KHGLKVK T+R
Sbjct  469  YHVKVVEDHPVSPNVSIILHMKHGLKVKVTRR  500



>gb|AES86633.2| cytochrome P450 family protein [Medicago truncatula]
Length=225

 Score =   179 bits (454),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +E   KLVYLH ALCES RL+PPV  EHK S   DVLPSGH +K NT ++ S YS GR++
Sbjct  72   IEGINKLVYLHAALCESLRLYPPVPFEHKSSLKPDVLPSGHKIKSNTMIVYSLYSIGRVE  131

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDC+EFKPERWIS KG I H PSYKF AFNAGPR+CLGKEM  ++MKMI   IL +
Sbjct  132  EIWGEDCLEFKPERWISKKGEIIHVPSYKFIAFNAGPRSCLGKEMSFIEMKMIIVAILLN  191

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            Y   VV+   V PS S+I+  KHGLKV   K
Sbjct  192  YHIHVVEGQVVKPSISLILHMKHGLKVMVKK  222



>ref|XP_011095705.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KL+YLHGALCE+ RLFPPVAI+HK     D+LP+GH +KPNT  +LSFYS GRM+
Sbjct  355  MKELRKLIYLHGALCEALRLFPPVAIQHKAPVEHDILPTGHHIKPNTITLLSFYSMGRME  414

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC++FKP RWIS  G IK EPSYKF AFNAGPR+CLGKEM   QMK++AA I+  
Sbjct  415  SIWGKDCLQFKPGRWISETGSIKIEPSYKFTAFNAGPRSCLGKEMSFTQMKIVAAAIISR  474

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            ++ QV   H V P+ SII+  K GLKVK +K
Sbjct  475  FKVQVAAGHPVCPNASIILHMKRGLKVKVSK  505



>ref|XP_010027341.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62208.1| hypothetical protein EUGRSUZ_H04869 [Eucalyptus grandis]
Length=505

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   K+VYLHGA+CES RL+PPV  +HK  A  DVLPSGH V P+T++I+  Y+ GRM S
Sbjct  353  EHMHKMVYLHGAICESLRLYPPVPFQHKCPANPDVLPSGHEVDPSTKIIVVMYAMGRMKS  412

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC+EF+PERWIS +G I+HEPSYKF AFNAGPRTCLGK++   Q+K  AA ++H+Y
Sbjct  413  IWGEDCLEFRPERWISERGGIRHEPSYKFIAFNAGPRTCLGKDVAFTQIKTAAATVIHNY  472

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  VV+ H V PS+SI++  KHGLKVK  +R
Sbjct  473  EVYVVEDHPVRPSNSIVLHMKHGLKVKLARR  503



>ref|XP_010025512.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62204.1| hypothetical protein EUGRSUZ_H04862 [Eucalyptus grandis]
Length=507

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E    LVYLHGALCES RL+PP+  EHK     DVLPSGH V P  ++++  Y+ GRM S
Sbjct  355  EHVHNLVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVNPGKKILIHLYAMGRMKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EF+PERWIS  G ++HEPSYKF AFNAGPRTCLGK++   QMKMIAA+++H+Y
Sbjct  415  VWGEDCFEFRPERWISKSGGVRHEPSYKFLAFNAGPRTCLGKQVAFTQMKMIAAVVIHNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  VV+ H V PS+SII+  KHGL+VK  +R
Sbjct  475  EVHVVEGHLVRPSNSIILHMKHGLRVKLARR  505



>gb|EYU27553.1| hypothetical protein MIMGU_mgv1a006542mg [Erythranthe guttata]
Length=440

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 112/153 (73%), Gaps = 14/153 (9%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE ++L+YLHGALCES RLFPPVA+EHK     D LPSG  +K N ++I+SFYS+GRM+
Sbjct  297  VEESRRLIYLHGALCESLRLFPPVALEHKAPIEPDNLPSGEYIKSNAKVIVSFYSTGRME  356

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG DC EFKPERWIS  G IKHEPSYKFPAFNAGPRTC+GKEM  +Q+     +I   
Sbjct  357  SVWGNDCSEFKPERWISDSGLIKHEPSYKFPAFNAGPRTCVGKEMAFIQLVEGNDVI---  413

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
                       SP DSII+QAKHGLKV  +KRN
Sbjct  414  -----------SPRDSIILQAKHGLKVTLSKRN  435



>gb|AEI59774.1| cytochrome P450 [Helianthus annuus]
Length=505

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            E  K+VYLHGALCE+ RL+PPV   +K     D+LPSGH V  NT +IL FYS GRM SI
Sbjct  354  ELDKMVYLHGALCETLRLYPPVPFNNKSPLQPDILPSGHQVDQNTNIILCFYSMGRMRSI  413

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGEDCMEFKPERWISS G IKH PSYKFP FNAGPR CLGK M   ++K++A  I++HY 
Sbjct  414  WGEDCMEFKPERWISSSGGIKHVPSYKFPTFNAGPRACLGKNMAFSELKIVATTIIYHYH  473

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
             Q+V+ H V P+DS+++  K+GLKVK  +R+
Sbjct  474  IQLVEGHLVLPADSMVLHMKYGLKVKLNRRS  504



>ref|XP_004489210.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=505

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V++ +KLVYLHGA+CE+ RLFPP+  E K +   D+LPSGH+V PNT ++ S YS GR +
Sbjct  352  VDDVKKLVYLHGAICEALRLFPPIPFESKKAIKGDILPSGHIVDPNTMILFSLYSMGRFE  411

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EFKPERWIS +GRI HEPSYKF  FNAGPRTCLGK++  +Q+KMIA  IL  
Sbjct  412  DIWGKDCLEFKPERWISERGRIVHEPSYKFFTFNAGPRTCLGKDLSFIQIKMIATSILCK  471

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y  QV + H    S SI++  K+GL+VK TKR  
Sbjct  472  YRVQVGEDHIPILSHSIVLLMKNGLRVKLTKRQN  505



>ref|XP_008440140.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Cucumis melo]
Length=507

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KLVY HGALCE+ RL+PPV  +HKV+   D LPSGH +KP T+++ S Y+ GR  
Sbjct  355  IDELKKLVYFHGALCEALRLYPPVPFQHKVATQHDKLPSGHHIKPKTKIVFSLYALGRTS  414

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             +WG+DC+EFKPERWIS KG IKH PSYKF AFNAGPRTCLGKE+   +MK++AA I+H+
Sbjct  415  EVWGKDCLEFKPERWISEKGSIKHVPSYKFLAFNAGPRTCLGKEVAFTEMKIVAATIIHN  474

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y       H V P+ SII+  KHG KV  TKR
Sbjct  475  YNIIQQIGHKVVPNPSIILHMKHGFKVNVTKR  506



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V E  KLVYLHGALC+S RL+PPV  +HK     D+LPSGH V P  +++ S Y+ GRM+
Sbjct  354  VHELNKLVYLHGALCDSLRLYPPVPFQHKEPLKEDILPSGHKVHPKLKILFSLYAMGRME  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+
Sbjct  414  SIWGKDCLEFKPERWISERGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAATIIHN  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+ QVV+ H + P+ SII+  ++G KV+ ++R
Sbjct  474  YQVQVVEGHPIKPNTSIILYMRYGFKVRISRR  505



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E  KLVYLHGALC+S RL+PPV  +HK     D+LPSGH V P  +++ S Y+ GRM+
Sbjct  352  VQELNKLVYLHGALCDSLRLYPPVPFQHKEPLENDILPSGHKVHPKLKIMFSLYAMGRME  411

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS  G IKHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+
Sbjct  412  SIWGKDCLEFKPERWISDGGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHN  471

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+ ++V  H + P+ SII+  +HG KV+ ++R
Sbjct  472  YQVELVKGHPIEPNASIILYMRHGFKVRISRR  503



>gb|KEH24777.1| cytochrome P450 family protein [Medicago truncatula]
Length=505

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E +KLVYLHGA+CE+ RLFPP+  E K +   DVLPSGH++ PNT ++ S YS GR +
Sbjct  354  VDEVKKLVYLHGAICEAIRLFPPIPFERKKAIKGDVLPSGHIINPNTIILFSLYSMGRFE  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDC+EFKPERWIS +G I HEPSYKF +FNAGPRTCLGK++  +Q+KMIA  IL  
Sbjct  414  EIWGEDCLEFKPERWISERGSIVHEPSYKFFSFNAGPRTCLGKDLSFIQVKMIAIAILSK  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVVD H    S SI++  K+GLKV+ TKR
Sbjct  474  YCVQVVDGHVPILSHSIVLLMKNGLKVRITKR  505



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V E  KLVYLHGALC+S RL+PPV  +HK     D+LPSGH V P  +++ S Y+ GRM+
Sbjct  354  VHELNKLVYLHGALCDSLRLYPPVPFQHKEPLQEDMLPSGHKVHPKLKILFSLYAMGRME  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+
Sbjct  414  SIWGKDCLEFKPERWISERGTIKHEPSYKFLAFNAGPRTCLGKEVAFNQMKAVAATIIHN  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+ QVV+ H + P+ SII+  +HG KV+ ++R
Sbjct  474  YQVQVVEGHPIKPNTSIILYMRHGFKVRISRR  505



>ref|XP_008440139.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Cucumis melo]
Length=510

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KLVY HGALCE+ RL+PPV  +HKV+   D LPSGH +KP T+++ S Y+ GR  
Sbjct  358  IDELKKLVYFHGALCEALRLYPPVPFQHKVATQHDKLPSGHHIKPKTKIVFSLYALGRTS  417

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             +WG+DC+EFKPERWIS KG IKH PSYKF AFNAGPRTCLGKE+   +MK++AA I+H+
Sbjct  418  EVWGKDCLEFKPERWISEKGSIKHVPSYKFLAFNAGPRTCLGKEVAFTEMKIVAATIIHN  477

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y       H V P+ SII+  KHG KV  TKR
Sbjct  478  YNIIQQIGHKVVPNPSIILHMKHGFKVNVTKR  509



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             E   KLVYLH ALCE+ RL+PPV  +HK     D+LPSGH V P  +++ S Y+ GRM 
Sbjct  369  TEALNKLVYLHAALCETLRLYPPVPFQHKAPLQPDMLPSGHRVDPKMKILFSLYAMGRMT  428

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG DC+EFKPERWIS +GRIKHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+
Sbjct  429  SIWGTDCLEFKPERWISERGRIKHEPSYKFFAFNAGPRTCLGKEVAFTQMKAVAATIIHN  488

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+ H V+P+ SII+  KHGL V+ +KR
Sbjct  489  YHVQVVEGHHVAPNVSIILYMKHGLMVRVSKR  520



>ref|XP_008441105.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=424

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE   L YLHGALCE  RL+PPVA EHK S   D LPSGHLVKP TR++LS Y+ GRM 
Sbjct  268  IEELSNLAYLHGALCEILRLYPPVAFEHKSSVEADTLPSGHLVKPGTRIVLSTYALGRMK  327

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WGED  EFKPERWI+ KGRIK EPSYKF  FN GPR+CLGKE+   Q+K+I+A I+H+
Sbjct  328  SVWGEDYEEFKPERWITEKGRIKREPSYKFFTFNTGPRSCLGKEVTFAQLKIISAAIIHN  387

Query  289  YEFQvvdshsvsps--dsiiIQAKHGLKVKFTKR  194
            Y+ + V   +   +   SII+  K G KV+ +KR
Sbjct  388  YDIESVVEDNNGIAPVASIILHMKTGFKVRVSKR  421



>ref|XP_004157876.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=379

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE   L YLHGA+CE  RL+PPVA EHK S   D LPSGHLVK  TR++LS Y+ GR+ S
Sbjct  225  EELSNLAYLHGAICEILRLYPPVAFEHKSSVEADTLPSGHLVKAGTRIVLSTYALGRIKS  284

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EFKPERWIS KGRIK EPSYKF  FN GPR+CLGKE+ + Q+K+I+A I+H+Y
Sbjct  285  VWGEDCEEFKPERWISEKGRIKREPSYKFFTFNTGPRSCLGKEVTIAQLKIISAAIIHNY  344

Query  286  EFQvvdshsvsps--dsiiIQAKHGLKVKFTKRN  191
            + + V   +   +   SII+  K G KV+ +KR+
Sbjct  345  DIEAVVEDNNGIAPVASIILHMKTGFKVRVSKRS  378



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KLVY+HGA+CE+ RL+PPV  +HK     D+LPSGH V+P  +++ S Y+ GRM+
Sbjct  358  VEETKKLVYMHGAICEALRLYPPVPFQHKEPVEPDILPSGHFVEPTMKVMFSLYAMGRME  417

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WGEDC+EFKPERWIS +G IKHEPSYKF AFNAGPRTCLGK++   Q+K +AA ++H+
Sbjct  418  SVWGEDCLEFKPERWISDRGSIKHEPSYKFLAFNAGPRTCLGKDVAFAQVKAVAATLIHN  477

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
            Y+  V D H V P+ SII+  ++GLKV+   R +A
Sbjct  478  YQVHVADGHRVLPNCSIILYMRNGLKVRVANRWSA  512



>emb|CDP12888.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V++  KLVYLHGALCES RL+PPV  +HK     D+LP+GH V P  +++ S Y+ GRM 
Sbjct  319  VQDLNKLVYLHGALCESLRLYPPVPFQHKEPLEPDILPTGHQVYPKMKIMFSLYAMGRMA  378

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DCME KPERWIS +G IKHEPSYKF AFNAGPRTCLGKE+   Q+K +AA I+H+
Sbjct  379  SIWGKDCMEMKPERWISDRGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQLKAVAATIIHN  438

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  +VV    + P+ S+I+  K GLKVK +KR
Sbjct  439  YHVRVVKGQKIVPNISVILYIKQGLKVKVSKR  470



>ref|XP_008440138.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=511

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 115/153 (75%), Gaps = 1/153 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE   LVYLHG LCE+ RL+PPV ++HKVS   D+LPSGH +KP T+++ S Y+ GRM 
Sbjct  356  LEEVDNLVYLHGTLCEALRLYPPVPLQHKVSTQHDILPSGHHIKPKTKILFSLYALGRMS  415

Query  469  SIWGEDCMEFKPERWISSK-GRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
             +WG+DC+EFKPERWI+S+ G+IKH PSYKF AFNAGPRTCLGK +   ++K++AA I+H
Sbjct  416  EVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNAGPRTCLGKHVAFTELKIVAAAIIH  475

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +Y       H V PS SII+  KHG KVK TKR
Sbjct  476  NYNIIQQTGHEVVPSASIILHMKHGFKVKVTKR  508



>ref|XP_011100086.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=512

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E  KLVY+HGA+CE+ RL+PPV  +HK     D+LPSGH V P  +++   Y+ GRM+
Sbjct  359  IDEINKLVYMHGAMCEALRLYPPVPFQHKEPMKPDILPSGHYVHPKMKVMFFLYAMGRME  418

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPSYKF AFNAGPRTCLG+E+   QMKM+AA ++H+
Sbjct  419  SIWGKDCLEFKPERWISERGTIKHEPSYKFLAFNAGPRTCLGREVAFTQMKMVAATVIHN  478

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+ +VV+ H V+P+ S+I+  +HGLKV+  KR
Sbjct  479  YQVRVVEGHRVAPNCSVILYMRHGLKVRVAKR  510



>gb|EYU43136.1| hypothetical protein MIMGU_mgv1a007195mg [Erythranthe guttata]
Length=415

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE  KLVYLHGALCE+ RLFPPV  EHK     D+LPSGH + PNT+ +LSFYS GRM+
Sbjct  262  IEESNKLVYLHGALCETLRLFPPVPFEHKAPVEHDILPSGHRIGPNTKTVLSFYSMGRME  321

Query  469  SIWGEDCMEFKPERWISSK-GRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
            SIWG+DC++FKP RWI ++ GR+  EPS+KF AFNAGPR+CLGK++  +Q+K++AA I+ 
Sbjct  322  SIWGKDCLDFKPGRWIDAETGRVITEPSFKFTAFNAGPRSCLGKDVSFIQLKIVAAAIVS  381

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFT  200
             +  QV    SV+PS S+++  KHGLKVK +
Sbjct  382  RFNIQVARGFSVTPSISVVLHMKHGLKVKVS  412



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E  KLVYLHGALC+S RL+PPV  +HK     D+LPS H V P  +++ S Y+ GRM+
Sbjct  352  VQELNKLVYLHGALCDSLRLYPPVPFQHKEPLEKDILPSVHKVHPKLKIMFSLYAMGRME  411

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS +G IKHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+
Sbjct  412  SIWGKDCLEFKPERWISDRGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHN  471

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+ ++V  H + P+ SII+  +HG KV+ ++R
Sbjct  472  YQVELVKGHPIEPNASIILYMRHGFKVRISRR  503



>ref|XP_004160508.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=511

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE   LVY HG LCE+ RL+PPV ++HKVS   D+LPSGH +KP T+++ S Y+ GRM 
Sbjct  356  IEEVDNLVYFHGTLCEALRLYPPVPLQHKVSIQHDILPSGHHIKPKTKILFSLYALGRMS  415

Query  469  SIWGEDCMEFKPERWISSK-GRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
             +WG+DC+EFKPERWI+S+ G+IKH PSYKF AFNAGPRTCLGK +   ++K++AA I+H
Sbjct  416  EVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNAGPRTCLGKHVAFTELKIVAAAIIH  475

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +Y       H V PS SII+  KHG KVK TKR
Sbjct  476  NYNIIQQAGHEVVPSASIILHMKHGFKVKVTKR  508



>gb|KGN48432.1| hypothetical protein Csa_6G487530 [Cucumis sativus]
Length=511

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE   LVY HG LCE+ RL+PPV ++HKVS   D+LPSGH +KP T+++ S Y+ GRM 
Sbjct  356  IEEVDNLVYFHGTLCEALRLYPPVPLQHKVSIQHDILPSGHHIKPKTKILFSLYALGRMS  415

Query  469  SIWGEDCMEFKPERWISSK-GRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
             +WG+DC+EFKPERWI+S+ G+IKH PSYKF AFNAGPRTCLGK +   ++K++AA I+H
Sbjct  416  EVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNAGPRTCLGKHVAFTELKIVAAAIIH  475

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +Y       H V PS SII+  KHG KVK TKR
Sbjct  476  NYNIIQQAGHEVVPSASIILHMKHGFKVKVTKR  508



>emb|CDP12890.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E + LVYLH ALCE+ RL+PPV  +HK     D+LPSG  V P  +++   Y+ GRM+S
Sbjct  285  DEIKNLVYLHAALCETLRLYPPVPFQHKTPLKPDILPSGLHVTPKMKVMFPLYAMGRMES  344

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC EFKPERWIS +GR+KHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y
Sbjct  345  IWGKDCKEFKPERWISERGRVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNY  404

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              Q+V+ H V P+ S+I+  K+GLKV+ TKR
Sbjct  405  NIQLVEGHPVIPNVSVILYIKNGLKVRVTKR  435



>gb|KGN48429.1| hypothetical protein Csa_6G487010 [Cucumis sativus]
Length=458

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE   L YLHGA+CE  RL+PPVA EHK S   D LPSGHLVK  TR++LS Y+ GR+ S
Sbjct  304  EELSNLAYLHGAICEILRLYPPVAFEHKSSVEADTLPSGHLVKAGTRIVLSTYALGRIKS  363

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EFKPERWIS KGRIK EPSYKF  FN GPR+CLGKE+ + Q+K+I+A I+H+Y
Sbjct  364  VWGEDCEEFKPERWISEKGRIKREPSYKFFTFNTGPRSCLGKEVTIAQLKIISAAIIHNY  423

Query  286  EFQvvdshsvsps--dsiiIQAKHGLKVKFTKRN  191
            + + V   +   +   SII+  K G KV+ +KR+
Sbjct  424  DIEAVVEDNNGIAPVASIILHMKTGFKVRVSKRS  457



>ref|XP_010681243.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=272

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = -2

Query  637  QKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWG  458
             +LVYLH ALCES RL+PPV  +HK     +VLPSGH V PN + +   Y  GRM +IWG
Sbjct  123  NELVYLHAALCESLRLYPPVPFQHKSPIKPNVLPSGHHVHPNMKTVFPLYEMGRMKAIWG  182

Query  457  EDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQ  278
            E+C +F+PERWIS +G+IKHEPSYKF AFNAG RTCLGKE+   QMKMIAA ++H++ FQ
Sbjct  183  ENCSKFQPERWISKQGKIKHEPSYKFLAFNAGRRTCLGKEIAFTQMKMIAATLIHNFHFQ  242

Query  277  vvdshsvspsdsiiIQAKHGLKVKFTKR  194
            VV+  ++ P  S++   KHG KVK  KR
Sbjct  243  VVEDDNIYPDVSVMFHIKHGFKVKIYKR  270



>ref|XP_004160509.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48433.1| hypothetical protein Csa_6G487540 [Cucumis sativus]
Length=511

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE  KLVY H  LCE+ RL+PPV  +HKV+   D+LPSGH +KP T+++ S Y+ GRM 
Sbjct  357  MEEVNKLVYFHATLCEALRLYPPVPFQHKVATQHDILPSGHHIKPKTKIVFSLYALGRMS  416

Query  469  SIWGEDCMEFKPERWISSK-GRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
             +WG+DC+EFKPERWI+S+ G+IKH PSYKF AFNAGPRTCLGK +  +++K++AA I+H
Sbjct  417  EVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNAGPRTCLGKHVAFIELKIVAAAIIH  476

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            +Y       H V P+ SII+  KHG KVK TKR T
Sbjct  477  NYNIIQQTGHQVVPNASIILHMKHGFKVKVTKRWT  511



>gb|KCW62190.1| hypothetical protein EUGRSUZ_H04847 [Eucalyptus grandis]
Length=502

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E+   LVYLHGALCES RL+PP+  EHK     DVLPSGH V P  ++++  Y+ GRM S
Sbjct  350  EQVHNLVYLHGALCESLRLYPPIPFEHKCPVKPDVLPSGHKVDPGKKILIHLYAMGRMKS  409

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGE C EF+PERWIS  G ++HEPSYKF AFNAGPRTCLGK++   QMKMIAA+++H+Y
Sbjct  410  VWGEYCFEFRPERWISKSGGVRHEPSYKFLAFNAGPRTCLGKQVAFTQMKMIAAVVIHNY  469

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  VV+ H V PS+SII+  KHGL+VK  +R
Sbjct  470  EVHVVEGHPVRPSNSIILHMKHGLRVKLARR  500



>ref|XP_010027329.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62193.1| hypothetical protein EUGRSUZ_H04851 [Eucalyptus grandis]
Length=507

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGA+CES RL+PP+  + K  A  DVLPSGH V P T++I+  Y+ GRM S
Sbjct  355  EHMHKLVYLHGAVCESLRLYPPLPFQRKSPAKPDVLPSGHEVDPGTKIIVVMYAMGRMKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC+EFKPERWIS +G I+HEPSYKF AFNAGPRTCLGK++   Q+K +AA ++H+Y
Sbjct  415  IWGEDCLEFKPERWISERGGIRHEPSYKFVAFNAGPRTCLGKDVAFTQIKTVAATVIHNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  VV+ H V PS+SI++  K+GLKVK  +R
Sbjct  475  EVHVVEDHPVRPSNSIVLHMKYGLKVKLARR  505



>gb|KEH22137.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  634  KLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGE  455
            KL+YLHGALCE+ RL+PPV +EHK +   DVLPSGH VKPNT ++ S YS GR++ IWGE
Sbjct  348  KLIYLHGALCEALRLYPPVPLEHKSALKSDVLPSGHRVKPNTMIVYSLYSVGRVEEIWGE  407

Query  454  DCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQv  275
            DC++FKPERWIS KG I H PSYKF AFNAGPR+CLGK++  ++MKM+A  IL +Y  QV
Sbjct  408  DCLKFKPERWISKKGGIIHVPSYKFIAFNAGPRSCLGKDISFIEMKMVAIAILLNYHIQV  467

Query  274  vdshsvspsdsiiIQAKHGLKVKFTKRN  191
            V+ H + PS S+++  KHGLKV   KR+
Sbjct  468  VEDHPIIPSLSVVLHMKHGLKVNVKKRS  495



>ref|XP_011025593.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=513

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             +E   LVYLHGALCE+ RL+PPV  +HK     DVLPSGH V PNT ++ S Y  GRM 
Sbjct  360  TQELSNLVYLHGALCETLRLYPPVPFQHKEPLKSDVLPSGHRVGPNTMVLFSVYVMGRMA  419

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG DC+EFKPERWIS  G+IKHEPSYKF AFNAGPRTCLG+ +   QMK +AA I+H+
Sbjct  420  SIWGPDCIEFKPERWISDSGKIKHEPSYKFLAFNAGPRTCLGRGVAFTQMKAVAAAIIHN  479

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+  VV+ H V+PS SII+  KHGLKV  +K+
Sbjct  480  YQVHVVEGHPVAPSSSIILHMKHGLKVSLSKK  511



>ref|XP_010437068.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=518

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CES RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  365  QEVKKLVYLHGAICESLRLYPPVPFQHKSPTEPDVLPSGHKVDANSKILFCLYSLGRMKS  424

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  425  VWGEDALEFKPERWISESGRSLHEPSYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  484

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
            EFQVV+ H + P+ S+I+  KHGLKV  +KR  A
Sbjct  485  EFQVVEGHKIEPAPSVILHMKHGLKVTVSKRCCA  518



>ref|XP_004142039.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=467

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 112/154 (73%), Gaps = 2/154 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE   L YLHGA+CE  RL+PPVA EHK S   D LPSGHLVK  TR++LS Y+ GR+ S
Sbjct  313  EELSNLAYLHGAICEILRLYPPVAFEHKSSVEADTLPSGHLVKAGTRIVLSTYALGRIKS  372

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EFKPERWIS KGRIK EPSYKF  FN GPR+CLGKE+ + Q+K+I+A I+H+Y
Sbjct  373  VWGEDCEEFKPERWISEKGRIKREPSYKFFTFNTGPRSCLGKEVTIAQLKIISAAIIHNY  432

Query  286  EFQvvdshsvsps--dsiiIQAKHGLKVKFTKRN  191
            + + V   +   +   SII+  K G KV+ +KR+
Sbjct  433  DIEAVVEDNNGIAPVASIILHMKTGFKVRVSKRS  466



>ref|XP_004489209.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=511

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E + LVYLHGA+CE+ RLFPP+  E K S   DVLPSGH V PNT ++ S Y+ GR +
Sbjct  358  VDEVKNLVYLHGAICEALRLFPPIPFERKESVEKDVLPSGHHVHPNTMILFSLYAMGRSE  417

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWGEDC+EFKPERWIS +G I + PSYKF +FNAGPRTCLGK++  +Q+KM+AA IL +
Sbjct  418  NIWGEDCLEFKPERWISERGGIVYAPSYKFFSFNAGPRTCLGKDLAFIQIKMVAASILWN  477

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y   VV+ + V+PS SI++  KHGLKVK TKR
Sbjct  478  YGIHVVEGNCVTPSLSIVLLMKHGLKVKITKR  509



>ref|XP_007150921.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
 gb|ESW22915.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
Length=508

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KLVYLHGA+CES RLFPP+  E K +   DVLPSGH V P+T ++   YS GR +
Sbjct  355  VEEVKKLVYLHGAICESLRLFPPIPFERKEALKSDVLPSGHGVNPSTVILFCLYSMGRFE  414

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDCMEFKPERWIS KG   + PSYKF AFNAGPRTCLGK++  +QMKM+A  ILH 
Sbjct  415  EIWGEDCMEFKPERWISQKGGNVYVPSYKFIAFNAGPRTCLGKDVSFIQMKMVATAILHK  474

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+ +   P+ SI++  K GLKVK  KR
Sbjct  475  YRLQVVEGYVAKPNLSIVLLMKDGLKVKIKKR  506



>ref|NP_195658.3| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 emb|CAB44683.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80611.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE87077.1| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=516

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV   HK  A  DVLPSGH VK N+R++   YS GRM S
Sbjct  363  QEVKKLVYLHGAVCEALRLYPPVPFNHKSPAKPDVLPSGHKVKANSRILFCLYSLGRMKS  422

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED MEFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  423  VWGEDAMEFKPERWISESGRSVHEPSYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  482

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  VV+ H + P+ S+I+  KHGLKV  +KR
Sbjct  483  DINVVEGHKIKPAPSVILHMKHGLKVTVSKR  513



>gb|KCW62191.1| hypothetical protein EUGRSUZ_H04849 [Eucalyptus grandis]
Length=496

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   K+VYLHGALCES RL+PP+  E K     D+LPSGH V P+ R++ + Y+ GRM S
Sbjct  344  EHMHKMVYLHGALCESLRLYPPIPFELKCPVKPDILPSGHKVDPSKRILFNLYAMGRMKS  403

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC EF+PERWIS  G ++HEPSYKF AFNAGPRTCLGK++   QMKMIAA+++H+Y
Sbjct  404  IWGEDCFEFRPERWISEGGGVRHEPSYKFLAFNAGPRTCLGKQVAFTQMKMIAAVVIHNY  463

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  VV+ H + PS+SI++  K GL+VK  +R
Sbjct  464  EVHVVEGHPMRPSNSIVLHMKQGLRVKLARR  494



>gb|EYU41723.1| hypothetical protein MIMGU_mgv1a021724mg [Erythranthe guttata]
Length=518

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 117/157 (75%), Gaps = 4/157 (3%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E +KL+YLH ALCES RL+PP  +EHK     D LPSGH +K + ++ILSFYS GRM+
Sbjct  361  VKESKKLIYLHAALCESLRLYPPGPLEHKSPMKSDNLPSGHYIKEDAKVILSFYSIGRME  420

Query  469  SIWGEDCMEFKPERWI---SSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAII  299
            S+WG+DC+EFKPERWI   SS   IKH PSYKFP FN GPRTCLGKEM   +MKM+AA I
Sbjct  421  SVWGKDCLEFKPERWISTTSSTAIIKHVPSYKFPVFNIGPRTCLGKEMAFFEMKMVAATI  480

Query  298  LHHYEFQvvdshsvspsds-iiIQAKHGLKVKFTKRN  191
            ++HY   +V+ H V P    II++ KHGL+VK +KRN
Sbjct  481  IYHYNIHLVEGHPVIPRHDCIILEMKHGLRVKLSKRN  517



>gb|KEH40828.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +  KLVYLHGA+CE+ RL+PP+  EH  S   D+LPSG+ V PNT +I S YS GRM+ I
Sbjct  358  DLDKLVYLHGAICETLRLYPPIPFEHICSIKSDILPSGYHVSPNTTLIYSLYSMGRMEQI  417

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGEDCMEFKPERWIS +G I H PSYKF AFN GPR C+GK++  +QMKM+AA +L  + 
Sbjct  418  WGEDCMEFKPERWISERGDIIHVPSYKFVAFNTGPRICIGKDLSFIQMKMVAAALLQKFH  477

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
             QVV+ H V+P  S++++ KHGLKV+ +KR+
Sbjct  478  IQVVEGHPVTPRLSVLLRMKHGLKVEVSKRS  508



>gb|KEH40839.1| cytochrome P450 family protein [Medicago truncatula]
Length=501

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE+  KLVYLHGA+CE+ RL+PP+A +HK +   D+LPSG  V PNT++I S Y+ GRM 
Sbjct  348  VEKIDKLVYLHGAICETLRLYPPLAFQHKCAIKSDILPSGEHVGPNTKLIYSLYAMGRMQ  407

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EFKPERWIS++G I + PSYKF AFNAGPR+C+GK++  VQMKM+AA +L  
Sbjct  408  QIWGDDCLEFKPERWISARGGIINVPSYKFIAFNAGPRSCIGKDLSFVQMKMVAASLLWK  467

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  QVV+ H V+   SI+++ KHGLKV+ +KR
Sbjct  468  FRIQVVEGHPVTLRTSIVVRMKHGLKVEVSKR  499



>ref|XP_003554826.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=501

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE+ +KLVYLHGA+CE+ RLFPP+  E K++   D+LPSGH V P T +++S Y+ GR++
Sbjct  348  VEKVKKLVYLHGAICETLRLFPPIPFERKLAIKADMLPSGHRVNPRTMILISLYAMGRLE  407

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
              WG+DC+EFKPERWIS KG I + PSYKF AFNAGPRTCLGK++  +QMKM+AA IL+ 
Sbjct  408  ETWGKDCLEFKPERWISEKGGIVYVPSYKFIAFNAGPRTCLGKDLSFIQMKMVAAAILYK  467

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+ +  +PS SI++  K GLKV  TKR
Sbjct  468  YHVQVVEDYVATPSLSIVLLIKDGLKVMITKR  499



>gb|KFK30508.1| hypothetical protein AALP_AA7G271100 [Arabis alpina]
Length=438

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  285  QELKKLVYLHGAICEALRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKS  344

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  G+  HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +Y
Sbjct  345  VWGEDALEFKPERWISETGKSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNY  404

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+   + P+ S+I+  KHGLKV  TKR
Sbjct  405  EMKIVEGQKIEPAPSVILHTKHGLKVTVTKR  435



>ref|XP_010431920.1| PREDICTED: cytochrome P450 86B1-like, partial [Camelina sativa]
Length=424

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  271  QELKKLVYLHGAICEALRLYPPVPFQHKSPTEADVLPSGHKVDANSKILFCLYSLGRMKS  330

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG+D +EFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +Y
Sbjct  331  VWGDDALEFKPERWISESGRSVHEPSYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNY  390

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+   + P+ S+I+  KHG+KV  TKR
Sbjct  391  EMKIVEGQKIEPAPSVILHMKHGVKVTVTKR  421



>gb|KHN27470.1| Cytochrome P450 86B1 [Glycine soja]
Length=412

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KLVYLHGA+CE+ RLFPP+  E K++   DVLPSGH V   T ++ S Y+ GR +
Sbjct  259  VEEVKKLVYLHGAICEALRLFPPIPFERKLAIKADVLPSGHSVNSRTMILFSLYAMGRFE  318

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
              WG+DC+EFKPERWIS K  I + PSYKF AFNAGPRTCLGK++   QMKM+AA IL +
Sbjct  319  ETWGKDCLEFKPERWISEKRSIVYVPSYKFIAFNAGPRTCLGKDLSFFQMKMVAAAILSN  378

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+ +  +PS SI++  K GLKVK TKR
Sbjct  379  YRVQVVEGYVATPSLSIVLLMKDGLKVKITKR  410



>gb|KDO37383.1| hypothetical protein CISIN_1g042798mg, partial [Citrus sinensis]
Length=271

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  637  QKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWG  458
             ++VYLH ALCE+ RL+PPV   HK++A  DVLPSGH +  N  +++S+Y+ GRM+ IWG
Sbjct  121  NRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWG  180

Query  457  EDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQ  278
            +DC+EFKP+RWIS +G I H PSYKF AF+AGPR CLGK+   +QMKM+AA+IL +Y+ +
Sbjct  181  KDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVK  240

Query  277  vvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            +V  H VSP +S+++  K+GLKV+ +KR 
Sbjct  241  IVQGHPVSPCNSMVLHMKYGLKVQLSKRT  269



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +++   LVYLHGALCE+ RL+PPV  + K     D LPSGH V PN ++I S Y+  RM 
Sbjct  335  IDDFNNLVYLHGALCEALRLYPPVVFQAKGPTKPDTLPSGHEVNPNMQIIFSMYAMARMK  394

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG DC EFKPERWIS  G+I+HEPSYK+  FNAGPRTCLGK+M   QMK++AA I+ +
Sbjct  395  SIWGNDCYEFKPERWISESGKIRHEPSYKYLVFNAGPRTCLGKDMAFTQMKVVAATIVKN  454

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            YEFQ ++ H V P  SI+++ K+GLKV+ +K
Sbjct  455  YEFQALEGHLVVPDISIMLRVKYGLKVQVSK  485



>ref|XP_010261086.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            E   L YLHGALCE+ RLFPPV  EHK     DVLPSGH V   T+++ S Y  GRM+ +
Sbjct  361  ELSGLAYLHGALCEALRLFPPVPFEHKSPVCPDVLPSGHRVDERTKILFSLYGMGRMEGL  420

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+DC+EFKPERWI+ +GRI+HEPSYKF AFNAGPRTCLGKE+   QMK++AA  +H+Y 
Sbjct  421  WGKDCLEFKPERWITERGRIRHEPSYKFLAFNAGPRTCLGKEVAFTQMKVVAAAFIHNYH  480

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
             +V++ H VSP+ SII+  KHGL V+ TKR
Sbjct  481  VEVIEGHPVSPNLSIILHMKHGLMVRVTKR  510



>ref|XP_004237624.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=510

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V E  KLVYLHGALC+S RL+PPV  +HK     D LPSGH V P T ++ S Y+  R +
Sbjct  357  VHELNKLVYLHGALCDSLRLYPPVPFQHKEPLKEDTLPSGHKVHPKTMILFSLYAMARTE  416

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG+DC+EFKPERWIS  G IKHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+
Sbjct  417  SIWGKDCLEFKPERWISETGTIKHEPSYKFMAFNAGPRTCLGKEVAFTQMKAVAATIIHN  476

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y+ +VV+  ++ P+ SII+  ++G KV+ ++R T
Sbjct  477  YKVEVVEGQTIEPNTSIILYMRYGFKVRISRRWT  510



>gb|KEH40811.1| cytochrome P450 family protein [Medicago truncatula]
Length=504

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 111/150 (74%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +  KLVYLHGALCE+ RL+PPV  EH  +   D+LPSG  V PNTR++ S Y+ GRM+ I
Sbjct  353  DLDKLVYLHGALCEAMRLYPPVPFEHICAINSDILPSGERVSPNTRLLYSLYAMGRMEQI  412

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGEDCMEFKPERW+S +G I H PSYKF AFN GPR+C+GK++  +QMKM+AA +L  + 
Sbjct  413  WGEDCMEFKPERWVSERGHIIHVPSYKFIAFNTGPRSCMGKDISFIQMKMVAAALLPKFH  472

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
             +VV  H ++P  S ++  KHGLKVK TKR
Sbjct  473  IKVVAGHPITPKLSFVLHMKHGLKVKVTKR  502



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             EE  KLVYLHGALCE+ RL+PPV  +HK     DVLPSGH V P  +++ S Y+ GRM 
Sbjct  350  TEELNKLVYLHGALCETLRLYPPVPFQHKAPHQADVLPSGHRVHPKMKILFSLYAMGRMT  409

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWG+DC EFKPERWI+ +G IK+EPSYKF AFNAGPRTCLGK +   QMK +AA I+H+
Sbjct  410  TIWGKDCFEFKPERWITEQGGIKYEPSYKFFAFNAGPRTCLGKGVAFTQMKAVAAAIIHN  469

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  Q+V  H V+P+ SII+  KH L V+ TKR
Sbjct  470  YNVQLVQGHPVAPNVSIILHMKHELMVRVTKR  501



>ref|XP_002310605.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
 gb|EEE91055.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
Length=505

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             +E   LVYLHGALCE+ RL+PPV  +HK     DVLPSGH V PN  ++ S Y  GRM 
Sbjct  352  TQELSNLVYLHGALCETLRLYPPVPFQHKEPLKSDVLPSGHRVGPNMMVLFSVYVMGRMT  411

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWG DC+EFKPERWIS  G+IKHEPSYKF AFNAGPRTCLG+ +   QMK +AA I+H+
Sbjct  412  SIWGPDCLEFKPERWISDSGKIKHEPSYKFLAFNAGPRTCLGRGVAFTQMKAVAAAIIHN  471

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+  VV+ H V+PS SII+  KHGLKV  +++
Sbjct  472  YQVHVVEGHPVAPSSSIILHMKHGLKVSLSRK  503



>gb|EYU27556.1| hypothetical protein MIMGU_mgv1a021423mg [Erythranthe guttata]
Length=507

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV  +HK     D+LPSGH + PNT+ +LSFYS GRM+
Sbjct  354  IEESKKLVYLHGALCETLRLFPPVPFQHKAPVEHDILPSGHRISPNTKTVLSFYSMGRME  413

Query  469  SIWGEDCMEFKPERWISSK-GRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
            SIWG DC++FKP RWI  + GR++ EPS+KF AFNAGPR+CLGK++  +Q+K++AA I+ 
Sbjct  414  SIWGNDCLDFKPGRWIDPETGRVRTEPSFKFTAFNAGPRSCLGKDVSFIQLKIVAAAIVS  473

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFT  200
             +  +V    SV+PS S+I+  KHGLKVK +
Sbjct  474  RFNIRVARGFSVTPSISVILHMKHGLKVKVS  504



>gb|KEH40819.1| cytochrome P450 family protein [Medicago truncatula]
Length=481

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +   LVYLHGA+CE+ RL+PPV  EH  +   D+LPSG  V PNTR++ S Y+ GRM+ I
Sbjct  330  DLDNLVYLHGAICETLRLYPPVPFEHICAIKSDILPSGERVSPNTRLLYSLYAMGRMEQI  389

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGEDCMEFKPERW+S  G I H PSYKF AFN GPR+CLGK++  +QMKM+AA +L  + 
Sbjct  390  WGEDCMEFKPERWVSETGHIIHVPSYKFIAFNTGPRSCLGKDLSFIQMKMVAAALLQKFH  449

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
             QVV+ H V+P  S ++  KHG KVK TKR
Sbjct  450  IQVVEGHPVTPKLSFVLHMKHGFKVKVTKR  479



>ref|XP_007150924.1| hypothetical protein PHAVU_004G006100g [Phaseolus vulgaris]
 gb|ESW22918.1| hypothetical protein PHAVU_004G006100g [Phaseolus vulgaris]
Length=509

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KLVYLHGA+CES RLFPP+  E K +   DVLPSGH V P+T ++   YS GR +
Sbjct  356  VEEVKKLVYLHGAICESLRLFPPIPFERKEALKSDVLPSGHGVNPSTVILFFLYSMGRSE  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDCMEFKPERWIS KG I + PSYKF AFN GPRTCLGK + L+QMKM+A  ILH 
Sbjct  416  EIWGEDCMEFKPERWISEKGGIVYVPSYKFVAFNTGPRTCLGKGVSLIQMKMVATAILHK  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+ H   P  SI++  K GLKV   KR
Sbjct  476  YRLQVVEGHVAKPKLSIVLLMKDGLKVTIKKR  507



>ref|XP_003604436.1| Cytochrome P450 [Medicago truncatula]
Length=481

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +E   KLVYLH ALCES RL+PPV  EHK S   DVLPSGH +K NT ++ S YS GR++
Sbjct  328  IEGINKLVYLHAALCESLRLYPPVPFEHKSSLKPDVLPSGHKIKSNTMIVYSLYSIGRVE  387

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDC+EFKPERWIS KG I H PSYKF AFNAGPR+CLGKEM  ++MKMI   IL +
Sbjct  388  EIWGEDCLEFKPERWISKKGEIIHVPSYKFIAFNAGPRSCLGKEMSFIEMKMIIVAILLN  447

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            Y   VV+   V PS S+I+  KHGLKV   K
Sbjct  448  YHIHVVEGQVVKPSISLILHMKHGLKVMVKK  478



>ref|XP_010446495.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  360  QELKKLVYLHGAICEALRLYPPVPFQHKSPTEADVLPSGHKVDANSKILFCLYSLGRMKS  419

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +Y
Sbjct  420  VWGEDALEFKPERWISESGRSVHEPSYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNY  479

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+   + P+ S+I+  KHG+KV  TKR
Sbjct  480  EMKIVEGQKIEPAPSVILHMKHGVKVTVTKR  510



>ref|XP_004492144.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=500

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGALCE+ RL+PP+  EHK +   DVLPSGH +K NT ++ S YS GR++ 
Sbjct  348  EGLSKLVYLHGALCETLRLYPPIPFEHKCAMKFDVLPSGHKIKSNTMIVYSLYSMGRVEE  407

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC+EFKPERWIS+KG I H PSYKF AFNAGPR+CLGK++   +MKM+   IL +Y
Sbjct  408  IWGEDCLEFKPERWISNKGGIIHVPSYKFIAFNAGPRSCLGKDISFTEMKMVVVAILLNY  467

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              Q+V+ H + PS S+I+  KHGLK+   KR
Sbjct  468  HIQLVEEHPIVPSLSVILHMKHGLKIMVKKR  498



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            ++  KLVY+HGALCE+ RL+PPVA E K S   D+LPSG  V PN ++I + Y+ GRM S
Sbjct  350  QDHDKLVYVHGALCEALRLYPPVAFEQKASMESDILPSGQHVYPNMQIIFNLYAMGRMKS  409

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC EFKPERWIS +G IKHEPSYKF  FNAGPR+CLGK M   QMK + A I+ +Y
Sbjct  410  IWGDDCNEFKPERWISERGNIKHEPSYKFLTFNAGPRSCLGKNMAFTQMKAVVATIVQNY  469

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            +FQ +    V P  S++++ K+G KVK  K
Sbjct  470  KFQAIQGQLVVPDISLMLRMKNGFKVKVCK  499



>emb|CAB44684.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80612.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=479

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CES RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  326  QELKKLVYLHGAICESLRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKS  385

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  G   HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +Y
Sbjct  386  VWGEDALEFKPERWISESGNSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKSVAVKIIQNY  445

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+   + P+ S+I+  KHGLKV  TKR
Sbjct  446  EMKIVEGQQIEPAPSVILHMKHGLKVTVTKR  476



>gb|KEH40835.1| cytochrome P450 family protein [Medicago truncatula]
Length=508

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGA+CE+ RL+PPV  EH  +   D+LPSG  V PNTR++ S Y+ GRM+ 
Sbjct  356  EYLDKLVYLHGAICEALRLYPPVPFEHICAIKSDILPSGERVSPNTRLLYSLYAMGRMEQ  415

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDCMEFKPERW+S  G I H PSYKF AFN GPR+CLGK++  +QMKM+AA +L ++
Sbjct  416  IWGEDCMEFKPERWVSETGHIIHVPSYKFIAFNTGPRSCLGKDLSFIQMKMVAAALLQNF  475

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              ++V+ H V+P  S ++  K+GLKVK TKR
Sbjct  476  HIKIVEGHPVTPKISFVLHMKYGLKVKVTKR  506



>ref|XP_010446494.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=519

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            ++ +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  366  QDVKKLVYLHGAICEALRLYPPVPFQHKSPTEPDVLPSGHKVDANSKILFCLYSLGRMKS  425

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  426  VWGEDAFEFKPERWISESGRSLHEPSYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  485

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            EFQVV+ H + P+ S+I+  KHGLKV  +KR
Sbjct  486  EFQVVEGHKIEPAPSVILHMKHGLKVTVSKR  516



>gb|KEH40823.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +  KLVYLHGA+CE+ RL+PPV  EH  +   D+LPSG+ V PNT +I S YS GRM+ I
Sbjct  358  DLDKLVYLHGAICETLRLYPPVPFEHICAIKSDILPSGYHVTPNTTLIYSLYSMGRMEQI  417

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGEDCMEFKPERWIS +G I H PSYKF AFN GPR C+GK++  +QMKM+AA +L  + 
Sbjct  418  WGEDCMEFKPERWISERGDIIHVPSYKFIAFNTGPRICIGKDISFIQMKMVAAALLRKFH  477

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
             QVV+ H V+P  S+ ++ KHGLKV+ +KR+
Sbjct  478  IQVVEGHPVTPRLSVFLRMKHGLKVEVSKRS  508



>gb|KEH40821.1| cytochrome P450 family protein [Medicago truncatula]
Length=504

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE  KLVYLHGA+CE+ RL+P VA +HK +   D LPSG  V PNT++I S Y+ GRM+
Sbjct  351  VEELDKLVYLHGAICEALRLYPSVAFQHKCAIKSDKLPSGDHVSPNTKLIYSLYAMGRME  410

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDC+EFKPERWIS +G+I   PSYKF AFNAGPR+CLGK++  +QMKM+AA +L  
Sbjct  411  QIWGEDCLEFKPERWISDRGQIIQVPSYKFIAFNAGPRSCLGKDISFLQMKMVAAAVLFK  470

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  QVV+ HS+ P  SI+++ +HG KVK  KR
Sbjct  471  FHIQVVEGHSIIPRVSILLRMEHGFKVKIRKR  502



>gb|KHN19678.1| Cytochrome P450 86B1 [Glycine soja]
Length=427

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV IE K +   D LPSGH V  NT ++ S Y+ GR +
Sbjct  275  IEEVKKLVYLHGALCEALRLFPPVPIERKQAIKDDTLPSGHRVNGNTMILFSLYAMGRCE  334

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EFKPERWIS +G + + P+YKF AFNAGPR CLGK++  VQMKM+AA IL  
Sbjct  335  EIWGKDCLEFKPERWISERGEVVYAPAYKFIAFNAGPRICLGKDLAFVQMKMVAASILRK  394

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y FQVV+ HS +PS SI++  K+GLK +  KR
Sbjct  395  YRFQVVEGHSPTPSHSIVLLMKNGLKARIMKR  426



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V  N++++L  YS GRM S
Sbjct  360  QELKKLVYLHGAICEALRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILLCLYSLGRMKS  419

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +Y
Sbjct  420  VWGEDALEFKPERWISESGRSVHEPSYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNY  479

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+   + P+ S+I+  KHG+KV  TK+
Sbjct  480  ELKIVEGQKIEPAPSVILHMKHGVKVTVTKK  510



>ref|XP_010027344.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62209.1| hypothetical protein EUGRSUZ_H04870 [Eucalyptus grandis]
Length=507

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   K+VYLHGA+CES RL+PP+ +  K     DVLPSGH V P  ++++  Y+ GRM S
Sbjct  355  EHMHKMVYLHGAICESLRLYPPIPLLPKCPTNPDVLPSGHKVDPGAKIVVHMYAMGRMKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC+EF+PERWI  +G I+H+PSYKF AFNAGPRTCLGK++   Q+KM+AA ++H+Y
Sbjct  415  IWGEDCLEFRPERWILERGGIRHQPSYKFVAFNAGPRTCLGKDVAFTQIKMVAATVIHNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  VV+ H V PS+SII+  KHGLKVK T+R
Sbjct  475  EVHVVEDHPVRPSNSIILHMKHGLKVKVTRR  505



>gb|KHN19669.1| Cytochrome P450 86B1 [Glycine soja]
Length=455

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV+IE K +   D LPSGH V  NT ++ S Y+ GR +
Sbjct  303  IEEVKKLVYLHGALCEALRLFPPVSIERKQAIKDDTLPSGHRVNGNTMILFSLYAMGRCE  362

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EFKPERWIS +G + + P+YKF AFNAGPR CLGK++  VQMKM+AA IL  
Sbjct  363  EIWGKDCLEFKPERWISERGEVVYAPAYKFIAFNAGPRICLGKDLAFVQMKMVAAAILRK  422

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y FQVV+ HS +PS SI++  K+GLK +  KR
Sbjct  423  YRFQVVEGHSPTPSHSIVLLMKNGLKARIMKR  454



>ref|XP_010681238.1| PREDICTED: cytochrome P450 86A1-like [Beta vulgaris subsp. vulgaris]
Length=160

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLH ALCE+ RL+PPV  + K     D+LPSGH V  N ++I + Y+ GRM S
Sbjct  9    EVNSKLVYLHAALCEALRLYPPVVFQAKSPIESDMLPSGHHVDRNRQIIFNLYAMGRMKS  68

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EFKPERWIS +G+I+HEPSYKF AFNAGPRTCLGK+M   QMK++AA I+ +Y
Sbjct  69   LWGEDCYEFKPERWISEQGKIRHEPSYKFLAFNAGPRTCLGKDMAFTQMKLVAATIIQNY  128

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
              + V+ H V PS SII+  K+G KV+  +
Sbjct  129  VIEAVEEHHVVPSISIILHMKYGFKVRVLR  158



>ref|XP_004157875.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=475

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 112/155 (72%), Gaps = 3/155 (2%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE   LVYLHGALCE+ RL+PP+A EHK     + LPSGH V+P TR++ S Y+ GRM 
Sbjct  321  IEELNNLVYLHGALCETLRLYPPIAFEHKSPVVAETLPSGHHVRPGTRILFSLYALGRMR  380

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WGEDC EFKPERWIS KG IK EPSYKF +FNAGPRTCLGK +   Q+K+++A I+H+
Sbjct  381  SVWGEDCEEFKPERWISDKGTIKREPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIVHN  440

Query  289  YEFQvvdshsvsp---sdsiiIQAKHGLKVKFTKR  194
            Y+ + VD    +    + S+I+  K G +VK +KR
Sbjct  441  YDIEAVDEDINNVVVPAASVILHMKSGFRVKVSKR  475



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  360  QELKKLVYLHGAICEALRLYPPVPFQHKSPTEADVLPSGHKVDANSKILFCLYSLGRMKS  419

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG+D +EFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +Y
Sbjct  420  VWGDDALEFKPERWISESGRSVHEPSYKFLSFNAGPRTCLGKEVALMQMKTVAVKIIQNY  479

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+   + P+ S+I+  KHG+KV  TKR
Sbjct  480  EMKIVEGQKIEPAPSVILHMKHGVKVTVTKR  510



>ref|XP_010027335.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62199.1| hypothetical protein EUGRSUZ_H04857 [Eucalyptus grandis]
Length=507

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGA+CES RL+PP+  + K  A  DVLPSGH V P T++I+  Y+ GR+ S
Sbjct  355  EHMHKLVYLHGAVCESLRLYPPLPFQRKCPAKPDVLPSGHEVDPGTKIIVVMYAMGRIKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGED +EFKPERWIS +G I+HEPSYKF AFNAGPRTCLGK++   Q+K +AA ++H+Y
Sbjct  415  IWGEDFLEFKPERWISERGGIRHEPSYKFVAFNAGPRTCLGKDVAFTQIKTVAATVIHNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  VV+ H V PS+ I++  KHGLKVK  +R
Sbjct  475  EVHVVEDHPVRPSNFIVLHMKHGLKVKLARR  505



>ref|XP_004142038.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=475

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 112/155 (72%), Gaps = 3/155 (2%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE   LVYLHGALCE+ RL+PP+A EHK     + LPSGH V+P TR++ S Y+ GRM 
Sbjct  321  IEELNNLVYLHGALCETLRLYPPIAFEHKSPVVAETLPSGHHVRPGTRILFSLYALGRMR  380

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WGEDC EFKPERWIS KG IK EPSYKF +FNAGPRTCLGK +   Q+K+++A I+H+
Sbjct  381  SVWGEDCEEFKPERWISDKGTIKREPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIVHN  440

Query  289  YEFQvvdshsvsp---sdsiiIQAKHGLKVKFTKR  194
            Y+ + VD    +    + S+I+  K G +VK +KR
Sbjct  441  YDIEAVDEDINNVVVPAASVILHMKSGFRVKVSKR  475



>ref|XP_010681074.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE  KL YLH ALCE  RL+PPV  +HK     + LPSGH V P T+++ S Y+ GRM 
Sbjct  357  IEETNKLTYLHAALCECLRLYPPVPFQHKSPIQPETLPSGHHVNPKTKVLFSLYAMGRMK  416

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDC EFKPERWI+ +G+IK+EP YKF +FNAGPRTCLGKE+   Q+KM++A ++H+
Sbjct  417  GIWGEDCFEFKPERWITKEGKIKYEPPYKFLSFNAGPRTCLGKEVAFTQLKMVSATLIHN  476

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+F VV      P  SI++  KHGLKVK + R
Sbjct  477  YKFHVVHGQHAEPDMSIVLHMKHGLKVKVSNR  508



>ref|XP_008440137.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=434

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 112/155 (72%), Gaps = 3/155 (2%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E   LVYLHGALCE+ RL+PP+A EHK     + LPSGH V+P  R++ S Y+ GRM 
Sbjct  280  IQELNNLVYLHGALCETLRLYPPIAFEHKSPVEAETLPSGHHVRPGMRILFSLYALGRMR  339

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WGEDC EFKPERWIS KG IK EPSYKF +FNAGPRTCLGK +   Q+K+++A I+H+
Sbjct  340  SVWGEDCEEFKPERWISDKGTIKREPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIIHN  399

Query  289  YEFQvvdshsvsp---sdsiiIQAKHGLKVKFTKR  194
            Y+ + VD  S +    + S+I+  K G +VK TKR
Sbjct  400  YDIEAVDEDSNNAVAPAASVILHMKSGFRVKVTKR  434



>ref|XP_010025513.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62205.1| hypothetical protein EUGRSUZ_H04866 [Eucalyptus grandis]
Length=507

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   K+VYLHGA+CES RL+PPV   HK  A  DVLPSGH V P+ ++++  Y+ GRM S
Sbjct  355  EHMHKMVYLHGAICESLRLYPPVPFLHKCPANPDVLPSGHKVDPSAKIVVHTYAMGRMKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC+EF+PERWIS +G I+H+PSYKF AF  GPRTCLGK++   Q+KM+ A ++H+Y
Sbjct  415  IWGEDCLEFRPERWISERGGIRHQPSYKFIAFGDGPRTCLGKDVAFTQIKMVTATVIHNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  VV+ H V PS+S+I+  KHGLKVK  +R
Sbjct  475  EVHVVEHHPVRPSNSVILNMKHGLKVKLARR  505



>gb|KEH40805.1| cytochrome P450 family protein [Medicago truncatula]
Length=498

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  637  QKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWG  458
             KLVYLHGA+CE+ RL+PP+  EHK +   D+LPSG  V PNT++I S Y+ GRM+ IWG
Sbjct  349  DKLVYLHGAICEALRLYPPIPFEHKCAIKSDILPSGDHVSPNTKLIYSLYAMGRMEQIWG  408

Query  457  EDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQ  278
            EDC+EFKPERWIS++G I   PSYKF AFNAGPR+C+GK++  VQMKM+AA +L  +  +
Sbjct  409  EDCLEFKPERWISNRGEIIQVPSYKFIAFNAGPRSCIGKDISFVQMKMVAANVLWKFHIE  468

Query  277  vvdshsvspsdsiiIQAKHGLKVKFTKR  194
            VV+ H V+P  +++++ KHGLKVK ++R
Sbjct  469  VVEGHFVTPRVAMVLRMKHGLKVKVSQR  496



>gb|KEH22136.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = -2

Query  634  KLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWGE  455
            KLVYLHGALCE+ RL+PP+  EHK +   DVLPSGH V+ NT ++ S YS GR++ IWGE
Sbjct  348  KLVYLHGALCEALRLYPPIPFEHKSAQKSDVLPSGHRVESNTMIVYSLYSVGRVEEIWGE  407

Query  454  DCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQv  275
            DC+EFKPERWIS KG I + PSYKF AFNAGPR+CLGK++  ++MKM+A  IL +Y  QV
Sbjct  408  DCLEFKPERWISQKGGIVYVPSYKFIAFNAGPRSCLGKDISFIEMKMVAIAILLNYHIQV  467

Query  274  vdshsvspsdsiiIQAKHGLKVKFTKRN  191
            V+ H + PS S+++  KHGLKV   KR+
Sbjct  468  VEDHPIIPSLSVVLHMKHGLKVNLKKRS  495



>ref|XP_007150922.1| hypothetical protein PHAVU_004G005900g [Phaseolus vulgaris]
 gb|ESW22916.1| hypothetical protein PHAVU_004G005900g [Phaseolus vulgaris]
Length=509

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KLVYLHGA+CES RLFPP+  E K +   D+LPSGH V P+T ++   YS GR +
Sbjct  356  VEEVKKLVYLHGAICESLRLFPPIPFERKEALKSDLLPSGHGVNPSTVILFFLYSMGRSE  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDCMEFKPERWIS KG I + PSYKF AFN GPRTCLGK++  +Q+KM+A  ILH 
Sbjct  416  EIWGEDCMEFKPERWISEKGGIVYVPSYKFVAFNTGPRTCLGKDVSFIQIKMVATAILHK  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+ +   P+ SI++  K GLKV   KR
Sbjct  476  YRLQVVEGYVAKPNLSIVLLIKDGLKVTIKKR  507



>ref|XP_002869292.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45551.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGALCE+ RL+PPV+   K     DVLPSGH V  N+++I+  Y+ GRM +
Sbjct  353  ENVDKLVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPSGHKVDANSKIIICLYALGRMRA  412

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  +FKPERWIS  G IKHEPSYKF AFNAGPRTCLGK + + QMK++A +IL +Y
Sbjct  413  VWGEDATQFKPERWISENGGIKHEPSYKFLAFNAGPRTCLGKHLAMTQMKIMAVVILRNY  472

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
            + +V+    + P+   I+  KHGLK+  TKR +A
Sbjct  473  DIKVLQGQKIVPALGFILSMKHGLKITVTKRCSA  506



>ref|XP_009400927.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=541

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             EE  KLVYLH ALCES RLFPPV  EHK +   ++LPSGH V+  T++++S YS GRM+
Sbjct  383  TEELSKLVYLHAALCESLRLFPPVPFEHKAALRHEILPSGHRVEAGTKILVSLYSMGRME  442

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EF+PERWIS KGR++HEPSYKF  FN+GPRTCLGKE+   QMK + A ++++
Sbjct  443  GIWGKDCLEFRPERWISEKGRVRHEPSYKFMPFNSGPRTCLGKEVAFTQMKAVVAAMVYN  502

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            ++ QV+  H V P  SII+  K+GL+VK  +R
Sbjct  503  FQVQVLPGHVVEPKLSIILHLKNGLRVKIKRR  534



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CES RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  366  QELKKLVYLHGAICESLRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKS  425

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  G   HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +Y
Sbjct  426  VWGEDALEFKPERWISESGNSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKSVAVKIIQNY  485

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+   + P+ S+I+  KHGLKV  TKR
Sbjct  486  EMKIVEGQQIEPAPSVILHMKHGLKVTVTKR  516



>ref|XP_004489211.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=505

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
             + +KLVYLHGA+CE+ RLFPPV  E K     D+LPSGH++ PNT ++ S Y  GR + 
Sbjct  353  NDLKKLVYLHGAICETLRLFPPVPFERKQVVKGDILPSGHIIDPNTMVLFSLYLMGRFED  412

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC+EFKPERWIS +G+I H+PSYKF  FNAGPRTCLGK+   +Q+KMIA  IL +Y
Sbjct  413  IWGKDCLEFKPERWISERGKIVHQPSYKFSIFNAGPRTCLGKDFSFIQLKMIATSILCNY  472

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
               VV  H  +PS SII+ +K+GLKV+ TKR  
Sbjct  473  RVHVVQGHIPTPSHSIILHSKNGLKVRITKRQN  505



>ref|XP_004151610.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48431.1| hypothetical protein Csa_6G487520 [Cucumis sativus]
Length=521

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE  KLVYLH  L E+ RL+PP+  +HKVS   DVLPSGH +KP T+++ S Y+ GRM  
Sbjct  368  EEVDKLVYLHATLYETLRLYPPLPFQHKVSVHHDVLPSGHHIKPKTKILFSLYALGRMSE  427

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG+DC EFKPERWIS  G+IKH PSYKF AFNAGPRTCLGK++ L+ +K++AA I+++Y
Sbjct  428  VWGKDCFEFKPERWISENGKIKHVPSYKFLAFNAGPRTCLGKQVALIGVKIVAAAIIYNY  487

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
                   H V PS SII+  K GLKV+ TKR
Sbjct  488  NVIQQSGHEVVPSSSIILHMKRGLKVRVTKR  518



>ref|XP_004160507.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=521

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE  KLVYLH  L E+ RL+PP+  +HKVS   DVLPSGH +KP T+++ S Y+ GRM  
Sbjct  368  EEVDKLVYLHATLYETLRLYPPLPFQHKVSVHHDVLPSGHHIKPKTKILFSLYALGRMSE  427

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG+DC EFKPERWIS  G+IKH PSYKF AFNAGPRTCLGK++ L+ +K++AA I+++Y
Sbjct  428  VWGKDCFEFKPERWISENGKIKHVPSYKFLAFNAGPRTCLGKQVALIGVKIVAAAIIYNY  487

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
                   H V PS SII+  K GLKV+ TKR
Sbjct  488  NVIQQSGHEVVPSSSIILHMKRGLKVRVTKR  518



>ref|NP_195660.1| cytochrome P450, family 96, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
 emb|CAB44685.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80613.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE87079.1| cytochrome P450, family 96, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
Length=469

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGALCE+ RL+PPV+   K     DVLPSGH V+ N+++I+  Y+ GRM +
Sbjct  316  ENLDKLVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPSGHKVQANSKIIICLYALGRMRA  375

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG+D +EFKPERW+S KG ++HEPS+KF +FN+GPRTCLGK + + QMKM+A  ILH+Y
Sbjct  376  VWGDDALEFKPERWVSDKGSLRHEPSFKFLSFNSGPRTCLGKHLAMTQMKMVAVEILHNY  435

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E +V+    + P    I+  KHGL++  TKR
Sbjct  436  EIKVIKGQKIKPVLGFILSMKHGLRITITKR  466



>ref|XP_002888363.1| hypothetical protein ARALYDRAFT_338681 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64622.1| hypothetical protein ARALYDRAFT_338681 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +  KLVYLHGA+CE+ RL+PPV   HK  A  DVLPSGH V  N ++++S Y+ GRM S+
Sbjct  107  DLDKLVYLHGAVCETLRLYPPVPFNHKSPAKPDVLPSGHKVDENWKIVISMYALGRMKSV  166

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+D  +F+PERWIS  GR+KHEPSYKF AFNAGPR CLGK++  +QMK +AA I+ +Y+
Sbjct  167  WGDDAEDFRPERWISYSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYD  226

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTK  197
             +VV+ H   P  S++ + +HGLKV  TK
Sbjct  227  IKVVEGHKTEPVPSVLFRMQHGLKVNITK  255



>gb|EPS65366.1| hypothetical protein M569_09411 [Genlisea aurea]
Length=503

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 115/153 (75%), Gaps = 1/153 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE ++LVYL GAL ES RLFPPVA+EHK  A  D LP+G  VK + R+I SFY+ GRM+S
Sbjct  350  EESRRLVYLQGALSESLRLFPPVALEHKAPAEDDTLPTGTRVKKDGRIIFSFYTMGRMES  409

Query  466  IWGEDCMEFKPERWISSK-GRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            IWG+D  EF+PERWIS K G + H PS+ FPAFNAGPRTCLGK+M  +QMKM AA IL  
Sbjct  410  IWGKDWPEFRPERWISDKIGGVVHVPSFHFPAFNAGPRTCLGKDMAFIQMKMAAAAILFR  469

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y  ++V +   SP D++I+Q++HGLKV  +KR+
Sbjct  470  YRVELVGNFETSPRDAVILQSRHGLKVTLSKRH  502



>ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KLVYLHGA+CE+ RLFPP+  E K++   DVLPSGH V   T ++ S Y+ GR +
Sbjct  349  VEEVKKLVYLHGAICEALRLFPPIPFERKLAIKADVLPSGHSVNSRTMILFSLYAMGRFE  408

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
              WG+DC+EFKPERWIS K  I + PSYKF AFNAGPRTCLGK++   QMKM+AA IL +
Sbjct  409  ETWGKDCLEFKPERWISEKRSIVYVPSYKFIAFNAGPRTCLGKDLSFFQMKMVAAAILSN  468

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+ +  +PS SI++  K GLKVK TKR
Sbjct  469  YRVQVVEGYVATPSLSIVLLMKDGLKVKITKR  500



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  366  QELKKLVYLHGAICEALRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKS  425

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  G   HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +Y
Sbjct  426  VWGEDALEFKPERWISESGNSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNY  485

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+   + P+ S+I+  KHGLKV  TKR
Sbjct  486  EMKIVEGQQIEPAPSVILHMKHGLKVTVTKR  516



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E + LVYLHGALCE+ RL+PPV  +HK      +LPSGH V P  +++ S Y+ GRMD
Sbjct  354  VDELRNLVYLHGALCEALRLYPPVPFQHKAPIQPVMLPSGHYVHPKMKILFSLYAMGRMD  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+D  EFKPERWI+ +G IK+EPSYKF AFNAGPRTCLGKE+   Q+K +AA I+H+
Sbjct  414  YIWGKDSKEFKPERWITDRGTIKYEPSYKFLAFNAGPRTCLGKEVAFTQLKAVAAAIIHN  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            Y+ +VV  H V+P+ S+I+  KHGLKV+ +KR T
Sbjct  474  YQVEVVKGHIVTPNVSVILYMKHGLKVRISKRWT  507



>emb|CDP12889.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E + LVY+H ALCES RL+PPV  +HK     D LPSGH V P  ++I S Y+ GRM 
Sbjct  336  VDELKNLVYIHAALCESMRLYPPVPFQHKFPLQPDTLPSGHRVHPKIKVIFSLYAMGRMK  395

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+D  EFKPERWIS +G IKHEPSYKF AFNAGPRTCLGKE+   QMK +AA ++H+
Sbjct  396  FIWGKDSWEFKPERWISERGTIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAMIHN  455

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  ++V+ H V P+ S+I+  KHGLKV+ +KR
Sbjct  456  YNVEMVEGHPVVPNLSVILYMKHGLKVRVSKR  487



>ref|XP_006446605.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
 gb|ESR59845.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
Length=509

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  ++VYLH ALCE+ RL+PPV   HK++A  DVLPSGH +  N  +++S+Y+ GRM+ 
Sbjct  356  KEVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEV  415

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC+EFKPERWI+ KG I H PSYKF AF+AGPR CLGK+   +QMKM+AA+IL +Y
Sbjct  416  IWGKDCLEFKPERWITEKGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNY  475

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            + ++V  H VSP +S+++  K+GLKV+ +KR 
Sbjct  476  QVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRT  507



>ref|XP_006427987.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
 ref|XP_006464489.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 ref|XP_006495173.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|ESR41227.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
Length=508

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             ++  +LVYLHGALCE+ RL+PPV  +HKV    D LPSGH   P T+++ S Y+ GRM 
Sbjct  354  TQKLNQLVYLHGALCEALRLYPPVPFQHKVPLVPDTLPSGHRAVPRTKILFSLYAMGRMK  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWGEDC+EF+PERWIS  G IK EPSYKF +FNAGPRTCLGKE+   QMK +AA ++H+
Sbjct  414  SIWGEDCLEFRPERWISESGGIKWEPSYKFFSFNAGPRTCLGKEVAFTQMKAVAAGVIHN  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y+ QVV+     P+ SII+  KHGLKV+   R
Sbjct  474  YDIQVVEGQRPGPNVSIILYMKHGLKVRVHDR  505



>gb|KDP46411.1| hypothetical protein JCGZ_10251 [Jatropha curcas]
Length=468

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE +KLVYLH  +CE  RL+PPV  EHK S   DVLPSGH V  N R++ S YS GRM  
Sbjct  313  EELKKLVYLHATICEVLRLYPPVPFEHKTSIKPDVLPSGHHVPENMRILYSLYSMGRMKD  372

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC+EF+PERWIS KGRIKH PSYKF AFN+GPRTCLGK++  +++K +A+ +L +Y
Sbjct  373  IWGEDCLEFRPERWISEKGRIKHFPSYKFIAFNSGPRTCLGKDLAFIKLKTVASAVLWNY  432

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              ++V+ H +SP  S+I+    GLKVK +KR
Sbjct  433  SLRIVEDHHISPKISVILYMDKGLKVKVSKR  463



>gb|EYU31098.1| hypothetical protein MIMGU_mgv1a004607mg [Erythranthe guttata]
Length=518

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = -2

Query  649  VEE-CQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRM  473
            VEE   K VYLHGALCE+ RL+PPV  +HK     D+LPSGH V P  +++   Y+ GRM
Sbjct  364  VEEITNKAVYLHGALCEALRLYPPVPFQHKEPNQPDILPSGHYVHPEMKVMFFLYAMGRM  423

Query  472  DSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
            +S+WG+DC+EFKPERWI+ +G IKHEPSYKF AFNAGPRTCLGKE+  VQMKM+AA I++
Sbjct  424  ESVWGKDCLEFKPERWITERGSIKHEPSYKFLAFNAGPRTCLGKEVAFVQMKMVAATIIY  483

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +Y  +VVD H V P+ S+I+  + GLKV+ +KR
Sbjct  484  NYRVRVVDGHRVEPNCSVILYMRDGLKVRVSKR  516



>gb|KGN48430.1| hypothetical protein Csa_6G487020 [Cucumis sativus]
Length=516

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 112/155 (72%), Gaps = 3/155 (2%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE   LVYLHGALCE+ RL+PP+A EHK     + LPSGH V+P TR++ S Y+ GRM 
Sbjct  362  IEELNNLVYLHGALCETLRLYPPIAFEHKSPVVAETLPSGHHVRPGTRILFSLYALGRMR  421

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WGEDC EFKPERWIS KG IK EPSYKF +FNAGPRTCLGK +   Q+K+++A I+H+
Sbjct  422  SVWGEDCEEFKPERWISDKGTIKREPSYKFFSFNAGPRTCLGKGVAFSQLKIVSAAIVHN  481

Query  289  YEFQvvdshsvsp---sdsiiIQAKHGLKVKFTKR  194
            Y+ + VD    +    + S+I+  K G +VK +KR
Sbjct  482  YDIEAVDEDINNVVVPAASVILHMKSGFRVKVSKR  516



>gb|KEH24772.1| cytochrome P450 family protein [Medicago truncatula]
Length=517

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E +KLVYLHGA+CE+ RLFPP+  E K +   D+LPSGH V PN  +  S YS GR  
Sbjct  364  VDEVKKLVYLHGAICEALRLFPPIPFERKQAIEADILPSGHHVFPNKMVFFSLYSMGRDA  423

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWGEDC+EFKPERWIS +G I + PSYKF +FNAGPRTCLG+E+ L+Q+KMIAA IL +
Sbjct  424  NIWGEDCLEFKPERWISERGGIVYAPSYKFFSFNAGPRTCLGRELALIQVKMIAASILWN  483

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y   VV  H V+PS SI++  KHGLKVK +KR
Sbjct  484  YCVHVVGDHQVTPSLSIVLLMKHGLKVKISKR  515



>ref|XP_002888362.1| hypothetical protein ARALYDRAFT_894004 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64621.1| hypothetical protein ARALYDRAFT_894004 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +  KLVYLHGA+CE+ RL+PPV   HK  A  DVLPSGH V  N ++++S Y+ GRM S+
Sbjct  60   DLDKLVYLHGAVCETLRLYPPVPFNHKSPAKPDVLPSGHKVDENWKIVISMYALGRMKSV  119

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+D  +F+PERWIS  GR+K EPSYKF AFNAGPR CLGK++  +QMK +AA I+ +Y+
Sbjct  120  WGDDAEDFRPERWISYSGRLKQEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYD  179

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTK  197
             +VV+ H   P  S++ + +HGLKV  TK
Sbjct  180  IKVVEGHKTEPVPSVLFRMQHGLKVNITK  208



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV IE K +   D LPSGH V  NT ++ S Y+ GR +
Sbjct  350  IEEVKKLVYLHGALCEALRLFPPVPIERKQAIKDDTLPSGHRVNGNTMILFSLYAMGRCE  409

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EFKPERWIS +G + + P+YKF AFNAGPR CLGK++  VQMKM+AA IL  
Sbjct  410  EIWGKDCLEFKPERWISERGEVVYAPAYKFIAFNAGPRICLGKDLAFVQMKMVAASILRK  469

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y FQVV+ HS +PS SI++  K+GLK +  KR
Sbjct  470  YRFQVVEGHSPTPSHSIVLLMKNGLKARIMKR  501



>gb|KEH40818.1| cytochrome P450 family protein [Medicago truncatula]
Length=507

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE+  KL+YLHGA+CE+ RL+PPV IE K +   D+LPSG  V PNTR++   YS GRM+
Sbjct  354  VEKLDKLIYLHGAICEALRLYPPVPIEQKFAIKADILPSGVHVSPNTRILYYLYSMGRME  413

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDCMEFKPERWIS  G+I H PSYKF AFNAGPR+CLGK++  V+MKM AA IL  
Sbjct  414  KIWGEDCMEFKPERWISKSGQIIHVPSYKFIAFNAGPRSCLGKDITFVEMKMAAAAILWK  473

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +   +VD H V+P  SI +  KHGLKV  TKR
Sbjct  474  FCIHLVDGHPVTPRLSITLGMKHGLKVIVTKR  505



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V+ N++++   YS GRM +
Sbjct  362  QELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVEANSKILFCLYSLGRMKT  421

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERW+S  G+  HEPSYKF +FNAGPRTCLGKE+ L QMK +A  I+ +Y
Sbjct  422  VWGEDALEFKPERWVSESGKSVHEPSYKFLSFNAGPRTCLGKEVALTQMKSVAVKIIQNY  481

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            E ++V+   + P+ S+I+  KHGLKV  TK
Sbjct  482  EIKMVEGQKIEPAPSVILHTKHGLKVTVTK  511



>gb|KEH40822.1| cytochrome P450 family protein [Medicago truncatula]
Length=512

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE+  KLVYLHGA+CE+ RL+PPV  +HK +   D+LPSG  VKPNT++I S Y+ GRM 
Sbjct  361  VEKLNKLVYLHGAICEALRLYPPVPFQHKCAIKADILPSGDYVKPNTKLIYSLYAMGRMK  420

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+D  EFKPERWIS KG I H PS KF AFNAGPR+CLGK++ +VQMKM+AA +L  
Sbjct  421  QIWGKDRFEFKPERWISDKGHILHVPSCKFIAFNAGPRSCLGKDISIVQMKMVAAAMLWK  480

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  QVV+ HSV+P  SI+++ +HG KVK +KR
Sbjct  481  FHIQVVEGHSVTPRVSIVLRMEHGFKVKVSKR  512



>ref|XP_006283543.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
 gb|EOA16441.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
Length=518

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CES RL+PPV  +HK     DVLPSGH V+  ++++   YS GRM S
Sbjct  365  QEIKKLVYLHGAICESLRLYPPVPFQHKSPTKPDVLPSGHKVEAKSKILFCLYSLGRMKS  424

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  425  VWGEDALEFKPERWISESGRSIHEPSYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  484

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E QVV+ H + P+ S+I+  KHGLKV  +K+
Sbjct  485  EIQVVEGHKIEPAPSVILHMKHGLKVTVSKK  515



>ref|NP_176086.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
 sp|Q9FVS9.1|C96AF_ARATH RecName: Full=Alkane hydroxylase MAH1; AltName: Full=Cytochrome 
P450 96A15; AltName: Full=Protein MID-CHAIN ALKANE HYDROXYLASE 
1 [Arabidopsis thaliana]
 gb|AAG50737.1|AC079733_5 cytochrome P450, putative [Arabidopsis thaliana]
 gb|AAL31942.1|AF419610_1 At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AAM13991.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAO64745.1| At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AEE33458.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
Length=497

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E+ +KLVYLH AL ES RL+PP+   HK  A  DVLPSGH V  N+++++  Y+ GRM S
Sbjct  346  EDLEKLVYLHAALSESMRLYPPLPFNHKSPAKPDVLPSGHKVDANSKIVICIYALGRMRS  405

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED ++FKPERWIS  G ++HEPSYKF AFN+GPRTCLGK + L+QMKM+A  I+ +Y
Sbjct  406  VWGEDALDFKPERWISDNGGLRHEPSYKFMAFNSGPRTCLGKNLALLQMKMVALEIIRNY  465

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +F+V++ H V P  SI+++ KHGLKV  TK+
Sbjct  466  DFKVIEGHKVEPIPSILLRMKHGLKVTVTKK  496



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V+ N++++   YS GRM +
Sbjct  362  QELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVEANSKILFCLYSLGRMKT  421

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERW+S  G+  HEPSYKF +FNAGPRTCLGKE+ L QMK +A  I+ +Y
Sbjct  422  VWGEDALEFKPERWVSESGKSVHEPSYKFLSFNAGPRTCLGKEVALTQMKSVAVKIIQNY  481

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            E ++V+   + P+ S+I+  KHGLKV  TK
Sbjct  482  EIKMVEGQKIEPAPSVILHTKHGLKVTVTK  511



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE  KLVYLHGA+CE+ RL+P V   ++VS   D LPSGHLVK NT+++ S YS G M+
Sbjct  365  LEELNKLVYLHGAICETLRLYPAVPFNYRVSVEADTLPSGHLVKANTKVMFSLYSMGSME  424

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+ FKPERWIS +G I H PSYK+ AFN GPR+CLGKE+  +QMK IA  IL +
Sbjct  425  EIWGDDCLAFKPERWISERGGIIHVPSYKYIAFNTGPRSCLGKEITFIQMKTIATAILMN  484

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  QVV+ H VSP  S+++  KHGLK++ TKR
Sbjct  485  FHLQVVEGHPVSPGLSVMLHMKHGLKLRVTKR  516



>ref|XP_002866852.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43111.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = -2

Query  637  QKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWG  458
            +KLVYLHGA+CE+ RL+PPV   HK     DVLPSGH VK N++++   YS GRM S+WG
Sbjct  365  KKLVYLHGAICEALRLYPPVPFNHKSPTKPDVLPSGHKVKANSKILFCLYSLGRMKSVWG  424

Query  457  EDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQ  278
            ED +EFKPERWIS  GR  HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +YE  
Sbjct  425  EDALEFKPERWISESGRSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEIN  484

Query  277  vvdshsvspsdsiiIQAKHGLKVKFTKR  194
            VV+ H + P+ S+I+  KHGLKV  +KR
Sbjct  485  VVEGHKIKPAPSVILHMKHGLKVTVSKR  512



>ref|XP_010510801.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=500

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            + +KLVYLH  L E+ RL+PPV   HK  A  DVLPSGH V+ N+++I+S Y+ GRM S+
Sbjct  350  DLEKLVYLHAVLSETLRLYPPVPFNHKSPAKSDVLPSGHKVEANSKIIISVYALGRMRSV  409

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGED  +FKPERWIS KGR++ EPSYKF AFN+GPRTCLGK + L QMK++A  I+ +YE
Sbjct  410  WGEDASDFKPERWISDKGRLRQEPSYKFLAFNSGPRTCLGKNLALSQMKIVAVNIIRNYE  469

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            F++V+   +    S+I+  KHGLKV  +K  
Sbjct  470  FKIVEGQKIEQGASMILSMKHGLKVTVSKNT  500



>gb|KHM99046.1| Cytochrome P450 86B1 [Glycine soja]
Length=448

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE  KLVYLHGA+CE+ RLFP +  +HK +   D+LPSGH V PNT ++ S YS GRM+
Sbjct  295  VEEFGKLVYLHGAICEALRLFPSIPFDHKCAIKSDILPSGHHVSPNTMILYSLYSMGRME  354

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+D ++FKPERWIS +G I H PSYKF AFNAGPR+CLGK++ L++MKM+A  +L  
Sbjct  355  QIWGDDYLDFKPERWISERGNIIHIPSYKFIAFNAGPRSCLGKDVTLIEMKMVAVALLWR  414

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            +  QVV+ H ++P  S+I+  +HGLKVK T+R T
Sbjct  415  FHMQVVEGHPITPRLSMILAMEHGLKVKVTERCT  448



>ref|XP_002529227.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33140.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E   LVYLHGA CES RL+PPV  +HK     DVLPSGH V P+ ++I   YS GRM S
Sbjct  353  QELNSLVYLHGAFCESLRLYPPVPFQHKAPLREDVLPSGHKVSPDMKIIFCLYSMGRMAS  412

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC+EFKPERWI+  G+IKHEPSYKF AFNAGPRTCLGKE+  +QMK +AA +L++Y
Sbjct  413  IWGEDCLEFKPERWITG-GKIKHEPSYKFLAFNAGPRTCLGKEIAFIQMKTVAAFVLNNY  471

Query  286  EFQvvdshsvs-psdsiiIQAKHGLKVKFTKR  194
               +V+   VS  ++SII+  K+GLKV  ++R
Sbjct  472  NVHLVEGQHVSPATNSIILHMKYGLKVSVSRR  503



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE  KLVYLHGA+CE+ RL+P V   ++VS   D LPSGHLVK NT+++ S YS G M+
Sbjct  364  LEELNKLVYLHGAICETLRLYPAVPFNYRVSVEADTLPSGHLVKENTKVMFSLYSMGSME  423

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+ FKPERWIS +G I H PSYK+ AFN GPR+CLGKE+  +QMK IA  IL +
Sbjct  424  EIWGDDCLAFKPERWISERGGIIHVPSYKYIAFNTGPRSCLGKEITFIQMKTIATAILLN  483

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  QVV+ H VSP  S+++  KHGLK++ TKR
Sbjct  484  FHLQVVEGHPVSPGLSVMLHMKHGLKLRVTKR  515



>ref|XP_006411750.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
 gb|ESQ53203.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
Length=509

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   K+VYLHGALCE+ RL+PPVA E K S   DVLPSGH V  N+++I+  Y+ GRM +
Sbjct  356  ENLDKMVYLHGALCEAMRLYPPVAFERKSSIEPDVLPSGHKVDANSKIIICLYALGRMRA  415

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED ++FKPERWI+  G +KHEPS+KF AFNAGPRTCLGK++ + QMK++   IL +Y
Sbjct  416  VWGEDALQFKPERWITENGGLKHEPSFKFLAFNAGPRTCLGKQLAMTQMKIVVVEILQNY  475

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + +V+    + P    I+  KHGL+V  T+R
Sbjct  476  DIKVIKGQKIEPVLGFILSMKHGLRVTITQR  506



>gb|KHN27468.1| Cytochrome P450 86B1 [Glycine soja]
Length=464

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE ++LVYLHGA+CE+ RLFPP+  E K +   D+LPSGH V   T ++ S Y+ GR +
Sbjct  311  VEEVKRLVYLHGAICEALRLFPPIPFERKQAISSDMLPSGHRVNSGTMILFSLYAMGRFE  370

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
              WG+DC EFKPERWIS KG I + PSYKF AFNAGPRTCLGK+   +QMKM+A  ILH 
Sbjct  371  ETWGKDCFEFKPERWISEKGGIVYVPSYKFIAFNAGPRTCLGKDSSFIQMKMVATAILHK  430

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+    +PS SI++  K GLKV+ TKR
Sbjct  431  YRVQVVEGFVATPSLSIVLLMKDGLKVQITKR  462



>ref|XP_010681072.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGALCE+ RL+ PVA E K     D+LPSGH V PN ++I + Y+ GRM S
Sbjct  355  EANSKLVYLHGALCETLRLYAPVAFEAKAPMEPDILPSGHRVNPNMQIIFNLYAMGRMKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC EFKPERWIS++G I+HEPSYKF  FNAGPRTCLGKEM   QMK++AA ++  Y
Sbjct  415  IWGDDCNEFKPERWISAQGNIRHEPSYKFFVFNAGPRTCLGKEMAFTQMKVVAATMIQKY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKV  209
              +VVD   V P+ SI ++ KHG KV
Sbjct  475  VIEVVDERQVIPNMSIFLRMKHGFKV  500



>ref|XP_007150926.1| hypothetical protein PHAVU_004G006300g [Phaseolus vulgaris]
 gb|ESW22920.1| hypothetical protein PHAVU_004G006300g [Phaseolus vulgaris]
Length=503

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV IE K +   D LPSGH V  NT ++ S Y+ GR +
Sbjct  349  MEEVKKLVYLHGALCEALRLFPPVPIERKQAVKADTLPSGHRVNGNTMIMFSLYAMGRCE  408

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DCMEFKPERWIS +G I + P YKF AFNAGPR CLGK++  +QMKM+AA IL  
Sbjct  409  EIWGKDCMEFKPERWISERGEIVYAPPYKFIAFNAGPRICLGKDLAFLQMKMVAAAILRS  468

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y F+VV+ H  +PS SI++   +GLK   TKR 
Sbjct  469  YRFKVVEGHVATPSHSIVLLMNNGLKATITKRQ  501



>gb|KFK30509.1| hypothetical protein AALP_AA7G271200 [Arabis alpina]
Length=447

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV   HK     +VLPSGH V  N++++   YS GRM S
Sbjct  294  QELKKLVYLHGAICEALRLYPPVPFNHKSPTKSEVLPSGHKVDANSKILFCLYSLGRMKS  353

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  G+  HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +Y
Sbjct  354  VWGEDAFEFKPERWISESGKSIHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNY  413

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E +VV+ H + P+ S+I+  KHGLKV  +KR
Sbjct  414  EIKVVEGHKIEPAPSVILHMKHGLKVTVSKR  444



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E +KLVYLHGALCE+ RL+PPV  +HK     D LPSGH V P  +++ S Y+ GRM+
Sbjct  351  VDETKKLVYLHGALCEALRLYPPVPFQHKEPVEPDTLPSGHFVHPKMKVLFSLYAMGRME  410

Query  469  SIWGEDCMEFKPERWISSKGR-IKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
            SIWG+DC EFKPERWIS  GR ++HEPSYKF AFNAGPRTCLGKE+   QMK +AA ++H
Sbjct  411  SIWGKDCSEFKPERWISEGGRSVRHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAALIH  470

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +Y  +VVD H V P+ SII+  + GLKV+   R
Sbjct  471  NYRVRVVDGHRVVPNCSIILYMRDGLKVRVASR  503



>ref|XP_003556827.2| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=509

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE  KLVYLHGA+CE+ RLFP +  +HK +   D+LPSGH V PNT ++ S YS GRM+
Sbjct  356  VEEFGKLVYLHGAICEALRLFPSIPFDHKCAIKSDILPSGHHVSPNTMILYSLYSMGRME  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+D ++FKPERWIS +G I H PSYKF AFNAGPR+CLGK++ L++MKM+A  +L  
Sbjct  416  QIWGDDYLDFKPERWISERGNIIHIPSYKFIAFNAGPRSCLGKDVTLIEMKMVAVALLWR  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            +  QVV+ H ++P  S+I+  +HGLKVK T+R T
Sbjct  476  FHMQVVEGHPITPRLSMILAMEHGLKVKVTERCT  509



>ref|XP_010472324.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=235

 Score =   169 bits (427),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGALCES RL+PPV  +HK     D LPSGH V  +++++   YS GRM S
Sbjct  81   QELNKLVYLHGALCESLRLYPPVPFQHKSPTKPDELPSGHKVDASSKIVFCLYSLGRMKS  140

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERW+S  GR+ H PS+KF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  141  VWGEDASEFKPERWVSESGRLIHVPSFKFLSFNAGPRTCLGKEVAMAQMKTVAVKIIQNY  200

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            E +VV+ H + P  SII+  KHGLKV  TK
Sbjct  201  EIKVVEGHKIEPVPSIILHMKHGLKVTVTK  230



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLV+LHGA+CE+ RL+PPV  +HK     DVLPSGH V  N++++   YS GRM S
Sbjct  366  QELKKLVFLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVDANSKILFCLYSLGRMKS  425

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWIS  G+  HEPSYKF +FNAGPRTCLGKE+ L+QMK +A  I+ +Y
Sbjct  426  VWGEDALEFKPERWISESGKPVHEPSYKFLSFNAGPRTCLGKEVALMQMKSVAVKIIQNY  485

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+  ++ P+ S+I+  KHG KV  +KR
Sbjct  486  EMKIVEGQTIEPAPSVILHMKHGFKVTVSKR  516



>ref|XP_010429268.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=473

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 115/164 (70%), Gaps = 9/164 (5%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGALCES RL+PPV  +HK     DVLPSGH V  +++++   YS GRM S
Sbjct  319  QELNKLVYLHGALCESLRLYPPVPFQHKSPTKPDVLPSGHKVDASSKIVFCLYSLGRMKS  378

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERW+S  GR+ H PS+KF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  379  VWGEDASEFKPERWVSESGRLTHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  438

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA*HFVCICSFV  155
            + +VV+ H + P  SII+  KHGLKV+ TK         IC+FV
Sbjct  439  DIKVVEGHKIEPVPSIILHMKHGLKVRVTK---------ICNFV  473



>ref|XP_004515481.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=513

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE  KLVYLHGA+CE+ RL+PPV   HK +   D+LP+G  V  NT++I S Y+ GRM+
Sbjct  359  VEEFDKLVYLHGAICEALRLYPPVGYNHKCAIKSDILPNGEHVSSNTKVIFSMYAMGRME  418

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGE+C+EFKPERWIS  G+  H PSY+F AFNAGPR+CLGK+M ++QMKM A  +L  
Sbjct  419  EIWGENCLEFKPERWISDIGQSIHVPSYQFTAFNAGPRSCLGKDMSIIQMKMAAVTMLWK  478

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  QVV+  S++P  SI+++ +HG KVK TKR
Sbjct  479  FHIQVVEGQSITPRASIVLRMEHGFKVKLTKR  510



>ref|XP_007048137.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92294.1| Cytochrome P450 [Theobroma cacao]
Length=509

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE + LVYLHGALCE+ RL+PPV  +HK     D LPSGH V P T+++ S Y+ GRM S
Sbjct  357  EEVKNLVYLHGALCEALRLYPPVPFQHKEPLKPDSLPSGHPVYPKTKILFSLYALGRMKS  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EFKPERWI+ +G  KHEPSYKF +FNAGPRTCLGKE+  VQMK +A+ I+++Y
Sbjct  417  VWGEDCFEFKPERWITDRGGNKHEPSYKFLSFNAGPRTCLGKEVAFVQMKCVASAIIYNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              QV++   V P+ SII+  K+GL  + ++R
Sbjct  477  RIQVLEETPVVPAVSIILHTKNGLMARVSRR  507



>gb|KJB44293.1| hypothetical protein B456_007G244800 [Gossypium raimondii]
Length=499

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E + LVYLHGALCE+ RL+PPV  +HK     D LPSGH + P T+++ S YS GRM S
Sbjct  347  KEVKNLVYLHGALCEALRLYPPVPFQHKEPLKPDTLPSGHPIHPTTKIVFSLYSMGRMKS  406

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGEDC EFKPERWI+ KG IKHEPSYKF +FNAGPRTCLGK++  +QMK +A+ I+++Y
Sbjct  407  VWGEDCFEFKPERWITEKGGIKHEPSYKFMSFNAGPRTCLGKDVAFLQMKAVASAIIYNY  466

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
               V+    V P+ SII++ K GL  K + R
Sbjct  467  RIHVLGETPVVPTVSIILRTKDGLMTKISPR  497



>emb|CDM81752.1| unnamed protein product [Triticum aestivum]
Length=514

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            + ++LVYLH AL ES RL+PPV  EHK  A  D LPSG  V+P  R+I+SFYS GRM+S+
Sbjct  360  DLKRLVYLHAALSESLRLYPPVPFEHKAGARPDTLPSGPAVRPTRRVIVSFYSMGRMESV  419

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+DC+EF+PERW++++GR++HEPSYKF AFN GPRTCLGK++   QMK + A +L  + 
Sbjct  420  WGKDCLEFRPERWLTAEGRLRHEPSYKFVAFNVGPRTCLGKDLAFTQMKAVVAAVLPRFR  479

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
             +V     V P  SII+  K GLKV+  KR 
Sbjct  480  VEVAAGAVVRPKLSIILHMKDGLKVRVYKRQ  510



>gb|KEH40830.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -2

Query  637  QKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSIWG  458
             KLVYLHGA+CE+ RL+PP+  EH  +   D+LPSG  + PNT ++ S YS GRM+ +WG
Sbjct  360  DKLVYLHGAICETLRLYPPIPFEHICAIKSDILPSGERISPNTSLMYSMYSMGRMEQLWG  419

Query  457  EDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYEFQ  278
            EDCMEFKPERWIS +G I H PSYKF +FN GPR C+GK++  +QMKM+AA +L  +  Q
Sbjct  420  EDCMEFKPERWISERGDIIHVPSYKFISFNTGPRICIGKDLSFIQMKMVAAALLRKFHIQ  479

Query  277  vvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            VV+ H V+P  S+ ++ KHGLKV+ +KR+
Sbjct  480  VVEGHLVTPRLSVFLRMKHGLKVEVSKRS  508



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +E   KLVYLH A+CE+ RL+P + I HK+S   DVLPSGH V  NTR++   YS GRM+
Sbjct  355  LEALNKLVYLHAAICETLRLYPSIPINHKMSVEADVLPSGHRVPGNTRILYFLYSMGRME  414

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC EFKPERWI  KG+IKH PSYK+ AFNAGPRTCLGK++  +QMK++A+ I+ +
Sbjct  415  EIWGKDCSEFKPERWICEKGQIKHIPSYKYIAFNAGPRTCLGKDLTFLQMKIVASAIIWN  474

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVVD+   +P +S+++  K GLKV+ +KR
Sbjct  475  YSLQVVDNRPATPCNSVVLHMKGGLKVRVSKR  506



>ref|NP_001048917.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|ABF93893.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10831.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|EAZ25523.1| hypothetical protein OsJ_09347 [Oryza sativa Japonica Group]
Length=508

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  +LVYLH ALCES RL+PPV +EHK  A  DVLPSGH V+P  ++++S Y+ GRM+S
Sbjct  354  DETGRLVYLHAALCESLRLYPPVPMEHKGPAAADVLPSGHEVRPGDKIVVSLYAMGRMES  413

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG DCMEF+PERWIS  G++++ PSYKF +FN+GPRTCLGK+M  VQ+K  AA ++ ++
Sbjct  414  VWGSDCMEFRPERWISDDGKLRYVPSYKFMSFNSGPRTCLGKDMAFVQLKTAAAAVMKNF  473

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E + V  H V P  SII+  K+G  V+  +R
Sbjct  474  EIEAVAGHVVEPKLSIILHMKNGFMVRVKRR  504



>ref|XP_003524561.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=504

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE ++LVYLHGA+CE+ RLFPP+  E K +   D+LPSGH V   T ++ S Y+ GR +
Sbjct  351  VEEVKRLVYLHGAICEALRLFPPIPFERKQAISSDMLPSGHRVNSGTMILFSLYAMGRFE  410

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
              WG+DC EFKPERWIS KG I + PSYKF AFNAGPRTCLGK+   +QMKM+A  ILH 
Sbjct  411  ETWGKDCFEFKPERWISEKGGIVYVPSYKFIAFNAGPRTCLGKDSSFIQMKMVATAILHK  470

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVV+    +PS SI++  K GLKV+ TKR
Sbjct  471  YRVQVVEGFVATPSLSIVLLMKDGLKVQITKR  502



>gb|AGV40485.1| hypothetical protein [Phaseolus vulgaris]
Length=621

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +EE +KLVYLHGALCE+ RLFPPV IE K +   D LPSGH V  NT ++ S Y+ GR +
Sbjct  467  MEEVKKLVYLHGALCEALRLFPPVPIERKQAVKADTLPSGHRVNGNTMIMFSLYAMGRCE  526

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DCMEFKPERWIS +G I + P YKF AFNAGPR CLGK++  +QMKM+AA IL  
Sbjct  527  EIWGKDCMEFKPERWISERGEIVYAPPYKFIAFNAGPRICLGKDLAFLQMKMVAAAILRS  586

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y F+VV+ H  +PS SI++   +GLK   TKR 
Sbjct  587  YRFKVVEGHVATPSHSIVLLMNNGLKATITKRQ  619



>ref|XP_004513611.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=435

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +E+ +KLVY+HGA+CE+ RL+PP+  EHK +   D+LPSG  V PNT+++ S Y+ GRM+
Sbjct  282  MEKLEKLVYIHGAICEALRLYPPIPSEHKCAKKSDILPSGDHVSPNTKVMYSMYAMGRME  341

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DCMEFKPERWIS KG I   PSYKF AFNAGPR+CLGK+M  V MKMIA  +L  
Sbjct  342  QIWGKDCMEFKPERWISDKGVIIQVPSYKFIAFNAGPRSCLGKDMTFVHMKMIATAMLWK  401

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            + F VV+ H V+P  S++++ +HG KVK   R+
Sbjct  402  FHFHVVEPHRVTPKLSMVLRMEHGFKVKVNARS  434



>gb|KJB44331.1| hypothetical protein B456_007G246400 [Gossypium raimondii]
Length=507

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE + LVYLHGALCE+ RL+PPV  +HK     D+LPSGH V P  +++ S Y+ GR+ S
Sbjct  355  EEVKDLVYLHGALCEALRLYPPVPFQHKEPLKPDILPSGHPVHPTMKILFSLYAMGRIKS  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
             WGEDC+EFKPERWI+ +GRIKHEPSYKF +FNAGPRTCLGK++  +QMK +A+ I+++Y
Sbjct  415  FWGEDCLEFKPERWINERGRIKHEPSYKFMSFNAGPRTCLGKDVAFLQMKAVASAIIYNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
               V +   V P+ SII+  K+GL  + + R
Sbjct  475  RIHVSEETPVVPAVSIILHTKNGLMARISTR  505



>gb|KHM99045.1| Cytochrome P450 86B1 [Glycine soja]
Length=187

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            + E  KLVYLHGA+CE+ RLFP +  +HK +   D+L SGH V PNT +  S YS GRM+
Sbjct  34   IVEFGKLVYLHGAICEALRLFPSIPFDHKCTIKSDILLSGHHVSPNTMIFYSLYSMGRME  93

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDCMEFKP+RWIS +G I H P YKF  FNAGPR+CLGK++  ++MKM+A  +L  
Sbjct  94   RIWGEDCMEFKPKRWISERGNIIHIPFYKFIPFNAGPRSCLGKDITFIEMKMVAVALLWR  153

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  QVV+ H ++P  SI +  +HGLKVK T+R
Sbjct  154  FHMQVVEGHPITPRLSITLGTEHGLKVKVTER  185



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E + LVYLH ALCES RL+PPV  +HK  A   VLPSGH   P  +++ S Y+ GRM+ 
Sbjct  357  DEVRNLVYLHAALCESLRLYPPVPFQHKAPARPVVLPSGHYAGPEMKLLFSLYAMGRMEY  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+D  EFKPERWI+ +G +KHEPSYKF AFNAGPRTCLGKE+   Q+K +AA I+H+Y
Sbjct  417  IWGKDSGEFKPERWITERGTVKHEPSYKFLAFNAGPRTCLGKEVAFTQLKCVAAAIIHNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + +VV+ H+VSP+ SII+  K+GLKV+ TKR
Sbjct  477  QIEVVEGHNVSPNVSIILYMKYGLKVRVTKR  507



>ref|XP_007134109.1| hypothetical protein PHAVU_010G019600g [Phaseolus vulgaris]
 gb|ESW06103.1| hypothetical protein PHAVU_010G019600g [Phaseolus vulgaris]
Length=486

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE   +L YLH A+ E+ RL+PPV +EHK +   D+LPSGHL+K N R++ S YS GR +
Sbjct  333  VEWLSQLTYLHAAISETLRLYPPVPLEHKCALKSDILPSGHLIKSNARIVYSLYSMGRAE  392

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDC++F+PERWIS +G I H PSYKF AFNAGPR+CLGK++   ++KMIAA IL +
Sbjct  393  EIWGEDCLKFRPERWISKRGGIIHIPSYKFIAFNAGPRSCLGKDISYTEIKMIAAAILWN  452

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y   +V+  ++SP  S+I+  KHGLKV  TKR+
Sbjct  453  YRIHLVEGRAISPRVSVILHMKHGLKVTLTKRS  485



>gb|KEH24775.1| cytochrome P450 family protein [Medicago truncatula]
Length=505

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            ++E +KLVYLHGA+CE+ RLFPP+  E K +   D+LPSGH+V PNT ++   YS GR +
Sbjct  352  IDELKKLVYLHGAICEALRLFPPIPFERKQAIKGDILPSGHIVNPNTIILFFLYSMGRFE  411

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EFKPERWIS +G I H PSYKF ++NAGPRTCLGK++  +Q+KM    IL  
Sbjct  412  EIWGKDCLEFKPERWISERGGIVHTPSYKFISYNAGPRTCLGKDLSFIQIKMTTIAILSK  471

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  QVVD H    S SI++  K+GLKV+ TKR
Sbjct  472  YCVQVVDGHVPILSHSIVLLMKNGLKVRITKR  503



>gb|KEH24773.1| cytochrome P450 family protein [Medicago truncatula]
Length=517

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V++ +KLVYLHGA+CE+ RLFPP+  E K +   D+LPSGH V PN  ++ S Y+ GR +
Sbjct  364  VDDVKKLVYLHGAICEALRLFPPIPFERKEAVKPDILPSGHHVYPNNMILFSLYAMGRDE  423

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWG+DC+EFKPERWIS +G I + PSYKF +FNAGPRTCLG+E+  +Q+KM+AA +L +
Sbjct  424  NIWGKDCLEFKPERWISERGGIVYAPSYKFFSFNAGPRTCLGRELAFIQVKMVAASVLWN  483

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y   VV+ H V+P+ SI++  +HGLKVK TKR
Sbjct  484  YCVHVVEDHQVTPNLSIVLLMEHGLKVKITKR  515



>ref|NP_179899.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAK43908.1|AF370589_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAB87111.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAC42368.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07426.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVY+HGALCE+ RL+PPV  +HK     DVLPSGH V  +++++   YS GRM S
Sbjct  362  QELNKLVYVHGALCEALRLYPPVPFQHKSPTKSDVLPSGHRVDASSKIVFCLYSLGRMKS  421

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  GR+ H PS+KF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  422  VWGEDASEFKPERWISESGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  481

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            E +VV+ H + P  SII+  KHGLKV  TKR+ 
Sbjct  482  EIKVVEGHKIEPVPSIILHMKHGLKVTVTKRSN  514



>emb|CDY39928.1| BnaA09g15100D [Brassica napus]
Length=496

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            + +KLVYLH AL E+ RL+PP+   HK  A  DVLPSGH V+ N+++++  Y+ GRM SI
Sbjct  346  DLEKLVYLHAALSETMRLYPPLPFNHKSPAKPDVLPSGHKVEANSKIVICIYALGRMRSI  405

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGED ++FKPERWIS  G ++HEPSYKF AFNAGPR CLGK + L+QMK++A  I+  Y+
Sbjct  406  WGEDALDFKPERWISDSGNLRHEPSYKFMAFNAGPRACLGKNLALMQMKIVAVEIIQKYD  465

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            F+V     + P  S+I++ KHGL VK TK+
Sbjct  466  FEVTKGDKIKPVPSVILRMKHGLSVKVTKK  495



>emb|CDY46088.1| BnaA09g42120D [Brassica napus]
Length=516

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGALCE+ RL+PPV  +HK     DVLPSGH V P+T+++   YS GRM S
Sbjct  362  QELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHRVDPSTKIVFCLYSLGRMKS  421

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  GR+ H PS+KF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  422  VWGEDASEFKPERWISETGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  481

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+ H + P  SII+  K GL+V  TKR
Sbjct  482  EVKIVEGHKIEPVPSIILHMKQGLRVMVTKR  512



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 110/153 (72%), Gaps = 0/153 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
             E +  +YLH ALCES RL+PPV  +HK      +LPSGH V PN R++ S Y+ GRM+S
Sbjct  356  NELKNAIYLHAALCESLRLYPPVPFQHKTPREPGILPSGHHVHPNMRVMFSLYAMGRMES  415

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+D  EFKPERWIS +G +KHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y
Sbjct  416  IWGKDASEFKPERWISDRGTVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNY  475

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            + +V+  H V P+ SII+  +HG K +  KR T
Sbjct  476  QVEVIKGHKVYPNVSIILYMQHGFKARIKKRWT  508



>ref|XP_002888361.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64620.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +  KLVYLHGA+CE+ RL+PPV   HK  A  DVLPSGH V  N ++++S Y+ GRM S+
Sbjct  203  DLDKLVYLHGAVCETLRLYPPVPFNHKSPAKPDVLPSGHKVDENWKIVISMYALGRMKSV  262

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+D  +F+PERWIS  GR+KHEPSYKF AFNAGPR CLGK++  +QMK +A  I+ +Y+
Sbjct  263  WGDDAEDFRPERWISYSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAVEIIRNYD  322

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTK  197
             +VV+ H   P  S++ + +HGLKV  TK
Sbjct  323  IKVVEGHKTEPVPSVLFRMQHGLKVNITK  351



>gb|EAY88476.1| hypothetical protein OsI_09947 [Oryza sativa Indica Group]
Length=508

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  +LVYLH ALCES RL+PPV +EHK  A  DVLPSGH V+P  ++++S Y+ GRM+S
Sbjct  354  DETGRLVYLHAALCESLRLYPPVPMEHKGPAAADVLPSGHEVRPGDKIVVSLYAMGRMES  413

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG DCMEF+PERWIS  G++++ PSYKF +FN+GPRTCLGK+M  VQ+K  AA ++ ++
Sbjct  414  VWGSDCMEFRPERWISDDGKLRYVPSYKFMSFNSGPRTCLGKDMAFVQLKTAAAAVMKNF  473

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E + V  H V P  SII+  K+G  V   +R
Sbjct  474  EIEAVAGHVVEPKLSIILHMKNGFMVTVKRR  504



>gb|KEH40842.1| cytochrome P450 family protein [Medicago truncatula]
Length=513

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE   KL+YLH A+CE+ RL+PP+  +HK +   D+LPSGH V PNT++I S Y+ GRM+
Sbjct  361  VENIDKLIYLHAAICETLRLYPPIPFDHKCAVNSDILPSGHHVGPNTKLIYSLYAMGRME  420

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             +WG DC+EFKPERWIS KG+I H PSYKF AFNAGPR+CLGK++  +QMKM+AA +L  
Sbjct  421  HVWGGDCLEFKPERWISDKGQIIHVPSYKFIAFNAGPRSCLGKDISFIQMKMVAASVLWK  480

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +   VV+  SV+P  SI+++ + GLKV  +KR
Sbjct  481  FHIHVVEGQSVTPRVSIVLRVE-GLKVNVSKR  511



>ref|XP_002521476.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40966.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE  KLVYLH  +CE+ RL+PPV  E KV    D+LP GH V  + +++ S YS GRM+
Sbjct  351  VEELSKLVYLHAVVCETLRLYPPVPFEVKVPVESDILPGGHHVNRDIKILYSLYSMGRME  410

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC++F+PERWIS  G+IK  PSYKF AFNAGPRTCLGKE+G V+MK++A+ I+ +
Sbjct  411  DIWGKDCLKFRPERWISEAGKIKQVPSYKFTAFNAGPRTCLGKELGFVEMKLVASAIIWN  470

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
            Y  +VV+ H VSPS S+I+  K GLKV+  KRN  
Sbjct  471  YSIKVVEDHPVSPSLSLILYMKDGLKVRVAKRNAT  505



>ref|XP_010527154.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=449

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +   LVYLHGA+CE+ RL+PPV  +HK  A  DVLPSGH V+ N++++LS+Y+ GRM S+
Sbjct  297  DLNNLVYLHGAVCETLRLYPPVPFQHKSPAKADVLPSGHRVEANSKIVLSYYALGRMRSV  356

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+D  +FKPERWIS  G  +HEPS+KF AFNAGPRTCLGK++ L+QMK+ A  IL +++
Sbjct  357  WGDDASDFKPERWISDSGGSRHEPSFKFAAFNAGPRTCLGKQVALMQMKVAALEILENFD  416

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
               ++   V    S+I++ KHG K   TKR
Sbjct  417  ITAIEGQKVELVPSVILRMKHGFKAVMTKR  446



>ref|XP_002894690.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70949.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E+ +KLVYLH AL ES RL+PP+   HK  A  DVLPSGH V+P +++++  Y+ GRM S
Sbjct  348  EDLEKLVYLHAALSESMRLYPPLPFNHKAPAKPDVLPSGHKVEPESKIVICIYALGRMRS  407

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  +FKPERWIS  G ++HEPSYK+ AFN+GPRTCLGK + L+QMK++A  I+ +Y
Sbjct  408  VWGEDASDFKPERWISDNGGLRHEPSYKYVAFNSGPRTCLGKHLALLQMKIVALEIIKNY  467

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +F+V++ H +    SI+++ KHGLKV  TK+
Sbjct  468  DFKVIEGHKIEAIPSILLRMKHGLKVTVTKK  498



>ref|XP_009113346.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            + +KLVYLH AL E+ RL+PP+   HK  A  DVLPSGH V+ N+++++  Y+ GRM SI
Sbjct  346  DLEKLVYLHAALSETMRLYPPLPFNHKSPAKPDVLPSGHKVEANSKIVICIYALGRMRSI  405

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGED ++FKPERWIS  G ++HEP+YKF AFNAGPR CLGK + L+QMK++A  I+  Y+
Sbjct  406  WGEDALDFKPERWISDSGNLRHEPTYKFMAFNAGPRACLGKNLALMQMKIVAVEIIQKYD  465

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            F+V     + P  S+I++ KHGL VK TK+
Sbjct  466  FEVTKGDKIKPVPSVILRMKHGLSVKVTKK  495



>ref|XP_006470474.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
Length=510

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             ++   LVYLH ALCE+ RL+PPV   HK++A  D+LPSGH +K N  +++S+Y+ GRM+
Sbjct  356  TKQVNNLVYLHAALCETLRLYPPVPYNHKIAAQADILPSGHHIKKNQTVLISYYAMGRME  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG DC+EFKPERWIS KG I H P+YKF AF+AGPR CLGK+  L+QMKM+A+ ++ +
Sbjct  416  EIWGNDCLEFKPERWISEKGCIVHVPTYKFTAFHAGPRNCLGKDKALIQMKMVASAVIGN  475

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y  +V   H V P  SII+  K+GLKV+ +KR+
Sbjct  476  YHVKVAKGHPVLPRKSIILNMKYGLKVQLSKRS  508



>gb|EPS59359.1| hypothetical protein M569_15450, partial [Genlisea aurea]
Length=365

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E + LVYLH ALCE+ RLFPPV  +HK     DVLPSGHLVK N R++LSFYS GRM+S
Sbjct  215  DEIKNLVYLHAALCETLRLFPPVPFQHKSPLNDDVLPSGHLVKRNDRIVLSFYSMGRMES  274

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+D  EF+P RW S +G +K  P++KFPAFNAGPR+C+GKE+  VQMK++ A +L  +
Sbjct  275  IWGKDSGEFRPGRWFSDEGTMKLFPAFKFPAFNAGPRSCIGKEISFVQMKIVIAAVLSRF  334

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            +  VVD     P  SI++Q + GLK + TK
Sbjct  335  KIAVVDGDHARPRASIVLQLEDGLKTRVTK  364



>ref|XP_002878665.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54924.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGALCE+ RL+PPV  +HK     DVLPSGH V  +++++   YS GRM S
Sbjct  360  QELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHRVDASSKIVFCLYSLGRMKS  419

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  GR+ H PS+KF +FNAGPRTCLGKE+ + Q+K +A  I+ +Y
Sbjct  420  VWGEDASEFKPERWISESGRLIHMPSFKFLSFNAGPRTCLGKEVAMTQLKTVAVKIIQNY  479

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++VD H + P  SII+  KHGLKV  TKR
Sbjct  480  EIKIVDGHKIEPVPSIILHMKHGLKVTVTKR  510



>ref|XP_007150917.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
 gb|ESW22911.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
Length=504

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KLVYLHGA+CE+ RLFPP+  E K +   D+LPSGH V   T+++L  Y+ GR++
Sbjct  351  VEEVKKLVYLHGAICETLRLFPPIPFERKQALEADMLPSGHGVDSRTKILLFLYAMGRLE  410

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
              WG+DCMEFKPERWIS +G   +EPSYKF AFNAGPR CLGK++  +Q+KM+AA IL +
Sbjct  411  ETWGKDCMEFKPERWISKRGGNVYEPSYKFIAFNAGPRNCLGKDLSFIQLKMVAAAILRN  470

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  +VV+ +  SPS SI++  K GLKVK TKR
Sbjct  471  YCVKVVEGYVASPSLSIVLLMKDGLKVKITKR  502



>gb|EYU33777.1| hypothetical protein MIMGU_mgv1a004858mg [Erythranthe guttata]
Length=507

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEEC+KLVYLH    E+ RL+P V +E K S   D LP+   VK NT+++LSFYS+GRM+
Sbjct  353  VEECKKLVYLHACFYETLRLYPAVPLELKSSILPDTLPNNIEVKKNTKIVLSFYSTGRME  412

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WG+D +EFKPERWIS +G +++EPS+KFPAFN GPR+C GKEM LV+MK++   I+H 
Sbjct  413  SVWGKDALEFKPERWISDRGVLRNEPSFKFPAFNVGPRSCPGKEMALVEMKIVVVAIMHR  472

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
            Y  +VV+ H VSPSDS+ ++ KHGLKV+   R  A
Sbjct  473  YRVRVVEGHRVSPSDSVFLKTKHGLKVRLLSRKDA  507



>emb|CAN80536.1| hypothetical protein VITISV_035975 [Vitis vinifera]
Length=471

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             E   KLVYLH A+CE+ RL+PPV  +HK     DVLPSGH V P  ++    Y+ GRM 
Sbjct  317  TEGLNKLVYLHAAMCEALRLYPPVPFQHKAPIQPDVLPSGHKVDPKMKIFFPVYAMGRMT  376

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWG+DC+EFKPERWIS  G+IKHEPSYKF +FNAGPRTC+GKE+   QMK +AA I+H+
Sbjct  377  AIWGKDCLEFKPERWISELGKIKHEPSYKFFSFNAGPRTCIGKEVAFTQMKAVAATIIHN  436

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  ++V  H V+P+ SII+  K G KV+ +KR
Sbjct  437  YHVEMVKGHHVAPNVSIILYMKRGFKVRVSKR  468



>ref|XP_007150923.1| hypothetical protein PHAVU_004G006000g [Phaseolus vulgaris]
 gb|ESW22917.1| hypothetical protein PHAVU_004G006000g [Phaseolus vulgaris]
Length=494

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE +KLVYLHGA+CES RLFPP+ +E K +   DVLPSGH V P+T ++   YS GR +
Sbjct  356  VEEVKKLVYLHGAICESLRLFPPIPLERKEALKSDVLPSGHGVNPSTVIMFFLYSMGRSE  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDCMEFKPERWIS KG I + PSYKF AFN GPRTCLGK +  +Q+KM+A  ILH 
Sbjct  416  EIWGEDCMEFKPERWISEKGGIVYVPSYKFVAFNTGPRTCLGKGVSFIQIKMVATAILHK  475

Query  289  YEFQ  278
            Y  Q
Sbjct  476  YRLQ  479



>ref|NP_001140984.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACF85104.1| unknown [Zea mays]
 gb|AFW80291.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=321

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            E ++LVYLH AL ES RL+PPV  EHK +A  D LPSG  V P+ R+I+SFYS GRM+++
Sbjct  166  ELKQLVYLHAALSESLRLYPPVPFEHKAAARTDTLPSGARVGPSRRVIVSFYSMGRMEAV  225

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+DC EF+PERW+++ GR +HEPSYKF AFN GPRTCLG+++   QMK + A +L  + 
Sbjct  226  WGKDCSEFRPERWLTAAGRFRHEPSYKFVAFNVGPRTCLGRDLAYSQMKAVVAAVLPRFR  285

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
             +V     V P  SII+  K GLKV+  KR 
Sbjct  286  VEVDAGAVVRPKLSIILHMKDGLKVRVHKRE  316



>ref|XP_010660343.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=503

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGALCES RLFPPV ++ +     D+LPSGH V P+T++I   Y+ GRM  
Sbjct  351  KELSKLVYLHGALCESLRLFPPVPLQIRTPLQPDILPSGHRVDPSTKVIFHAYAMGRMAC  410

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
             WG+DC+EFKPERW++ KGR KHEP+YKF AF+AGPR CLGKE+   +MK +AA I+H+Y
Sbjct  411  AWGKDCLEFKPERWLTGKGRTKHEPAYKFLAFSAGPRICLGKEVAFFKMKAVAAAIMHNY  470

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
             FQ+V  H V P+ SI++  KHGL+V    +
Sbjct  471  HFQMVKGHRVVPTVSIVLHMKHGLRVNVKNK  501



>emb|CDY39927.1| BnaA09g15090D [Brassica napus]
Length=496

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 111/150 (74%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            + +KLVYLH AL E+ RL+PP+   HK  A  DVLPSGH V+ N+++++  Y+ GRM SI
Sbjct  346  DLEKLVYLHAALSETMRLYPPLPFNHKSPAKPDVLPSGHKVEANSKIVICIYALGRMRSI  405

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGED ++FKPERWIS  G +KHEPSYKF AFNAGPR CLGK + L+QMK++A  I+ +Y+
Sbjct  406  WGEDALDFKPERWISKSGELKHEPSYKFMAFNAGPRACLGKHLALLQMKIVAVEIIQNYD  465

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            F+V + H +    SI+++ KHGL V  TK+
Sbjct  466  FKVTEGHKIEAVPSIVLRMKHGLNVTVTKQ  495



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE   LVYLH A+CE+ RL+P V   HK +   D+LPSGH ++   ++++SFYS GRM++
Sbjct  369  EEVNGLVYLHAAMCETLRLYPSVHTNHKAAVEEDILPSGHRIRRKMQVLISFYSMGRMEA  428

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC+EFKPERWIS KG I H P YKF AFN GPRTCLGK++  +QMKM+A  +L +Y
Sbjct  429  IWGKDCLEFKPERWISDKGGIIHVPPYKFAAFNDGPRTCLGKDVSFIQMKMVACAVLWNY  488

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              QV++ H V PS ++++  K+GLKV+ TKR
Sbjct  489  HVQVIEDHQVFPSVAVVLHMKNGLKVRITKR  519



>gb|KHN19680.1| Cytochrome P450 86B1 [Glycine soja]
Length=572

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE+ +KLVYLHGA+CE+ RLFPP+  E K++   D+LPSGH V P T +++S Y+ GR++
Sbjct  348  VEKVKKLVYLHGAICETLRLFPPIPFERKLAIKADMLPSGHRVNPRTMILISLYAMGRLE  407

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
              WG+DC+EFKPERWIS KG I + PSYKF AFNAGPRTCLGK++  +QMKM+AA IL+ 
Sbjct  408  ETWGKDCLEFKPERWISEKGGIVYVPSYKFIAFNAGPRTCLGKDLSFIQMKMVAAAILYK  467

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVK  206
            Y  QVV+ +  +PS SI++  K GLK++
Sbjct  468  YHVQVVEDYVATPSLSIVLLIKDGLKME  495



>ref|XP_003629932.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04408.1| cytochrome P450 family protein [Medicago truncatula]
Length=493

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +E   KL+YLHGALCE+ RL+PP+  EHK +   DVLPSGH++K NT ++ S YS GR++
Sbjct  340  MEGLSKLIYLHGALCEALRLYPPIPFEHKSNLKSDVLPSGHVIKSNTMILYSLYSIGRVE  399

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDC+EFKPERW+S KG   H PSYKF AFNAGPR+ LGK++  +++KM+A  IL +
Sbjct  400  EIWGEDCLEFKPERWVSKKGGTIHVPSYKFIAFNAGPRSRLGKDISFIELKMVAIAILLN  459

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y  QVV+ H + PS S+++  KHGLK+   KR+
Sbjct  460  YHIQVVEGHPIIPSLSVVLHMKHGLKINVKKRS  492



>gb|EPS67771.1| hypothetical protein M569_06997, partial [Genlisea aurea]
Length=490

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE +  VYLH A+CES RL+PPV  +HK  A  D LPSGH V   T+++L  Y+ GRM+S
Sbjct  339  EETRNTVYLHAAVCESLRLYPPVPFQHKEPAEDDTLPSGHRVSRRTKVVLFLYAMGRMES  398

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC EFKPERWIS +G I+H+PSYKF AFNAGPRTCLG+E  L Q+KM+AA I+ +Y
Sbjct  399  IWGKDCGEFKPERWISERGTIRHQPSYKFLAFNAGPRTCLGREAALSQIKMVAAAIIQNY  458

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E  + + H  +P+ S+I+  K+GLKV   +R
Sbjct  459  EVGLAEGHVAAPNCSVILYMKNGLKVWIRRR  489



>ref|XP_006470473.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|KDO37420.1| hypothetical protein CISIN_1g043945mg [Citrus sinensis]
Length=518

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            ++  ++VYLH AL E+ RL+PPV   HK+SA  DVLPSGH +  N  +++S+Y+ GRM+ 
Sbjct  365  KQVNRMVYLHAALRETLRLYPPVPYNHKISAQADVLPSGHRINKNHSILISYYAMGRMEE  424

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC+EFKPERWIS +G I H PSYKF AF+AGPR CLGK+   +QMKM+AA+IL  Y
Sbjct  425  IWGKDCLEFKPERWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGKY  484

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            + ++V  H VSP +S+++  K+GLKV+ +KR 
Sbjct  485  QVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRT  516



>ref|XP_010520636.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=511

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 106/150 (71%), Gaps = 1/150 (1%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            +  KLVYLHGAL E+ RL+PPV   HK  A  D LPSGH V+ NT++I  FY+ GRM S+
Sbjct  358  DLNKLVYLHGALYEALRLYPPVPFNHKSPAKADTLPSGHKVEANTKIIFPFYAMGRMRSV  417

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+D  EFKPERWIS KGR+KHEPS+KF +FNAGPRTC+GK++ L QM ++A  IL +Y+
Sbjct  418  WGDDASEFKPERWISEKGRLKHEPSFKFASFNAGPRTCIGKQVALTQMAIVAVEILQNYD  477

Query  283  -FQvvdshsvspsdsiiIQAKHGLKVKFTK  197
                 +   +    SII++ KHG KV  TK
Sbjct  478  VITATEGQQLELVPSIILRTKHGYKVSITK  507



>gb|KDO37689.1| hypothetical protein CISIN_1g047842mg [Citrus sinensis]
Length=465

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             ++   LVYLH ALCE+ RL+PPV   HK++   D+LPSGH +K N  +++S+Y+ GRM+
Sbjct  311  TKQANNLVYLHAALCETLRLYPPVPYNHKIAGQADILPSGHHIKKNQTVLISYYAMGRME  370

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG DC+EFKPERWIS KG I H P+YKF AF+AGPR CLGK+  L+QMKM+A+ ++ +
Sbjct  371  EIWGNDCLEFKPERWISEKGCIVHVPTYKFTAFHAGPRNCLGKDKALIQMKMVASAVIGN  430

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y  +V   H V P  SII+  K+GLKV+ +KR+
Sbjct  431  YHVKVAKGHPVLPRKSIILNMKYGLKVQLSKRS  463



>emb|CDM81753.1| unnamed protein product [Triticum aestivum]
Length=516

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            + ++LVYLH AL ES RL+PPV  EHK  A  D LPSG  V P  R+I+SFYS GRM+S+
Sbjct  362  DLKRLVYLHAALSESLRLYPPVPFEHKAGARPDTLPSGPAVWPTRRVIVSFYSMGRMESV  421

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+DC+EF+PERW+++ GR++HEPSYKF AFN GPRTCLGK++   QMK + A +L  + 
Sbjct  422  WGKDCLEFRPERWLTAAGRLRHEPSYKFVAFNVGPRTCLGKDLAFTQMKAVVAAVLPRFR  481

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
             +V     V P  SII+  K GLKV+  KR 
Sbjct  482  VEVAPGAVVKPKLSIILHMKDGLKVRVYKRQ  512



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE + LVYLH ALCES RL+PPV  EHK     +VLPSG   +P+T+++ S YS GRM+ 
Sbjct  373  EELKGLVYLHAALCESLRLYPPVPFEHKGVLQSEVLPSGDKAQPSTKILFSLYSMGRMEG  432

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WG+DC+EFKPERWIS KGR++HEPSYKF +FN+GPRTC+GK+M   QMK + A +++++
Sbjct  433  VWGKDCLEFKPERWISEKGRLRHEPSYKFTSFNSGPRTCIGKDMAFTQMKAVVAAMVYNF  492

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
               VV+ H V P  SII+  K+GL V+  KR +A
Sbjct  493  HVDVVEGHVVQPKISIILHMKNGLMVRIRKRASA  526



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
             E   KLVYLH A+CE+ RL+PPV  +HK     DVLPSGH V P  ++    Y+ GRM 
Sbjct  353  TEGLNKLVYLHAAMCEALRLYPPVPFQHKAPIQPDVLPSGHKVDPKMKIFFPVYAMGRMT  412

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            +IWG+DC+EFKPERWIS  G+IKHEPSYKF +FNAGPRTC+GKE+   QMK +AA I+H+
Sbjct  413  AIWGKDCLEFKPERWISELGKIKHEPSYKFFSFNAGPRTCIGKEVAFTQMKAVAATIIHN  472

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  ++V  H V+P+ SII+  K G KV+ +KR
Sbjct  473  YHVEMVKGHHVAPNVSIILYMKRGFKVRVSKR  504



>ref|XP_009101871.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=510

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V   ++++   YS GRM S
Sbjct  357  QELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVDAGSKILFCLYSLGRMKS  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWI+  G   HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +Y
Sbjct  417  VWGEDALEFKPERWITENGTSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + +VV+ H V P+ SII+  KHGLKV  +KR
Sbjct  477  DIKVVEGHKVEPAPSIILHMKHGLKVTVSKR  507



>emb|CDY53181.1| BnaA06g40600D [Brassica napus]
Length=510

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V   ++++   YS GRM S
Sbjct  357  QELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVDAGSKILFCLYSLGRMKS  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWI+  G   HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +Y
Sbjct  417  VWGEDALEFKPERWITENGTSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + +VV+ H V P+ SII+  KHGLKV  +KR
Sbjct  477  DIKVVEGHKVEPAPSIILHMKHGLKVTVSKR  507



>ref|NP_194944.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 emb|CAA16973.1| cytochrome p450 - like protein [Arabidopsis thaliana]
 emb|CAA16572.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79935.1| cytochrome p450-like protein [Arabidopsis thaliana]
 gb|AEE86013.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=506

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGALCE+ RL+PPV+   K     DVLPSGH V  N+++I+  Y+ GRM +
Sbjct  353  ENVDKLVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPSGHKVDANSKIIICLYALGRMRA  412

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  +FKPERWIS  G IKHEPS+KF +FNAGPRTCLGK + + QMK++A  IL +Y
Sbjct  413  VWGEDASQFKPERWISENGGIKHEPSFKFLSFNAGPRTCLGKHLAMTQMKIVAVEILRNY  472

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
            + +V+    + P+   I+  KHGL++  TKR +A
Sbjct  473  DIKVLQGQKIVPALGFILSMKHGLQITVTKRCSA  506



>ref|XP_009113344.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 111/150 (74%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            + +KLVYLH AL E+ RL+PP+   HK  A  DVLPSGH V+ N+++++  Y+ GRM SI
Sbjct  346  DLEKLVYLHAALSETMRLYPPLPFNHKSPAKPDVLPSGHKVEANSKIVICIYALGRMRSI  405

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGED ++FKPERWIS  G +KHEPSYKF AFNAGPR CLGK + L+QMK++A  I+ +Y+
Sbjct  406  WGEDALDFKPERWISKGGELKHEPSYKFMAFNAGPRACLGKHLALLQMKIVAVEIIQNYD  465

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            F+V + H +    SI+++ KHGL V  TK+
Sbjct  466  FKVTEGHKIEAVPSIVLRMKHGLNVTVTKQ  495



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGALCE+ RL+PPV+   K     DVLPSGH V  N+++I+  Y+ GRM +
Sbjct  353  ENVDKLVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPSGHKVDANSKIIICLYALGRMRA  412

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  +FKPERWIS  G IKHEPS+KF +FNAGPRTCLGK + + QMK++A  IL +Y
Sbjct  413  VWGEDASQFKPERWISENGGIKHEPSFKFLSFNAGPRTCLGKHLAMTQMKIVAVEILRNY  472

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
            + +V+    + P+   I+  KHGL++  TKR +A
Sbjct  473  DIKVLQGQKIVPALGFILSMKHGLQITVTKRCSA  506



>ref|XP_010417073.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010417074.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=514

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGALCES RL+PPV  +HK     DVLPSGH V  +++++   YS GRM+S
Sbjct  360  QELNKLVYLHGALCESLRLYPPVPFQHKSPTKPDVLPSGHKVDASSKIVFCLYSLGRMES  419

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERW+S  GR+ H PS+KF +FNAGPRTCLGKE+ + QMK +A  ++ +Y
Sbjct  420  VWGEDASEFKPERWVSESGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKMIQNY  479

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            E +VV+ H + P  SII+  KHGLKV  TK
Sbjct  480  EIEVVEGHKIEPVPSIILHMKHGLKVTVTK  509



>gb|KFK32767.1| hypothetical protein AALP_AA6G286100 [Arabis alpina]
Length=515

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGALCE+ RL+PPV  +HK     DVLPSGH V  +++++   YS GRM S
Sbjct  361  QELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHRVGASSKIVFCLYSLGRMKS  420

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  G++ H PS+KF +FNAGPRTCLGKE+ + QMK++A  I+ +Y
Sbjct  421  VWGEDASEFKPERWISESGKLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKIVAVKIIQNY  480

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            E  +V+ H + P  S+I+  KHGLKV  TKR+ 
Sbjct  481  EINIVEGHKIEPVPSVILHMKHGLKVLVTKRSN  513



>ref|XP_009117295.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=534

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGALCE+ RL+PPV  +HK     DVLPSGH+V  +T+++   YS GRM S
Sbjct  380  QELNKLVYLHGALCEALRLYPPVPFQHKSPTKPDVLPSGHIVDVSTKIVFCLYSLGRMKS  439

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  GR+ H PS+KF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  440  VWGEDASEFKPERWISETGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  499

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E ++V+ H + P  SII+  K GL+V  TKR
Sbjct  500  EVKIVEGHKIEPVPSIILHMKQGLRVMVTKR  530



>ref|XP_009773631.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=510

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E + ++YLH ALCES RL+PPVA +HK     D+LPSGH V PN R+++  Y+ GRM+S
Sbjct  358  DELKNVIYLHAALCESLRLYPPVAFQHKTPLEPDILPSGHHVHPNMRVMIPLYAMGRMES  417

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+D  EFKP RWIS +G I +EPSYKF +FNAGPRTCLGKE    QMK++ A I+H+Y
Sbjct  418  IWGKDASEFKPHRWISDRGTINYEPSYKFFSFNAGPRTCLGKEAAFTQMKVVVATIIHNY  477

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + ++V  H V P+ S+++  KHG KV+  ++
Sbjct  478  QIEMVKGHVVYPNVSVMLYMKHGFKVRVKRK  508



>gb|KDP35255.1| hypothetical protein JCGZ_09414 [Jatropha curcas]
Length=259

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E+  KL+YLH  + E+ RL+PPV  EHK     DVLPSGHLV P  +++LS Y  GR+ S
Sbjct  108  EKVNKLIYLHAVIFETLRLYPPVMYEHKEPLKPDVLPSGHLVDPTMKILLSIYVMGRLKS  167

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDCMEFKPERWIS +GR+  +  YKF +FNAGPR CLGKE+ L QMK +AA I+H+Y
Sbjct  168  IWGEDCMEFKPERWISEEGRLIQQSPYKFLSFNAGPRVCLGKEIALTQMKAVAAFIIHNY  227

Query  286  EFQvvdshs-vspsdsiiIQAKHGLKVKFTKR  194
            + +V++ H     + SII+  K+GL V+ ++R
Sbjct  228  QVKVIEEHVPEPNTASIILHIKNGLMVRISRR  259



>gb|AJD25224.1| cytochrome P450 CYP96A84 [Salvia miltiorrhiza]
Length=485

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +K+VY+HGA+ E+ RL+PPV  +HK +   D+LPSGH V P+ +++ S Y+ GRM+S
Sbjct  330  DEVKKMVYIHGAVLEALRLYPPVPFQHKEALESDILPSGHTVGPDVKVMFSLYAMGRMES  389

Query  466  IWGEDCMEFKPERWISSKG-RIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            IWGEDC+EF+PERWIS  G  I+H P+YKF AFNAGPR+CLGKE+ L Q+K +AA ++++
Sbjct  390  IWGEDCLEFRPERWISGAGASIRHTPAYKFLAFNAGPRSCLGKEVALAQIKAVAATLIYN  449

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y F+V + H V  + S+I+  +HGLKVK   R
Sbjct  450  YRFRVAEGHRVEHNCSVILYMRHGLKVKVASR  481



>gb|KEH24774.1| cytochrome P450 family protein [Medicago truncatula]
Length=476

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            + E +KLVYLHGA+CE+ RLFPP+  E K +   D+LPSGH+V PNT ++   YS GR +
Sbjct  312  IYELKKLVYLHGAICEALRLFPPIPFERKQAIKGDILPSGHIVNPNTIILFFLYSMGRFE  371

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EFKPERWIS +G I H PSYKF ++NAGPRTCLGK++  +Q+KM    IL  
Sbjct  372  EIWGKDCLEFKPERWISERGGIVHTPSYKFISYNAGPRTCLGKDLSFIQIKMTTIAILSK  431

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTK  197
            Y  QVVD H    S SI+I  K+GLKVK TK
Sbjct  432  YCVQVVDGHVPILSHSIVIVMKNGLKVKITK  462



>gb|KEH41380.1| cytochrome P450 family protein [Medicago truncatula]
Length=508

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E  KLVYLHGA+CE+ RL+PPV  EHK +   D+LPSG  V  NT++I S Y+ GRM+
Sbjct  356  VKELDKLVYLHGAICEALRLYPPVPFEHKCAVNSDILPSGDHVSLNTKLIYSLYAMGRME  415

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWG+DC+EF+PERWIS +G+I H PSYKF AFNAGPR+CLGK++  +QMKM+AA +L  
Sbjct  416  QIWGDDCLEFRPERWISDRGQIIHVPSYKFIAFNAGPRSCLGKDITFLQMKMVAAAVLWK  475

Query  289  YEFQ  278
            +  Q
Sbjct  476  FRIQ  479



>ref|XP_004515489.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=539

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E  KLVYLHGA+CE+ RL+PP+   HK +   D+LP+G  V  NT++I S Y+ GRM+
Sbjct  385  VKEFDKLVYLHGAICEALRLYPPLGYNHKCAIKSDILPNGEHVSSNTKVIFSMYAMGRME  444

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGE+C+EFKPERWIS  G+  H PSY+F AFNAGPR+CLGK+M ++QMKM A  +L  
Sbjct  445  EIWGENCLEFKPERWISDIGQSIHVPSYQFTAFNAGPRSCLGKDMSIIQMKMAAVTMLWK  504

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            +  QVV+  S++P  SI+++ +HG KVK TKR
Sbjct  505  FHIQVVEGQSITPRASIVLRMEHGFKVKLTKR  536



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE   LVYLH A+CE+ RL+P V   HK +   D LPSGH ++   ++++SFYS GRM++
Sbjct  368  EEVNGLVYLHAAMCETLRLYPSVHTNHKAAVEEDTLPSGHRIRRKMQVLISFYSMGRMEA  427

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC+EFKPERWIS KG I H P YKF AFN GPRTCLGK++  +QMKM+A  +L +Y
Sbjct  428  IWGKDCLEFKPERWISDKGGIIHVPPYKFAAFNDGPRTCLGKDVSFIQMKMVACAVLWNY  487

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              QVV+ H V PS ++++  K+GLKV+ TKR
Sbjct  488  HVQVVEGHQVFPSVAVVLHMKNGLKVRITKR  518



>gb|EPS72790.1| hypothetical protein M569_01963, partial [Genlisea aurea]
Length=491

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            EE   LVYLH ALCES RL+PPV  +HK  A   VLPSGH V P  +++ S Y+  RM  
Sbjct  340  EELHNLVYLHCALCESLRLYPPVPFQHKSPAAPAVLPSGHYVHPKMKVLFSLYAMARMAY  399

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWGEDC EF+PERWI+ +G++ +EPSYKF AFNAGPRTC+GKE+   Q+K +AA ++++Y
Sbjct  400  IWGEDCKEFRPERWINGRGKVNYEPSYKFMAFNAGPRTCIGKEVAFTQLKAVAAAVIYNY  459

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              ++V+ H VSP+ S+I+  KHG KV+ TKR
Sbjct  460  RVELVEGHDVSPNVSVILYMKHGFKVRVTKR  490



>ref|XP_010681240.1| PREDICTED: cytochrome P450 86A7-like [Beta vulgaris subsp. vulgaris]
Length=421

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGALC + RL+ PVA E K     D+LPSGH V PN ++I + Y+ GRM S
Sbjct  282  EANSKLVYLHGALCVTLRLYAPVAFEAKAPMEPDILPSGHRVNPNMQIIFNLYAMGRMKS  341

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC EFKPERWIS++G I+HEPSYKF  FNAGPRTCLGKEM   QMK++AA ++  Y
Sbjct  342  IWGDDCNEFKPERWISAQGNIRHEPSYKFFVFNAGPRTCLGKEMAFTQMKVVAATMIQKY  401



>emb|CDX72695.1| BnaC07g47170D [Brassica napus]
Length=510

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V   ++++   YS GRM S
Sbjct  357  QELKKLVYLHGAICEALRLYPPVPFQHKSPTKTDVLPSGHKVDAGSKILFCLYSLGRMKS  416

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED +EFKPERWI+  G   HEPSYKF +FNAGPRTCLGKE+ ++QMK +A  I+ +Y
Sbjct  417  VWGEDALEFKPERWITENGTSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNY  476

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
              +VV+ H V P+ SII+  KHGLKV  +KR
Sbjct  477  NIKVVEGHKVEPAPSIILHMKHGLKVTVSKR  507



>ref|XP_010666954.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 103/151 (68%), Gaps = 1/151 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVL-PSGHLVKPNTRMILSFYSSGRM  473
            +E   KLVYLH ALCE+ RL+PPVA  HK S   DVL  SGH V PNT++I + Y+ GRM
Sbjct  188  IENSSKLVYLHAALCEALRLYPPVAFNHKTSVNSDVLLASGHRVGPNTQIIFNMYAMGRM  247

Query  472  DSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
              IWG+DC EFKPERWIS  G IK EP+YKF AF AGPR C GK+M   QMK + A I+ 
Sbjct  248  KCIWGDDCDEFKPERWISKGGSIKLEPTYKFLAFGAGPRICQGKDMVFTQMKAVVAAIIQ  307

Query  292  HYEFQvvdshsvspsdsiiIQAKHGLKVKFT  200
             Y+ + V  H V P  S+++Q KHG KVK +
Sbjct  308  KYDIEAVKGHQVVPDISVVLQMKHGFKVKLS  338



>gb|KDP46408.1| hypothetical protein JCGZ_10248 [Jatropha curcas]
Length=510

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            E  KLVYLH  +CE  RL+PP+   HKVS   D+LPSGH +  N R+I S YS GRM  I
Sbjct  358  ELSKLVYLHAVVCEVLRLYPPLPFNHKVSIEPDILPSGHHIPKNMRIIYSLYSMGRMKEI  417

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGEDC+EFKPERWIS  G+IKH P+YKF AF  GPR+CLGK M L+++K+IA  ++ +Y 
Sbjct  418  WGEDCLEFKPERWISETGQIKHVPAYKFIAFGTGPRSCLGKHMALMELKVIACAVIWNYS  477

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKRNTA  185
             Q+ ++H +SP  S+I+  K+GLKVK ++R+T 
Sbjct  478  LQIAENHPISPDISVILHIKNGLKVKVSERSTV  510



>emb|CDY12435.1| BnaC08g09240D [Brassica napus]
Length=513

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGA+CE+ RL+PPV  +HK     DVLPSGH V+P+T+++   YS GRM S
Sbjct  359  QELNKLVYLHGAMCEALRLYPPVPFQHKSPTKPDVLPSGHKVEPSTKIVFCLYSLGRMKS  418

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  +FKPERWIS  G   H PS+KF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  419  VWGEDASDFKPERWISETGSSIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  478

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            E ++V+ H++ P  S+I++ K GLKV  TKR+ 
Sbjct  479  EIKIVEGHTIEPVPSVILRMKQGLKVMVTKRSN  511



>gb|KFK31020.1| hypothetical protein AALP_AA6G057700 [Arabis alpina]
Length=508

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 104/151 (69%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGAL E+ RL+PPV+   K S   DVLPSGH V  N+ +I+S Y+ GRM +
Sbjct  355  ENLDKLVYLHGALNEAMRLYPPVSFGRKSSVESDVLPSGHRVDANSMIIISLYALGRMKA  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED ++FKPERWIS  G +K EPS+KF AFN+GPR CLGK + + QMK +A  ILH+Y
Sbjct  415  VWGEDALKFKPERWISENGGLKQEPSFKFLAFNSGPRICLGKNLAMTQMKTVAVEILHNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + +V     + P    I+  KHGLKV  TKR
Sbjct  475  DIKVTKGQKIEPVLGFILSMKHGLKVTITKR  505



>ref|XP_002534255.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28128.1| conserved hypothetical protein, partial [Ricinus communis]
Length=203

 Score =   163 bits (412),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +E+  KL+YLHGALCE+ RL+PPV  EHK     D+LPSGH V P  ++++S Y  GRM 
Sbjct  46   LEKLNKLLYLHGALCETLRLYPPVMFEHKEPLQPDILPSGHHVDPRMKILVSTYLMGRMK  105

Query  469  SIWGEDCMEFKPERWIS-SKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILH  293
            SIWGEDC+EFKPERWIS + GR+   P +KF AFNAGPRTCLGK++ L+ MK++AAI+L 
Sbjct  106  SIWGEDCLEFKPERWISKADGRLVQHPPHKFMAFNAGPRTCLGKDIALLVMKIVAAILLQ  165

Query  292  HYEFQvvdshsvsps-dsiiIQAKHGLKVKFTKRNTA  185
            +Y  +VV  H V+P+  SII+  KHGL  + ++R T+
Sbjct  166  NYNVEVVKEHPVAPNCASIILHIKHGLMARISRRWTS  202



>ref|XP_006294031.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
 gb|EOA26929.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
Length=514

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGAL ES RL+PPV  +HK     DVLPSGH V  +++++   YS GRM S
Sbjct  360  QELNKLVYLHGALYESLRLYPPVPFQHKSPTKPDVLPSGHKVDASSKIVFCLYSLGRMKS  419

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERW+S  GR+ H PS+KF +FNAGPRTCLGKE+ + QMK +A  I+ +Y
Sbjct  420  VWGEDASEFKPERWVSESGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNY  479

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E +VV+ H V P  SII+  KHGLKV  TKR
Sbjct  480  EIKVVEGHKVEPVPSIILHMKHGLKVTVTKR  510



>gb|KDP35252.1| hypothetical protein JCGZ_09411 [Jatropha curcas]
Length=491

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            +E+  KL+YLH ALCE+ R++PPV  E+K     D+LPSGH V P  +++LS Y  GR+ 
Sbjct  337  LEKVNKLLYLHAALCETLRIYPPVTYEYKAPLQNDILPSGHYVDPKMKILLSSYLMGRLK  396

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            S+WGEDC EFKPERWIS +GRI H+  YKF AFNAGPRTC+GK++  VQMK +AA +LH+
Sbjct  397  SLWGEDCFEFKPERWISEQGRIIHQSPYKFLAFNAGPRTCVGKDIAFVQMKAMAAFLLHN  456

Query  289  YEFQvvdshsvs-psdsiiIQAKHGLKVKFTKR  194
            Y  +VV+ H+V     SII+  K+GLKV+ ++R
Sbjct  457  YNIEVVEEHAVVPKYTSIILHMKYGLKVRISRR  489



>ref|XP_006283561.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
 gb|EOA16459.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
Length=506

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E   KLVYLHGALCE+ RL+PPV    K     DVLPSGH V  N+++I+  Y+ GRM +
Sbjct  355  EHLDKLVYLHGALCEAVRLYPPVCFGRKSPIKSDVLPSGHKVDANSKIIICLYALGRMRA  414

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED ++FKPERWI+  G IKHEPS+KF +FNAGPRTCLGK + + QMK++A  IL +Y
Sbjct  415  VWGEDALQFKPERWITENGGIKHEPSFKFLSFNAGPRTCLGKHIAMAQMKIVAVEILQNY  474

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            + +VV    + P+  II+  KHGL++  TKR
Sbjct  475  DIKVVQGQKIEPALGIILSMKHGLRITVTKR  505



>gb|KFK33664.1| hypothetical protein AALP_AA5G043500 [Arabis alpina]
Length=511

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 111/151 (74%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E +KLVYLHGA+ E  RL+PP+   HK     +VLPSGH V  N++++L  YS GRM S
Sbjct  358  QELKKLVYLHGAIYEVLRLYPPLPFNHKSPTKSEVLPSGHKVDANSKIVLCLYSLGRMKS  417

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  G++ HEPSYKF +FNAGPRTCLGKE+ ++Q+K +A  I+ +Y
Sbjct  418  VWGEDAFEFKPERWISETGKLIHEPSYKFLSFNAGPRTCLGKELAMMQIKTVAVKIIQNY  477

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E +VV+   + P+ S+I+  KHGLKV  +KR
Sbjct  478  EIKVVEGQKIEPAPSVILHMKHGLKVTVSKR  508



>ref|XP_007134103.1| hypothetical protein PHAVU_010G019100g [Phaseolus vulgaris]
 gb|ESW06097.1| hypothetical protein PHAVU_010G019100g [Phaseolus vulgaris]
Length=504

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VE   +L YLH A+ E+ RL+PPV +EHK     D+LPSGH +K NT ++ S YS GR +
Sbjct  351  VEWLSQLTYLHAAISETLRLYPPVPLEHKCPLKSDMLPSGHWIKSNTMILYSLYSMGRAE  410

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
             IWGEDC++F+PERWIS++G I H PSYKF AFNAGPR+CLGK +   ++KMIAA IL +
Sbjct  411  EIWGEDCLKFRPERWISNRGGIIHIPSYKFIAFNAGPRSCLGKAISYTEIKMIAAAILWN  470

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
            Y  Q+V+  ++SP  S+++  KHGLKV  TKR+
Sbjct  471  YRIQLVEGQAISPRVSVVLHMKHGLKVTLTKRS  503



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
             E +  +YLH ALCES RL+PPV  +HK      +LPSGH V PN R++ S Y+ GR++S
Sbjct  356  NELKNAIYLHAALCESLRLYPPVPFQHKTPREPCILPSGHHVHPNMRVMFSLYAMGRIES  415

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+D  EFKPERWIS +G +KHEPSYKF AFNAGPRTCLGKE+   QMK +AA I+H+Y
Sbjct  416  IWGKDAAEFKPERWISDRGIVKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNY  475

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRNT  188
            + +V+  H V P+ SII+  +HG K    KR T
Sbjct  476  QVEVIKGHKVYPNVSIILYMQHGFKASIKKRWT  508



>ref|NP_176713.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
 gb|AAC27155.1| Similar to cytochrome P450 gb|X90458 from A. thaliana [Arabidopsis 
thaliana]
 gb|AEE34360.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
Length=503

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            + +KLVYLHGA+CE+ RL+PPV   HK  A  DVLPSGH V    ++++S Y+ GRM S+
Sbjct  354  DLEKLVYLHGAVCETLRLYPPVPFNHKSPAKPDVLPSGHRVDEKWKIVISMYALGRMKSV  413

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+D  +F+PERWIS  GR+KHEPSYKF AFNAGPR CLGK++  +QMK +AA I+ +Y+
Sbjct  414  WGDDAEDFRPERWISDSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYD  473

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTK  197
             +VV+ H   P  S++ + +HGLKV  T+
Sbjct  474  IKVVEGHKTEPVPSVLFRMQHGLKVNITR  502



>ref|XP_004968446.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=506

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            E ++LVYLH AL ES RL+PPV  EHK +A  D LPSG  V P+ R+I+SFY+ GRM+++
Sbjct  353  ELKRLVYLHAALSESLRLYPPVPFEHKAAARPDTLPSGTPVGPSRRVIVSFYAMGRMEAV  412

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WG+DC+EF+PERW+++ GR++HEPSYKF AFN GPRTCLG+++   QMK + A +L  + 
Sbjct  413  WGKDCLEFRPERWLTAAGRLRHEPSYKFVAFNVGPRTCLGRDLAYAQMKAVVAAVLPRFR  472

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
             +V     V P  SII+  K GLKV+  KR
Sbjct  473  VEVDAGAVVRPKLSIILHMKDGLKVRVHKR  502



>gb|KHN27469.1| Cytochrome P450 86B1 [Glycine soja]
Length=463

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 108/152 (71%), Gaps = 1/152 (1%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            VEE ++LVYLHGA+CE+ RLFPP+  E K +   D+LPSGH V   T+++   Y+ GR +
Sbjct  311  VEEVKRLVYLHGAICEALRLFPPIPFETKQAIKADMLPSGHRVNSGTKILFILYAMGRSE  370

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
              WG+DC+EFKPERWIS KG I + PSYKF AFNAGPRTCLGKE+  +QMKM+AA ILH 
Sbjct  371  ETWGKDCLEFKPERWISEKGGIIYVPSYKFIAFNAGPRTCLGKEISFIQMKMVAAAILHK  430

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y  +VVD  +      +++  K GLKV+  KR
Sbjct  431  YRVRVVDHVATPSPSIVLLM-KDGLKVQIAKR  461



>ref|XP_006446602.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
 gb|ESR59842.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
Length=519

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            ++   LVYLH ALCE+ RL+PP+   HK++A  D+LPSGH +K N  +++S+Y+ GRM+ 
Sbjct  366  KQVNSLVYLHAALCETLRLYPPIPYNHKIAAQADILPSGHHIKKNQTVLISYYAMGRMEE  425

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            IWG+DC+EFKPERWIS K  I H PSYKF AF+AGPR CLGK+  L+QMKM+A+ ++ +Y
Sbjct  426  IWGDDCLEFKPERWISEKWCIVHVPSYKFTAFHAGPRNCLGKDKALIQMKMVASAVIGNY  485

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKRN  191
              ++   H VSP +SII+  K+GLKV+ +KR+
Sbjct  486  HVKIAKGHPVSPCNSIILNMKYGLKVQVSKRS  517



>ref|XP_006396175.1| hypothetical protein EUTSA_v10002359mg, partial [Eutrema salsugineum]
 gb|ESQ37618.1| hypothetical protein EUTSA_v10002359mg, partial [Eutrema salsugineum]
Length=225

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            +E  KLVYLHGAL E+ RL+PPV  +HK     DVLPSGH V  +++++   YS GRM +
Sbjct  71   QELSKLVYLHGALYEALRLYPPVPFQHKSPTKPDVLPSGHRVDASSKIVFCLYSLGRMKT  130

Query  466  IWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHY  287
            +WGED  EFKPERWIS  GR  H PS+KF +FNAGPRTCLGK++ + QMK +A  I+ +Y
Sbjct  131  VWGEDAAEFKPERWISESGRSIHVPSFKFLSFNAGPRTCLGKDVAMTQMKAVAVKIIQNY  190

Query  286  EFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            E +VV  H + P  S+I+  K GLKV  TKR
Sbjct  191  EIKVVKGHKIEPVPSVILHMKQGLKVMVTKR  221



>gb|KJB33823.1| hypothetical protein B456_006G032600 [Gossypium raimondii]
Length=473

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMD  470
            V+E + LVYLHGALCE+ RL+PP    HK +   D+LPSGH V P T+++ S YS GRM 
Sbjct  320  VDEVKNLVYLHGALCEALRLYPPAPFNHKEAVKPDILPSGHPVHPKTKILFSVYSMGRMK  379

Query  469  SIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            SIWGEDC EFKPERWI+ +G IKHE SYKF +F AGPR CLGKE   +QMK +A+ ++++
Sbjct  380  SIWGEDCYEFKPERWINKRGEIKHESSYKFLSFGAGPRICLGKETSFIQMKAVASALIYN  439

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
            Y   V++   V P+ S+++  ++GL  + +KR
Sbjct  440  YRIHVMEETPVVPALSVVLHTENGLMTRISKR  471



>gb|EYU33750.1| hypothetical protein MIMGU_mgv1a020734mg, partial [Erythranthe 
guttata]
Length=303

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 99/131 (76%), Gaps = 7/131 (5%)
 Frame = -2

Query  649  VEECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHL-------VKPNTRMILSF  491
            VEEC+KLVY+H  L E+ RLFPPVA+E K     ++LP+G         V+ NT++I+SF
Sbjct  156  VEECKKLVYIHACLSETLRLFPPVALELKSPVEPNILPAGGNNNNNNIKVEKNTKIIISF  215

Query  490  YSSGRMDSIWGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMI  311
            YS+GRM+S+WG+DC+EFKPERWI + G ++HEPS++FPAFN GPR+C GKEM  V+MKM+
Sbjct  216  YSTGRMESVWGKDCLEFKPERWILAGGELRHEPSFRFPAFNVGPRSCPGKEMSFVEMKMV  275

Query  310  AAIILHHYEFQ  278
            A  I+H Y  +
Sbjct  276  AVAIVHRYRVR  286



>ref|XP_010429263.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = -2

Query  643  ECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDSI  464
            E  KLVYLHGALCES RL+P V  +HK     DVLPSGH V  +++++   YS GRM S+
Sbjct  361  ELNKLVYLHGALCESLRLYPSVPFQHKSPTKSDVLPSGHKVDASSKIVFCLYSLGRMKSV  420

Query  463  WGEDCMEFKPERWISSKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHHYE  284
            WGED  EFKPERW+S  GR+ H PS+KF +FNAGPRTCLGKE+ + QMK+ A  I+ +Y+
Sbjct  421  WGEDASEFKPERWVSENGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKITAVKIIQNYD  480

Query  283  FQvvdshsvspsdsiiIQAKHGLKVKFTKR  194
             +VV+ H + P  SII+  KHGLKV  TKR
Sbjct  481  IKVVEGHKIEPVPSIILHMKHGLKVTVTKR  510



>gb|EYU27555.1| hypothetical protein MIMGU_mgv1a020397mg [Erythranthe guttata]
Length=503

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = -2

Query  646  EECQKLVYLHGALCESXRLFPPVAIEHKVSAGMDVLPSGHLVKPNTRMILSFYSSGRMDS  467
            E+ +KL YLHGA+CE+ RL+P +A + K +   D+LPSGH +  NT+ +LS YS GRM+S
Sbjct  351  EDLKKLNYLHGAVCETLRLYPTIAFQFKSTVEHDILPSGHAINANTKTVLSLYSMGRMES  410

Query  466  IWGEDCMEFKPERWIS-SKGRIKHEPSYKFPAFNAGPRTCLGKEMGLVQMKMIAAIILHH  290
            IWG+DC+ FKP RWI+   GRIK EPS+KF AFN+GPR+CLGKE+  +QMK++AA I+  
Sbjct  411  IWGKDCLNFKPGRWINPETGRIKTEPSFKFSAFNSGPRSCLGKEITFIQMKIVAAAIMSR  470

Query  289  YEFQvvdshsvspsdsiiIQAKHGLKVKFT  200
            + F+V   H +SPS S+++  KHGLKVK +
Sbjct  471  FHFRVAQGHLISPSASVVLHMKHGLKVKVS  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700