BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003I16

Length=766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773348.1|  PREDICTED: uncharacterized protein LOC104223588    313   6e-102   Nicotiana sylvestris
ref|XP_006348416.1|  PREDICTED: uncharacterized protein YMR315W-like    312   1e-101   Solanum tuberosum [potatoes]
ref|XP_009588958.1|  PREDICTED: uncharacterized protein YMR315W         311   2e-101   Nicotiana tomentosiformis
ref|XP_004228627.1|  PREDICTED: uncharacterized oxidoreductase C2...    311   3e-101   Solanum lycopersicum
gb|KDP20201.1|  hypothetical protein JCGZ_07921                         300   7e-97    Jatropha curcas
ref|XP_011025252.1|  PREDICTED: uncharacterized protein YMR315W i...    299   2e-96    Populus euphratica
emb|CDP14087.1|  unnamed protein product                                298   3e-96    Coffea canephora [robusta coffee]
ref|XP_011025251.1|  PREDICTED: uncharacterized protein YMR315W i...    294   1e-94    Populus euphratica
ref|XP_006386094.1|  hypothetical protein POPTR_0003s22050g             293   3e-94    Populus trichocarpa [western balsam poplar]
ref|XP_002513445.1|  oxidoreductase, putative                           292   8e-94    Ricinus communis
ref|XP_011080243.1|  PREDICTED: uncharacterized protein LOC105163544    291   2e-93    Sesamum indicum [beniseed]
ref|XP_006386095.1|  hypothetical protein POPTR_0003s22050g             289   2e-92    Populus trichocarpa [western balsam poplar]
emb|CBI16434.3|  unnamed protein product                                288   2e-92    Vitis vinifera
ref|XP_002285606.1|  PREDICTED: uncharacterized protein LOC100245...    288   2e-92    Vitis vinifera
ref|XP_006445974.1|  hypothetical protein CICLE_v10015756mg             287   7e-92    Citrus clementina [clementine]
ref|XP_006494722.1|  PREDICTED: uncharacterized protein YMR315W-like    287   8e-92    Citrus sinensis [apfelsine]
ref|XP_011461910.1|  PREDICTED: uncharacterized protein YMR315W         285   6e-91    Fragaria vesca subsp. vesca
gb|ABK96297.1|  unknown                                                 283   2e-90    Populus trichocarpa x Populus deltoides
ref|XP_008243595.1|  PREDICTED: uncharacterized protein YMR315W         283   2e-90    Prunus mume [ume]
ref|XP_009364714.1|  PREDICTED: uncharacterized protein LOC103954601    278   1e-88    Pyrus x bretschneideri [bai li]
ref|XP_010257400.1|  PREDICTED: uncharacterized protein LOC104597...    278   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_007150403.1|  hypothetical protein PHAVU_005G150400g             278   3e-88    Phaseolus vulgaris [French bean]
ref|XP_010257399.1|  PREDICTED: uncharacterized protein LOC104597...    278   4e-88    Nelumbo nucifera [Indian lotus]
ref|XP_003543553.1|  PREDICTED: uncharacterized protein YMR315W         278   4e-88    Glycine max [soybeans]
ref|XP_009364727.1|  PREDICTED: uncharacterized protein LOC103954617    277   5e-88    Pyrus x bretschneideri [bai li]
ref|XP_010257398.1|  PREDICTED: uncharacterized protein LOC104597...    278   5e-88    Nelumbo nucifera [Indian lotus]
ref|XP_004486934.1|  PREDICTED: uncharacterized protein YMR315W-like    277   6e-88    Cicer arietinum [garbanzo]
gb|AFK46300.1|  unknown                                                 276   9e-88    Lotus japonicus
ref|XP_009145584.1|  PREDICTED: uncharacterized protein YMR315W         275   2e-87    Brassica rapa
ref|XP_008358864.1|  PREDICTED: uncharacterized protein YMR315W-l...    275   3e-87    Malus domestica [apple tree]
ref|XP_008358862.1|  PREDICTED: uncharacterized protein YMR315W-l...    275   3e-87    Malus domestica [apple tree]
ref|XP_004162028.1|  PREDICTED: uncharacterized LOC101204258            271   4e-87    
ref|XP_003597479.1|  Oxidoreductase, putative                           275   4e-87    Medicago truncatula
ref|XP_010031848.1|  PREDICTED: uncharacterized protein YMR315W         273   3e-86    Eucalyptus grandis [rose gum]
gb|KFK39395.1|  hypothetical protein AALP_AA3G239500                    273   3e-86    Arabis alpina [alpine rockcress]
ref|XP_006406349.1|  hypothetical protein EUTSA_v10021019mg             272   4e-86    Eutrema salsugineum [saltwater cress]
ref|XP_008449757.1|  PREDICTED: uncharacterized protein YMR315W         272   5e-86    
ref|XP_010544236.1|  PREDICTED: uncharacterized protein YMR315W i...    271   9e-86    Tarenaya hassleriana [spider flower]
ref|XP_010544235.1|  PREDICTED: uncharacterized protein YMR315W i...    271   2e-85    Tarenaya hassleriana [spider flower]
ref|XP_010091995.1|  Uncharacterized protein L484_007981                270   4e-85    
ref|XP_010488066.1|  PREDICTED: glucose-fructose oxidoreductase d...    268   3e-84    Camelina sativa [gold-of-pleasure]
gb|KJB66097.1|  hypothetical protein B456_010G128200                    267   3e-84    Gossypium raimondii
gb|KJB66100.1|  hypothetical protein B456_010G128200                    261   4e-84    Gossypium raimondii
ref|XP_006298014.1|  hypothetical protein CARUB_v10014059mg             267   5e-84    
ref|XP_010913917.1|  PREDICTED: uncharacterized protein LOC105039...    266   8e-84    Elaeis guineensis
gb|KJB66094.1|  hypothetical protein B456_010G128200                    264   9e-84    Gossypium raimondii
ref|NP_188715.2|  NAD(P)-binding Rossmann-fold superfamily protein      265   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509356.1|  PREDICTED: glucose-fructose oxidoreductase d...    265   3e-83    Camelina sativa [gold-of-pleasure]
gb|KJB66101.1|  hypothetical protein B456_010G128200                    261   3e-83    Gossypium raimondii
ref|XP_010466287.1|  PREDICTED: uncharacterized protein LOC104746495    260   4e-83    Camelina sativa [gold-of-pleasure]
gb|KJB66098.1|  hypothetical protein B456_010G128200                    263   1e-82    Gossypium raimondii
gb|KJB66099.1|  hypothetical protein B456_010G128200                    263   1e-82    Gossypium raimondii
gb|KJB66096.1|  hypothetical protein B456_010G128200                    263   2e-82    Gossypium raimondii
ref|XP_010673579.1|  PREDICTED: uncharacterized protein YMR315W i...    263   2e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673578.1|  PREDICTED: uncharacterized protein YMR315W i...    263   2e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008787293.1|  PREDICTED: uncharacterized protein LOC103705381    263   3e-82    Phoenix dactylifera
ref|XP_002459955.1|  hypothetical protein SORBIDRAFT_02g018670          262   6e-82    Sorghum bicolor [broomcorn]
gb|KHG07862.1|  Uncharacterized protein F383_13730                      260   2e-81    Gossypium arboreum [tree cotton]
ref|XP_009385566.1|  PREDICTED: glucose-fructose oxidoreductase d...    260   2e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001062764.1|  Os09g0280300                                       260   3e-81    
ref|XP_004956459.1|  PREDICTED: uncharacterized protein YMR315W-like    259   4e-81    Setaria italica
gb|AFK42402.1|  unknown                                                 253   5e-81    Lotus japonicus
ref|XP_002883268.1|  oxidoreductase family protein                      258   2e-80    
ref|XP_006660493.1|  PREDICTED: uncharacterized protein YMR315W-like    257   2e-80    Oryza brachyantha
gb|KJB66095.1|  hypothetical protein B456_010G128200                    257   3e-80    Gossypium raimondii
ref|NP_001149836.1|  NAD-dependent dyhydrogenase, Gfo/Idh/MocA fa...    256   6e-80    Zea mays [maize]
ref|XP_007014899.1|  Oxidoreductase, putative isoform 1                 255   2e-79    
ref|XP_003577920.1|  PREDICTED: uncharacterized protein LOC100827110    254   4e-79    Brachypodium distachyon [annual false brome]
ref|XP_008668038.1|  PREDICTED: NAD-dependent dyhydrogenase, Gfo/...    254   4e-79    Zea mays [maize]
emb|CDY06381.1|  BnaC05g31490D                                          253   6e-79    
emb|CDY19604.1|  BnaA05g20120D                                          253   7e-79    Brassica napus [oilseed rape]
gb|EMT01460.1|  hypothetical protein F775_26364                         251   7e-78    
ref|XP_007205433.1|  hypothetical protein PRUPE_ppa007778mg             248   8e-77    
ref|XP_006850072.1|  hypothetical protein AMTR_s00022p00213490          243   1e-74    
gb|EEE69341.1|  hypothetical protein OsJ_28659                          242   2e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011090402.1|  PREDICTED: uncharacterized protein YMR315W-like    236   3e-72    Sesamum indicum [beniseed]
emb|CAN75498.1|  hypothetical protein VITISV_020272                     234   3e-71    Vitis vinifera
ref|XP_010651283.1|  PREDICTED: uncharacterized protein LOC100245...    232   6e-71    Vitis vinifera
gb|EPS68382.1|  hypothetical protein M569_06387                         233   7e-71    Genlisea aurea
gb|EYU46305.1|  hypothetical protein MIMGU_mgv1a0096472mg               225   1e-70    Erythranthe guttata [common monkey flower]
gb|EYU18011.1|  hypothetical protein MIMGU_mgv1a008840mg                230   1e-69    Erythranthe guttata [common monkey flower]
ref|XP_010913920.1|  PREDICTED: uncharacterized protein LOC105039...    223   5e-67    Elaeis guineensis
gb|KGN54118.1|  hypothetical protein Csa_4G286420                       214   6e-66    
ref|XP_007014900.1|  Oxidoreductase, putative isoform 2                 210   5e-62    
ref|XP_001762266.1|  predicted protein                                  184   4e-52    
ref|XP_010651284.1|  PREDICTED: uncharacterized protein LOC100245...    178   3e-50    
ref|XP_002976631.1|  hypothetical protein SELMODRAFT_416506             166   4e-45    Selaginella moellendorffii
ref|XP_002969664.1|  hypothetical protein SELMODRAFT_92921              165   7e-45    
ref|XP_002973220.1|  hypothetical protein SELMODRAFT_413759             164   1e-44    
ref|XP_002981277.1|  hypothetical protein SELMODRAFT_114540             155   2e-41    
ref|XP_001754780.1|  predicted protein                                  155   3e-41    
ref|XP_004142242.1|  PREDICTED: uncharacterized LOC101204258            151   7e-41    
ref|XP_006445973.1|  hypothetical protein CICLE_v10015756mg             151   3e-40    
ref|XP_002973823.1|  hypothetical protein SELMODRAFT_414190             151   1e-39    
gb|KCW51233.1|  hypothetical protein EUGRSUZ_J00813                     148   4e-39    Eucalyptus grandis [rose gum]
ref|XP_001776337.1|  predicted protein                                  139   4e-35    
dbj|BAB02487.1|  unnamed protein product                                119   5e-28    Arabidopsis thaliana [mouse-ear cress]
gb|KEH18356.1|  NAD(P)-binding rossmann-fold protein, putative          105   8e-25    Medicago truncatula
gb|KEH18355.1|  NAD(P)-binding rossmann-fold protein, putative          105   1e-24    Medicago truncatula
emb|CDY27562.1|  BnaC01g32450D                                        99.8    9e-22    Brassica napus [oilseed rape]
ref|XP_001942427.1|  conserved hypothetical protein                   97.4    4e-20    Pyrenophora tritici-repentis Pt-1C-BFP
gb|ACU17312.1|  unknown                                               94.0    2e-19    Glycine max [soybeans]
gb|KEQ84242.1|  NAD(P)-binding protein                                95.1    2e-19    Aureobasidium pullulans EXF-150
gb|EMD87949.1|  hypothetical protein COCHEDRAFT_1183091               93.2    1e-18    Bipolaris maydis C5
ref|XP_007713573.1|  hypothetical protein COCCADRAFT_99511            92.0    3e-18    Bipolaris zeicola 26-R-13
gb|KEQ61018.1|  oxidoreductase-like protein family                    92.0    3e-18    Aureobasidium melanogenum CBS 110374
gb|KEQ74017.1|  NAD(P)-binding protein                                91.7    3e-18    Aureobasidium namibiae CBS 147.97
ref|XP_007785079.1|  hypothetical protein W97_09025                   90.9    7e-18    Coniosporium apollinis CBS 100218
ref|XP_007699535.1|  hypothetical protein COCSADRAFT_89105            89.0    3e-17    Bipolaris sorokiniana ND90Pr
gb|EUN24448.1|  hypothetical protein COCVIDRAFT_106168                88.6    4e-17    Bipolaris victoriae FI3
gb|KDQ06959.1|  hypothetical protein BOTBODRAFT_60302                 87.8    8e-17    Botryobasidium botryosum FD-172 SS1
gb|KEQ94380.1|  hypothetical protein AUEXF2481DRAFT_270651            87.0    1e-16    Aureobasidium subglaciale EXF-2481
ref|XP_003300258.1|  hypothetical protein PTT_11448                   86.7    2e-16    
ref|XP_007686203.1|  hypothetical protein COCMIDRAFT_90481            85.9    3e-16    Bipolaris oryzae ATCC 44560
gb|EFQ28397.1|  oxidoreductase family protein                         85.9    4e-16    Colletotrichum graminicola M1.001
ref|XP_011399715.1|  Uncharacterized protein F751_0699                86.3    4e-16    Auxenochlorella protothecoides
gb|KIO22407.1|  hypothetical protein M407DRAFT_118073                 85.9    5e-16    Tulasnella calospora MUT 4182
ref|XP_008025728.1|  hypothetical protein SETTUDRAFT_135946           85.1    8e-16    Exserohilum turcica Et28A
emb|CCF43203.1|  oxidoreductase                                       83.6    3e-15    Colletotrichum higginsianum
ref|XP_001935897.1|  conserved hypothetical protein                   83.2    3e-15    Pyrenophora tritici-repentis Pt-1C-BFP
gb|EPS29944.1|  hypothetical protein PDE_04894                        83.2    3e-15    Penicillium oxalicum 114-2
gb|KIH88824.1|  hypothetical protein SPBR_07486                       82.8    4e-15    Sporothrix brasiliensis 5110
ref|XP_007603283.1|  oxidoreductase                                   82.8    4e-15    
ref|XP_007588173.1|  putative oxidoreductase nad-binding rossmann...  80.9    2e-14    
gb|ENH79899.1|  oxidoreductase nad-binding rossmann fold protein      81.3    2e-14    
ref|XP_002183307.1|  predicted protein                                81.6    2e-14    Phaeodactylum tricornutum CCAP 1055/1
gb|KIV83264.1|  hypothetical protein PV11_05309                       80.5    2e-14    Exophiala sideris
ref|XP_007674297.1|  hypothetical protein BAUCODRAFT_22896            80.5    3e-14    Baudoinia panamericana UAMH 10762
gb|KEZ45810.1|  Oxidoreductase-like protein                           79.7    5e-14    Scedosporium apiospermum
ref|XP_011117421.1|  hypothetical protein AOL_s00004g470              79.7    7e-14    Arthrobotrys oligospora ATCC 24927
ref|XP_008085160.1|  NAD(P)-binding Rossmann-fold containing protein  78.6    1e-13    Glarea lozoyensis ATCC 20868
gb|KFY61799.1|  hypothetical protein V496_04887                       80.5    1e-13    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ERT02500.1|  hypothetical protein HMPREF1624_00799                 78.6    1e-13    Sporothrix schenckii ATCC 58251
gb|KFX44107.1|  Uncharacterized protein GQ26_0300340                  76.3    2e-13    Talaromyces marneffei PM1
gb|KFZ16228.1|  hypothetical protein V501_02319                       78.2    2e-13    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|ERT03209.1|  hypothetical protein HMPREF1624_01515                 77.8    2e-13    Sporothrix schenckii ATCC 58251
dbj|GAM35894.1|  oxidoreductase                                       77.8    3e-13    Talaromyces cellulolyticus
ref|XP_003840030.1|  similar to oxidoreductase family                 77.4    4e-13    Leptosphaeria maculans JN3
gb|KIH86578.1|  hypothetical protein SPBR_08549                       77.8    4e-13    Sporothrix brasiliensis 5110
ref|XP_006962588.1|  predicted protein                                77.0    4e-13    Trichoderma reesei QM6a
ref|XP_007793174.1|  putative oxidoreductase nad-binding rossmann...  76.6    4e-13    
ref|XP_007275100.1|  oxidoreductase nad-binding rossmann fold pro...  77.0    5e-13    
gb|KFY75511.1|  hypothetical protein V499_04510                       77.0    5e-13    Pseudogymnoascus sp. VKM F-103
gb|ETS04874.1|  NAD-binding Rossmann fold oxidoreductase              77.0    5e-13    Trichoderma reesei RUT C-30
ref|XP_007839104.1|  hypothetical protein PFICI_12332                 77.0    6e-13    Pestalotiopsis fici W106-1
gb|EQB57311.1|  hypothetical protein CGLO_02580                       76.6    7e-13    Colletotrichum gloeosporioides Cg-14
gb|EWC48565.1|  hypothetical protein DRE_01787                        76.6    9e-13    Drechslerella stenobrocha 248
ref|XP_011318574.1|  hypothetical protein FGSG_02628                  76.3    1e-12    Fusarium graminearum PH-1
ref|XP_003045334.1|  hypothetical protein NECHADRAFT_70521            75.9    1e-12    [Nectria] haematococca mpVI 77-13-4
ref|XP_009263289.1|  hypothetical protein FPSE_11897                  75.9    1e-12    Fusarium pseudograminearum CS3096
gb|KFZ09203.1|  hypothetical protein V502_08867                       75.9    2e-12    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY88446.1|  hypothetical protein V500_06334                       75.9    2e-12    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_002146783.1|  oxidoreductase family, NAD-binding Rossmann ...  75.5    2e-12    Talaromyces marneffei ATCC 18224
ref|XP_007295758.1|  oxidoreductase family protein                    75.5    2e-12    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_009153161.1|  glucose-fructose oxidoreductase                  75.5    2e-12    Exophiala dermatitidis NIH/UT8656
gb|KIW21209.1|  hypothetical protein PV08_01789                       75.5    2e-12    Exophiala spinifera
gb|EPS32813.1|  hypothetical protein PDE_07773                        75.1    2e-12    Penicillium oxalicum 114-2
gb|KIM99483.1|  hypothetical protein OIDMADRAFT_89802                 75.1    2e-12    Oidiodendron maius Zn
gb|KEZ39853.1|  Oxidoreductase-like protein                           75.1    3e-12    Scedosporium apiospermum
gb|EHK50187.1|  hypothetical protein TRIATDRAFT_233440                74.7    3e-12    Trichoderma atroviride IMI 206040
ref|XP_006455042.1|  hypothetical protein AGABI2DRAFT_194743          74.7    4e-12    Agaricus bisporus var. bisporus H97
ref|XP_011112776.1|  hypothetical protein H072_7001                   74.7    4e-12    
gb|KIL95797.1|  glucose-fructose oxidoreductase                       74.3    5e-12    Fusarium avenaceum
ref|XP_006696746.1|  hypothetical protein CTHT_0064410                74.7    6e-12    Chaetomium thermophilum var. thermophilum DSM 1495
gb|ELR09495.1|  hypothetical protein GMDG_00677                       73.6    8e-12    Pseudogymnoascus destructans 20631-21
gb|EHK17838.1|  hypothetical protein TRIVIDRAFT_136949                73.6    8e-12    Trichoderma virens Gv29-8
ref|XP_007330917.1|  hypothetical protein AGABI1DRAFT_114560          73.9    8e-12    Agaricus bisporus var. burnettii JB137-S8
gb|KIW39301.1|  hypothetical protein PV06_09085                       72.8    1e-11    Exophiala oligosperma
gb|KFX44108.1|  Uncharacterized protein GQ26_0300340                  71.6    2e-11    Talaromyces marneffei PM1
gb|KIM22883.1|  hypothetical protein M408DRAFT_332653                 72.4    2e-11    Serendipita vermifera MAFF 305830
ref|XP_003347717.1|  hypothetical protein SMAC_03815                  72.0    3e-11    Sordaria macrospora k-hell
gb|KIO22409.1|  hypothetical protein M407DRAFT_245182                 72.0    3e-11    Tulasnella calospora MUT 4182
gb|KFX46381.1|  Uncharacterized protein GQ26_0191180                  71.6    3e-11    Talaromyces marneffei PM1
gb|EEQ92492.1|  NAD-binding Rossmann fold oxidoreductase              71.6    4e-11    Blastomyces dermatitidis ER-3
gb|EQL35203.1|  hypothetical protein BDFG_03181                       71.6    4e-11    Blastomyces dermatitidis ATCC 26199
ref|XP_002626131.1|  NAD-binding Rossmann fold oxidoreductase         71.6    4e-11    Blastomyces gilchristii SLH14081
ref|XP_007324396.1|  hypothetical protein SERLADRAFT_364213           71.6    4e-11    Serpula lacrymans var. lacrymans S7.9
gb|KIV93979.1|  hypothetical protein PV10_05146                       71.6    4e-11    Exophiala mesophila
emb|CCA69637.1|  hypothetical protein PIIN_03576                      71.6    5e-11    Serendipita indica DSM 11827
gb|EGE83963.1|  NAD-binding Rossmann fold oxidoreductase              71.2    6e-11    Blastomyces dermatitidis ATCC 18188
gb|KIX08304.1|  hypothetical protein Z518_02960                       71.2    6e-11    Rhinocladiella mackenziei CBS 650.93
emb|CCT69021.1|  related to dehydrogenases and related proteins       70.9    7e-11    Fusarium fujikuroi IMI 58289
gb|KFY00135.1|  hypothetical protein O988_03504                       70.9    7e-11    Pseudogymnoascus sp. VKM F-3808
ref|XP_002839683.1|  hypothetical protein                             70.9    8e-11    Tuber melanosporum Mel28
gb|EPE09779.1|  nad-binding rossmann fold oxidoreductase family p...  70.9    8e-11    Ophiostoma piceae UAMH 11346
ref|XP_001906379.1|  hypothetical protein                             70.5    9e-11    Podospora anserina S mat+
gb|KFH44383.1|  hypothetical protein ACRE_048520                      70.5    1e-10    Acremonium chrysogenum ATCC 11550
gb|KIY03803.1|  hypothetical protein Z520_00494                       70.1    1e-10    Fonsecaea multimorphosa CBS 102226
ref|XP_568129.1|  hypothetical protein                                70.5    1e-10    Cryptococcus neoformans var. neoformans JEC21
ref|XP_007760853.1|  hypothetical protein A1O7_08673                  70.1    1e-10    Cladophialophora yegresii CBS 114405
ref|XP_007733422.1|  hypothetical protein A1O3_05105                  69.7    2e-10    Capronia epimyces CBS 606.96
ref|XP_007794424.1|  putative oxidoreductase nad-binding rossmann...  70.1    2e-10    
gb|ERS96910.1|  hypothetical protein HMPREF1624_06237                 70.1    2e-10    Sporothrix schenckii ATCC 58251
gb|EWG49872.1|  glucose-fructose oxidoreductase                       69.7    2e-10    Fusarium verticillioides 7600
ref|XP_001216107.1|  predicted protein                                70.5    2e-10    Aspergillus terreus NIH2624
ref|XP_002479070.1|  oxidoreductase family, NAD-binding Rossmann ...  69.7    2e-10    Talaromyces stipitatus ATCC 10500
gb|EER41723.1|  NAD-binding Rossmann fold oxidoreductase              69.3    3e-10    Histoplasma capsulatum H143
gb|KEF53140.1|  hypothetical protein A1O9_11048                       68.9    3e-10    Exophiala aquamarina CBS 119918
ref|XP_755974.1|  oxidoreductase family, NAD-binding Rossmann fol...  69.3    3e-10    Aspergillus fumigatus Af293
ref|XP_003047008.1|  hypothetical protein NECHADRAFT_95358            68.9    3e-10    [Nectria] haematococca mpVI 77-13-4
gb|KFY14890.1|  hypothetical protein V492_02347                       68.9    4e-10    Pseudogymnoascus sp. VKM F-4246
emb|CCX08562.1|  Similar to Putative uracil phosphoribosyltransfe...  69.3    4e-10    Pyronema omphalodes CBS 100304
gb|EIT72400.1|  putative dehydrogenase                                68.9    4e-10    Aspergillus oryzae 3.042
dbj|BAE63558.1|  unnamed protein product                              68.9    4e-10    Aspergillus oryzae RIB40
gb|ENH74564.1|  hypothetical protein FOC1_g10009984                   68.6    4e-10    Fusarium oxysporum f. sp. cubense race 1
gb|EMT70613.1|  hypothetical protein FOC4_g10009079                   68.6    4e-10    Fusarium oxysporum f. sp. cubense race 4
gb|EWZ38499.1|  glucose-fructose oxidoreductase                       68.6    5e-10    Fusarium oxysporum Fo47
gb|EXK91996.1|  glucose-fructose oxidoreductase                       68.6    5e-10    Fusarium oxysporum f. sp. raphani 54005
gb|EWY91836.1|  glucose-fructose oxidoreductase                       68.6    5e-10    Fusarium oxysporum FOSC 3-a
ref|XP_007367395.1|  oxidoreductase family protein                    68.6    6e-10    Dichomitus squalens LYAD-421 SS1
gb|KIN06467.1|  hypothetical protein OIDMADRAFT_155638                68.2    6e-10    Oidiodendron maius Zn
ref|XP_773472.1|  hypothetical protein CNBI0860                       68.2    6e-10    Cryptococcus neoformans var. neoformans B-3501A
gb|EGU88150.1|  hypothetical protein FOXB_01288                       68.9    7e-10    Fusarium oxysporum Fo5176
gb|KFY35329.1|  hypothetical protein V494_06008                       68.2    7e-10    Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KGQ09050.1|  hypothetical protein BBAD15_g5618                     65.9    8e-10    Beauveria bassiana D1-5
ref|XP_007722030.1|  hypothetical protein A1O1_02932                  67.8    8e-10    Capronia coronata CBS 617.96
ref|XP_003715071.1|  NAD-binding Rossmann fold oxidoreductase         67.8    8e-10    Magnaporthe oryzae 70-15
ref|XP_007911759.1|  putative oxidoreductase nad-binding rossmann...  67.8    8e-10    Phaeoacremonium minimum UCRPA7
gb|KIR46389.1|  NAD-binding Rossmann fold oxidoreductase              67.8    8e-10    Cryptococcus gattii CA1280
gb|EKV16143.1|  Oxidoreductase family, NAD-binding Rossmann fold ...  68.2    9e-10    Penicillium digitatum Pd1
gb|KIR59526.1|  NAD-binding Rossmann fold oxidoreductase              67.8    9e-10    Cryptococcus gattii CA1873
gb|KIR85165.1|  NAD-binding Rossmann fold oxidoreductase              67.8    1e-09    Cryptococcus gattii VGIV IND107
gb|AFR94284.1|  NAD-binding Rossmann fold oxidoreductase              67.8    1e-09    Cryptococcus neoformans var. grubii H99
ref|XP_001554573.1|  hypothetical protein BC1G_07162                  67.4    1e-09    Botrytis cinerea B05.10
gb|KIW64306.1|  hypothetical protein PV04_09250                       67.4    1e-09    Phialophora americana
ref|XP_009854174.1|  hypothetical protein NEUTE1DRAFT_131795          67.4    1e-09    Neurospora tetrasperma FGSC 2508
gb|KIW42674.1|  hypothetical protein PV06_06200                       67.4    1e-09    Exophiala oligosperma
gb|EEH05857.1|  NAD-binding Rossmann fold oxidoreductase              67.4    1e-09    Histoplasma capsulatum G186AR
gb|KIR26739.1|  NAD-binding Rossmann fold oxidoreductase              67.4    1e-09    Cryptococcus gattii VGII LA55
gb|KIS02481.1|  NAD-binding Rossmann fold oxidoreductase              67.4    1e-09    Cryptococcus gattii VGII 2001/935-1
ref|XP_008045096.1|  oxidoreductase family protein                    67.4    2e-09    Trametes versicolor FP-101664 SS1
gb|KIW64066.1|  hypothetical protein PV04_09025                       67.0    2e-09    Phialophora americana
ref|XP_001538347.1|  predicted protein                                67.0    2e-09    Histoplasma capsulatum NAm1
gb|EXL57961.1|  glucose-fructose oxidoreductase                       67.0    2e-09    Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|KIW87520.1|  hypothetical protein Z519_11843                       67.0    2e-09    Cladophialophora bantiana CBS 173.52
ref|XP_007727310.1|  hypothetical protein A1O1_08258                  67.0    2e-09    Capronia coronata CBS 617.96
ref|XP_003194017.1|  hypothetical protein CGB_D1030C                  67.0    2e-09    Cryptococcus gattii WM276
gb|KIR53880.1|  NAD-binding Rossmann fold oxidoreductase              67.0    2e-09    Cryptococcus gattii Ru294
gb|KEZ38713.1|  Oxidoreductase                                        66.6    2e-09    Scedosporium apiospermum
gb|EMS23348.1|  NAD dependent oxidoreductase                          66.6    3e-09    Rhodotorula toruloides NP11
gb|KIV87570.1|  hypothetical protein PV11_03107                       66.2    3e-09    Exophiala sideris
ref|XP_007740232.1|  hypothetical protein A1O5_01425                  66.2    3e-09    Cladophialophora psammophila CBS 110553
gb|KGB78824.1|  hypothetical protein CNBG_4662                        66.2    3e-09    Cryptococcus gattii VGII R265
ref|XP_006445972.1|  hypothetical protein CICLE_v10015756mg           64.7    3e-09    
ref|XP_680622.1|  hypothetical protein AN7353.2                       66.2    3e-09    Aspergillus nidulans FGSC A4
ref|XP_008730183.1|  hypothetical protein G647_07648                  65.9    4e-09    Cladophialophora carrionii CBS 160.54
ref|XP_008597824.1|  oxidoreductase family protein                    65.9    5e-09    Beauveria bassiana ARSEF 2860
ref|XP_008716792.1|  hypothetical protein HMPREF1541_04224            65.9    5e-09    Cyphellophora europaea CBS 101466
gb|ESZ98482.1|  hypothetical protein SBOR_1144                        65.5    6e-09    Sclerotinia borealis F-4128
ref|XP_001593666.1|  hypothetical protein SS1G_05094                  65.5    6e-09    Sclerotinia sclerotiorum 1980 UF-70
ref|XP_002567221.1|  Pc21g01510                                       65.1    6e-09    Penicillium rubens Wisconsin 54-1255
gb|KGO40526.1|  Oxidoreductase, N-terminal                            65.5    8e-09    Penicillium expansum
gb|KEY68231.1|  hypothetical protein S7711_04765                      65.1    8e-09    Stachybotrys chartarum IBT 7711
gb|EJU01365.1|  NADP-binding protein                                  65.1    9e-09    Dacryopinax primogenitus
gb|KGO75187.1|  Oxidoreductase, N-terminal                            65.1    9e-09    Penicillium italicum
gb|KFX45295.1|  Uncharacterized protein GQ26_0241310                  64.7    9e-09    Talaromyces marneffei PM1
gb|KFA50043.1|  hypothetical protein S40293_06825                     64.7    9e-09    Stachybotrys chartarum IBT 40293
ref|XP_001275918.1|  NAD-binding Rossmann fold oxidoreductase fam...  64.7    9e-09    Aspergillus clavatus NRRL 1
gb|KFA81971.1|  hypothetical protein S40288_04398                     64.7    1e-08    Stachybotrys chartarum IBT 40288
ref|XP_009550993.1|  hypothetical protein HETIRDRAFT_441859           64.7    1e-08    Heterobasidion irregulare TC 32-1
gb|KIW03136.1|  hypothetical protein PV09_05778                       64.7    1e-08    Verruconis gallopava
ref|XP_001227364.1|  hypothetical protein CHGG_09437                  65.1    1e-08    Chaetomium globosum CBS 148.51
gb|KHE80312.1|  NAD(P)-binding protein                                64.3    1e-08    Neurospora crassa
gb|KIJ64897.1|  hypothetical protein HYDPIDRAFT_181650                64.3    1e-08    Hydnomerulius pinastri MD-312
ref|XP_960192.1|  NAD-binding Rossmann fold oxidoreductase            63.9    2e-08    Neurospora crassa OR74A
ref|XP_002150922.1|  oxidoreductase, putative                         63.9    2e-08    Talaromyces marneffei ATCC 18224
gb|KFX97097.1|  hypothetical protein V490_02972                       63.9    2e-08    Pseudogymnoascus sp. VKM F-3557
gb|KFA62356.1|  hypothetical protein S40285_08590                     63.9    2e-08    Stachybotrys chlorohalonata IBT 40285
ref|XP_009654382.1|  NAD-binding Rossmann fold oxidoreductase fam...  63.9    2e-08    Verticillium dahliae VdLs.17
gb|KIW33724.1|  hypothetical protein PV07_00552                       63.9    2e-08    Cladophialophora immunda
gb|KIW60300.1|  hypothetical protein PV05_00529                       63.5    2e-08    Exophiala xenobiotica
gb|EHK24126.1|  hypothetical protein TRIVIDRAFT_45259                 63.5    2e-08    Trichoderma virens Gv29-8
dbj|GAM37326.1|  oxidoreductase                                       63.5    3e-08    Talaromyces cellulolyticus
gb|KIW86052.1|  hypothetical protein Z517_01446                       63.2    3e-08    Fonsecaea pedrosoi CBS 271.37
emb|CEP60003.1|  LALA0S01e00804g1_1                                   63.2    3e-08    Lachancea lanzarotensis
ref|XP_007769867.1|  NAD(P)-binding protein                           63.2    4e-08    Coniophora puteana RWD-64-598 SS2
ref|XP_002554199.1|  KLTH0E16522p                                     63.2    4e-08    Lachancea thermotolerans CBS 6340
ref|XP_004152962.1|  PREDICTED: uncharacterized protein LOC101204258  58.9    4e-08    
ref|XP_001261103.1|  hypothetical protein NFIA_091650                 63.2    4e-08    Aspergillus fischeri NRRL 181
emb|CEJ83936.1|  hypothetical protein VHEMI03305                      62.8    5e-08    
ref|XP_009230177.1|  NAD-binding Rossmann fold oxidoreductase         62.8    5e-08    
ref|XP_003045013.1|  hypothetical protein NECHADRAFT_43861            62.4    6e-08    
gb|KFY46177.1|  hypothetical protein V495_02629                       62.4    6e-08    
gb|KFY59684.1|  hypothetical protein V497_04131                       62.4    6e-08    
gb|KFY03608.1|  hypothetical protein O988_01367                       62.4    7e-08    
gb|EHK44528.1|  hypothetical protein TRIATDRAFT_300680                62.4    7e-08    
ref|XP_006969500.1|  predicted protein                                62.0    8e-08    
ref|XP_001397204.1|  NAD-binding Rossmann fold oxidoreductase fam...  61.6    1e-07    
dbj|GAA91490.1|  oxidoreductase family, NAD-binding Rossmann fold...  61.6    1e-07    
gb|EIT80267.1|  putative dehydrogenase                                61.6    1e-07    
ref|XP_002382548.1|  oxidoreductase family, NAD-binding Rossmann ...  61.2    1e-07    
dbj|BAE61316.1|  unnamed protein product                              61.2    1e-07    
dbj|GAM42631.1|  oxidoreductase                                       61.2    1e-07    
ref|XP_007824029.2|  oxidoreductase                                   61.2    2e-07    
gb|KIN02849.1|  hypothetical protein OIDMADRAFT_40668                 61.2    2e-07    
gb|KIY44168.1|  NAD(P)-binding protein                                61.2    2e-07    
ref|XP_001211482.1|  conserved hypothetical protein                   59.3    2e-07    
ref|XP_007350429.1|  NAD(P)-binding protein                           61.2    2e-07    
gb|KIH93169.1|  hypothetical protein SPBR_02922                       60.8    2e-07    
ref|XP_007769882.1|  NAD(P)-binding protein                           60.5    3e-07    
ref|XP_003007531.1|  NAD-binding Rossmann fold oxidoreductase fam...  60.5    3e-07    
gb|EFX03707.1|  nuclear migration protein                             60.1    5e-07    
ref|XP_001822449.2|  hypothetical protein AOR_1_404134                59.7    6e-07    
gb|ERT01696.1|  hypothetical protein HMPREF1624_02949                 59.7    6e-07    
emb|CDM31202.1|  NAD(P)-binding domain                                59.3    6e-07    
ref|XP_007810860.1|  oxidoreductase family, NAD-binding Rossmann ...  59.3    7e-07    
gb|KIJ10684.1|  hypothetical protein PAXINDRAFT_172088                59.3    7e-07    
ref|XP_003678562.1|  hypothetical protein TDEL_0A00190                58.9    9e-07    
gb|KDQ61926.1|  hypothetical protein JAAARDRAFT_190638                58.9    1e-06    
ref|XP_003660926.1|  oxidoreductase-like protein                      58.5    1e-06    
ref|XP_007394970.1|  hypothetical protein PHACADRAFT_254723           58.5    1e-06    
ref|XP_009656154.1|  NAD-binding Rossmann fold oxidoreductase fam...  58.5    1e-06    
gb|KIK34237.1|  hypothetical protein CY34DRAFT_26897                  58.5    2e-06    
gb|KIM80656.1|  hypothetical protein PILCRDRAFT_822384                58.2    2e-06    
ref|XP_011276250.1|  Inositol 2-dehydrogenase/D-chiro-inositol 3-...  58.2    2e-06    
gb|KID95177.1|  oxidoreductase family, NAD-binding Rossmann fold ...  57.8    2e-06    
ref|WP_004102818.1|  oxidoreductase                                   57.8    2e-06    
gb|EMD36780.1|  hypothetical protein CERSUDRAFT_155077                57.4    3e-06    
ref|XP_004182195.1|  hypothetical protein TBLA_0I00110                57.0    5e-06    
gb|KIP10807.1|  hypothetical protein PHLGIDRAFT_22069                 57.0    5e-06    
ref|WP_020265263.1|  hypothetical protein                             56.6    6e-06    
ref|XP_453042.1|  hypothetical protein                                56.6    6e-06    
ref|XP_001800467.1|  hypothetical protein SNOG_10185                  56.6    6e-06    
gb|KIW18212.1|  hypothetical protein PV08_02500                       56.2    8e-06    
gb|KID84577.1|  oxidoreductase family, NAD-binding Rossmann fold ...  56.2    9e-06    
ref|XP_003004419.1|  NAD-binding Rossmann fold oxidoreductase fam...  55.8    9e-06    
emb|CAE84407.1|  hypothetical protein                                 55.8    1e-05    
ref|WP_038051523.1|  oxidoreductase                                   55.5    1e-05    
emb|CDO93391.1|  unnamed protein product                              55.5    1e-05    
ref|WP_014856858.1|  oxidoreductase domain-containing protein         55.5    1e-05    
ref|XP_007379545.1|  oxidoreductase family protein                    55.5    1e-05    
ref|XP_007870707.1|  NAD P-binding protein                            55.5    1e-05    
ref|WP_041844546.1|  oxidoreductase                                   55.5    1e-05    
ref|WP_011943217.1|  oxidoreductase                                   55.5    1e-05    
ref|XP_449954.1|  hypothetical protein                                55.1    2e-05    
ref|XP_003650189.1|  hypothetical protein THITE_123357                55.1    2e-05    
gb|KIL66602.1|  hypothetical protein M378DRAFT_74962                  54.7    2e-05    
gb|EPT01940.1|  hypothetical protein FOMPIDRAFT_1041084               54.7    2e-05    
ref|XP_003674473.1|  hypothetical protein NCAS_0B00110                54.7    3e-05    
gb|KIJ28562.1|  hypothetical protein M422DRAFT_189558                 54.3    4e-05    
emb|CAJ75722.1|  predicted dehydrogenases and related proteins        53.9    4e-05    
emb|CAJ75716.1|  predicted dehydrogenases and related proteins        53.9    5e-05    
ref|XP_004338924.1|  oxidoreductase family protein                    53.9    6e-05    
ref|WP_011011672.1|  oxidoreductase                                   53.5    6e-05    
ref|WP_043356026.1|  oxidoreductase                                   53.5    7e-05    
gb|EYE96563.1|  oxidoreductase family, NAD-binding Rossmann fold ...  53.1    9e-05    
gb|KIL66581.1|  hypothetical protein M378DRAFT_123742                 52.8    1e-04    
dbj|BAO40034.1|  uncharacterized protein YMR315W                      52.8    1e-04    
emb|CCK71422.1|  hypothetical protein KNAG_0G03650                    52.8    1e-04    
ref|XP_003954874.1|  hypothetical protein KAFR_0A03040                52.4    1e-04    
gb|EYU46307.1|  hypothetical protein MIMGU_mgv1a0096473mg             48.1    2e-04    
ref|WP_036225443.1|  hypothetical protein                             51.6    2e-04    
ref|WP_023964497.1|  oxidoreductase                                   51.6    3e-04    
ref|WP_038066570.1|  oxidoreductase                                   51.6    3e-04    
gb|ACM22551.1|  Oxidoreductase domain protein                         51.6    3e-04    
gb|EGN93485.1|  hypothetical protein SERLA73DRAFT_189645              51.6    3e-04    
ref|XP_003644579.1|  hypothetical protein Ecym_2002                   51.2    3e-04    
ref|XP_011103102.1|  YMR315W                                          51.2    4e-04    
ref|XP_007324516.1|  hypothetical protein SERLADRAFT_480526           51.2    4e-04    
ref|WP_035502132.1|  oxidoreductase                                   51.2    4e-04    
ref|WP_018749344.1|  hypothetical protein                             51.2    4e-04    
ref|NP_014046.1|  hypothetical protein YMR315W                        50.8    4e-04    
ref|WP_038033444.1|  MULTISPECIES: oxidoreductase                     50.8    4e-04    
gb|KDR66469.1|  hypothetical protein GALMADRAFT_259259                50.8    5e-04    
gb|KIJ64973.1|  hypothetical protein HYDPIDRAFT_111692                50.8    5e-04    
gb|KDE06246.1|  hypothetical protein MVLG_03405                       50.8    5e-04    
gb|AJS95761.1|  hypothetical protein H823_YJM1447M00470               50.8    5e-04    
gb|EGA73622.1|  YMR315W-like protein                                  50.8    6e-04    
gb|AJS70048.1|  hypothetical protein H765_YJM627M00474                50.4    6e-04    
ref|WP_038890093.1|  oxidoreductase                                   50.4    6e-04    
gb|AJS80533.1|  hypothetical protein H788_YJM1248M00474               50.4    7e-04    
gb|AJS63054.1|  hypothetical protein H749_YJM195M00474                50.4    7e-04    
dbj|GAA25767.1|  K7_Ymr315wp                                          50.4    7e-04    
gb|EDN64256.1|  conserved protein                                     50.4    7e-04    
gb|AJS83136.1|  hypothetical protein H794_YJM1311M00474               50.4    7e-04    
gb|AJS80962.1|  hypothetical protein H789_YJM1250M00464               50.4    7e-04    
gb|AJP41010.1|  hypothetical protein F842_YJM1078M00474               50.4    7e-04    
ref|WP_033191335.1|  oxidoreductase                                   50.4    7e-04    
gb|EIF45784.1|  ymr315w-like protein                                  50.1    9e-04    
gb|KGR35670.1|  Myo-inositol 2-dehydrogenase                          50.1    0.001    



>ref|XP_009773348.1| PREDICTED: uncharacterized protein LOC104223588 [Nicotiana sylvestris]
Length=361

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G       YFSSSWRR F GGFILDMGVH+VAGLRMLVGCE+ S+SAM SHVDKT
Sbjct  166  QVIVEGSMNNSNPYFSSSWRRQFVGGFILDMGVHFVAGLRMLVGCEIASLSAMNSHVDKT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++FQLENGCSGVF MVVSS+SPKI+WRVVGLNG L+VERGNKDGKHGYS+ L
Sbjct  226  LPPPDNISSMFQLENGCSGVFVMVVSSKSPKIIWRVVGLNGVLQVERGNKDGKHGYSIHL  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAM  169
            +M DGQ KSFFYPF GV +ELKTFLSD+S AN K       +PRLSF EG RD+AVL+AM
Sbjct  286  HMADGQSKSFFYPFSGVTDELKTFLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAM  345

Query  168  LESGKREGALVQVKKF  121
            LESGKR+GALVQVKKF
Sbjct  346  LESGKRQGALVQVKKF  361


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLFLKLLEAQLLWRF  626
            F E +K+I+EIG+MMN+QVI+EG+MN+SNP F      Q +  F
Sbjct  149  FIEGRKLISEIGEMMNIQVIVEGSMNNSNPYFSSSWRRQFVGGF  192



>ref|XP_006348416.1| PREDICTED: uncharacterized protein YMR315W-like [Solanum tuberosum]
Length=359

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 169/196 (86%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+SSWRR F GGFILDMGVH+VAGLRMLVGCE+TS+S+M SHVDKT
Sbjct  164  QIIVEGAMNSSNPYFASSWRRQFVGGFILDMGVHFVAGLRMLVGCEITSLSSMNSHVDKT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++FQLENGCSGVF MVVSS+SPK++WRVVGLNG L+V+RGNKDGKHGYSVSL
Sbjct  224  LPPPDNISSMFQLENGCSGVFVMVVSSKSPKVIWRVVGLNGVLQVDRGNKDGKHGYSVSL  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAM  169
            +M DGQ KSFFYPF GV +ELK FLSD+S AN K       +PRLSF EG RD+AVL+AM
Sbjct  284  HMADGQSKSFFYPFSGVTDELKAFLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAM  343

Query  168  LESGKREGALVQVKKF  121
            LESGKR+GALVQVKKF
Sbjct  344  LESGKRQGALVQVKKF  359


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLFLKLLEAQLLWRF  626
            F E K++I+EIG+MMN+Q+I+EG MNSSNP F      Q +  F
Sbjct  147  FIEGKRLISEIGEMMNIQIIVEGAMNSSNPYFASSWRRQFVGGF  190



>ref|XP_009588958.1| PREDICTED: uncharacterized protein YMR315W [Nicotiana tomentosiformis]
Length=361

 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR F GGFILDMGVH+VAGLRMLVGCE+ S+SA+ SHVDKT
Sbjct  166  QVIVEGSMNSSNPYFSSSWRRQFDGGFILDMGVHFVAGLRMLVGCEIASLSAINSHVDKT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++FQLENGCSGVF MVVSS+SPKI+WRVVGLNG L+VERGNKDGKHGYS+ L
Sbjct  226  LPPPDNISSMFQLENGCSGVFVMVVSSKSPKIIWRVVGLNGVLQVERGNKDGKHGYSIHL  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAM  169
            +M DGQ KSFFYPF GV +ELKTFLSD+S AN K       +PRLSF EG RD+AVL+AM
Sbjct  286  HMADGQSKSFFYPFSGVTDELKTFLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAM  345

Query  168  LESGKREGALVQVKKF  121
            LESGKR+GALVQVKKF
Sbjct  346  LESGKRQGALVQVKKF  361


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK+I+EIG+MMN+QVI+EG+MNSSNP F
Sbjct  149  FIEGKKLISEIGEMMNIQVIVEGSMNSSNPYF  180



>ref|XP_004228627.1| PREDICTED: uncharacterized oxidoreductase C26H5.09c [Solanum 
lycopersicum]
Length=359

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 169/196 (86%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+SSWRR F GGFILDMGVH+VAGLRML+GCE+ S+S+M SHVDKT
Sbjct  164  QVIVEGAMNSSNPYFASSWRRQFVGGFILDMGVHFVAGLRMLIGCEIASLSSMNSHVDKT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++FQLENGCSGVF MVVSS+SPK++WRVVGLNG L+V+RGNKDGKHGYSVSL
Sbjct  224  LPPPDNISSMFQLENGCSGVFVMVVSSKSPKVIWRVVGLNGVLQVDRGNKDGKHGYSVSL  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAM  169
            +M DGQ KSFFYPF GV +ELKTFLSD+S AN K       +PRLSF EG RD+AVL+AM
Sbjct  284  HMADGQSKSFFYPFSGVTDELKTFLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAM  343

Query  168  LESGKREGALVQVKKF  121
            LESGKR+GALVQVKKF
Sbjct  344  LESGKRQGALVQVKKF  359


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLFLKLLEAQLLWRF  626
            F E K++I+EIG+MMN+QVI+EG MNSSNP F      Q +  F
Sbjct  147  FIEGKRLISEIGEMMNIQVIVEGAMNSSNPYFASSWRRQFVGGF  190



>gb|KDP20201.1| hypothetical protein JCGZ_07921 [Jatropha curcas]
Length=359

 Score =   300 bits (767),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 166/196 (85%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEV SVSAMTSHVDKT
Sbjct  164  EVIVEGSMNSANPYFSSSWRRNFTGGFILDMGVHFIAGLRMVVGCEVISVSAMTSHVDKT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++FQLENGCSGVF MVVSSRSPKI+WRVVGL GTL+V+RG++DG+HGY VS 
Sbjct  224  LPPPDNISSVFQLENGCSGVFVMVVSSRSPKILWRVVGLKGTLQVDRGSQDGRHGYVVSF  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DG  KS FYPF GV EELKTF+ DIS AN  KG   + EPR+SFVEG RD+AVL+AM
Sbjct  284  YGADGICKSTFYPFSGVTEELKTFIHDISQANLKKGSSYEAEPRISFVEGARDVAVLDAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG + GALVQVKKF
Sbjct  344  LESGMKNGALVQVKKF  359


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++AEIGDMM V+VI+EG+MNS+NP F
Sbjct  147  FVECKKLLAEIGDMMTVEVIVEGSMNSANPYF  178



>ref|XP_011025252.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Populus 
euphratica]
Length=359

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++    +   YFSSSWRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD T
Sbjct  165  QLIIEASMNSANPYFSSSWRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVFAMVVSS+SPKI+WR+VG+NGT+E+ RGN+DG+HGY++S 
Sbjct  225  LPPPDNISSVFHLENGCSGVFAMVVSSKSPKILWRIVGINGTVEIGRGNQDGQHGYTISF  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  KS FYPF GV  ELK FL DIS AN KG   + EPRLSF+EG RD+AVL+AML
Sbjct  285  YGAGGHCKSNFYPFSGVTAELKAFLHDISQANLKGSSYEVEPRLSFIEGARDVAVLDAML  344

Query  165  ESGKREGALVQVKKF  121
            ESG + GALVQVKKF
Sbjct  345  ESGNKNGALVQVKKF  359



>emb|CDP14087.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH+VAGLRMLVGCEV+SVSA+TSHVD T
Sbjct  164  QVIIEGSMTSSNPYFSSSWRRNFTGGFILDMGVHFVAGLRMLVGCEVSSVSALTSHVDLT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+ FQLENGC+GVF +VVSSRSPKI+WRVVGLNGTL++ERGN+DGKHGY V+L
Sbjct  224  LPPPDNISSTFQLENGCTGVFVLVVSSRSPKILWRVVGLNGTLQIERGNQDGKHGYLVTL  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y+ +GQ KSFF+PF GV EELK FLS+IS A   K    + E RLSFVEG RD+AVL+AM
Sbjct  284  YLANGQNKSFFHPFSGVTEELKAFLSEISQATLKKDSSYEVERRLSFVEGVRDVAVLDAM  343

Query  168  LESGKREGALVQVKKF  121
            LESGKR+GA VQVK+F
Sbjct  344  LESGKRQGAPVQVKRF  359


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++AE+GD+M++QVIIEG+M SSNP F
Sbjct  147  FEESKKLMAEVGDVMSIQVIIEGSMTSSNPYF  178



>ref|XP_011025251.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Populus 
euphratica]
Length=360

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++    +   YFSSSWRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD T
Sbjct  165  QLIIEASMNSANPYFSSSWRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVFAMVVSS+SPKI+WR+VG+NGT+E+ RGN+DG+HGY++S 
Sbjct  225  LPPPDNISSVFHLENGCSGVFAMVVSSKSPKILWRIVGINGTVEIGRGNQDGQHGYTISF  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y   G  KS FYPF GV  ELK FL DIS AN  KG   + EPRLSF+EG RD+AVL+AM
Sbjct  285  YGAGGHCKSNFYPFSGVTAELKAFLHDISQANLKKGSSYEVEPRLSFIEGARDVAVLDAM  344

Query  168  LESGKREGALVQVKKF  121
            LESG + GALVQVKKF
Sbjct  345  LESGNKNGALVQVKKF  360



>ref|XP_006386094.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63891.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=359

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++    +   YFSSSWRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD T
Sbjct  165  QLIIEASMNSANPYFSSSWRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVFAMVVSS++PKI+WR+VG+NGT+E+ RGN+ G+HGY +S 
Sbjct  225  LPPPDNISSVFHLENGCSGVFAMVVSSKTPKILWRIVGINGTVEIGRGNQGGQHGYMISF  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  KS FYPF GV  ELK FL DIS AN KG   + EPRLSF+EG RD+AVL+AML
Sbjct  285  YGAGGHCKSNFYPFSGVTAELKAFLHDISQANLKGSSYEVEPRLSFIEGARDVAVLDAML  344

Query  165  ESGKREGALVQVKKF  121
            ESG + GALVQVKKF
Sbjct  345  ESGNKNGALVQVKKF  359



>ref|XP_002513445.1| oxidoreductase, putative [Ricinus communis]
 gb|EEF48848.1| oxidoreductase, putative [Ricinus communis]
Length=359

 Score =   292 bits (747),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 164/196 (84%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCEV SVSAMTSH+DKT
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEVISVSAMTSHMDKT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVF MVVSSRSPKI WRVVGL GTL++ERG+ DGKHGY VS+
Sbjct  224  LPPPDNISSVFHLENGCSGVFVMVVSSRSPKIFWRVVGLKGTLQIERGSHDGKHGYLVSV  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
               DGQ +S FYPF GV EELKTF+ DIS AN  KG   + EPR+SF+EG RD+A+L+AM
Sbjct  284  CGTDGQSRSSFYPFSGVTEELKTFIHDISQANLKKGSSYEVEPRISFMEGARDVAILDAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG + GALVQVKKF
Sbjct  344  LESGTKAGALVQVKKF  359


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F EC+K++AEIGDMM VQVI+EG+MNSSNP F
Sbjct  147  FVECRKLLAEIGDMMTVQVIVEGSMNSSNPYF  178



>ref|XP_011080243.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080244.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080245.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
Length=356

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = -2

Query  702  LLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTL  523
            ++++G   +   YFSSSWRR+F GGFILDMGVH+++GLRMLVGCE+TSVSA+TSHVD TL
Sbjct  162  VIIEGSMNSSNPYFSSSWRRDFVGGFILDMGVHFISGLRMLVGCEITSVSAITSHVDTTL  221

Query  522  PPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLY  343
            P PD+IS+  QLE+G SGVF MVVSSRSPK++WR+VGL GTL+VERG+KDGKHGY+V L+
Sbjct  222  PAPDHISSTIQLEDGSSGVFVMVVSSRSPKVLWRIVGLKGTLQVERGSKDGKHGYTVVLF  281

Query  342  MGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAML  166
              DGQ KS+FYPF GV EELKTFLSDIS AN  K G  + EPR+SF+EG RD+AVL+AML
Sbjct  282  TADGQNKSWFYPFSGVTEELKTFLSDISQANLKKDGSHQVEPRISFLEGARDVAVLDAML  341

Query  165  ESGKREGALVQVKKF  121
            ESGKR+G  VQVKKF
Sbjct  342  ESGKRQGVAVQVKKF  356


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++AEIGD++N+ VIIEG+MNSSNP F
Sbjct  144  FVEGKKLMAEIGDVINIHVIIEGSMNSSNPYF  175



>ref|XP_006386095.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63892.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=360

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 161/196 (82%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++    +   YFSSSWRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD T
Sbjct  165  QLIIEASMNSANPYFSSSWRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVFAMVVSS++PKI+WR+VG+NGT+E+ RGN+ G+HGY +S 
Sbjct  225  LPPPDNISSVFHLENGCSGVFAMVVSSKTPKILWRIVGINGTVEIGRGNQGGQHGYMISF  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y   G  KS FYPF GV  ELK FL DIS AN  KG   + EPRLSF+EG RD+AVL+AM
Sbjct  285  YGAGGHCKSNFYPFSGVTAELKAFLHDISQANLKKGSSYEVEPRLSFIEGARDVAVLDAM  344

Query  168  LESGKREGALVQVKKF  121
            LESG + GALVQVKKF
Sbjct  345  LESGNKNGALVQVKKF  360



>emb|CBI16434.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 161/196 (82%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSA+TSHVD  
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIASVSAITSHVDTM  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++FQLENGCSGVF MVVS+R+PKI WRVVGL GTL++ERGNK+G HGY  S 
Sbjct  224  LPPPDNISSVFQLENGCSGVFVMVVSTRAPKIFWRVVGLKGTLQLERGNKEGSHGYQFSF  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            +  DGQ KS FYPF GV EELKTF+ DIS A   KG   + E RLSFVEG RD+A+L+AM
Sbjct  284  HGADGQCKSSFYPFSGVTEELKTFIHDISQATLKKGSSYEAETRLSFVEGARDVAILDAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG R+GAL+QVKKF
Sbjct  344  LESGMRQGALIQVKKF  359


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++ EIGDMM++QVI+EG+MNSSNP F
Sbjct  147  FVECKKLMEEIGDMMSIQVIVEGSMNSSNPYF  178



>ref|XP_002285606.1| PREDICTED: uncharacterized protein LOC100245027 isoform X1 [Vitis 
vinifera]
Length=359

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 161/196 (82%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSA+TSHVD  
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIASVSAITSHVDTM  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++FQLENGCSGVF MVVS+R+PKI WRVVGL GTL++ERGNK+G HGY  S 
Sbjct  224  LPPPDNISSVFQLENGCSGVFVMVVSTRAPKIFWRVVGLKGTLQLERGNKEGSHGYQFSF  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            +  DGQ KS FYPF GV EELKTF+ DIS A   KG   + E RLSFVEG RD+A+L+AM
Sbjct  284  HGADGQCKSSFYPFSGVTEELKTFIHDISQATLKKGSSYEAETRLSFVEGARDVAILDAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG R+GAL+QVKKF
Sbjct  344  LESGMRQGALIQVKKF  359


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++ EIGDMM++QVI+EG+MNSSNP F
Sbjct  147  FVECKKLMEEIGDMMSIQVIVEGSMNSSNPYF  178



>ref|XP_006445974.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59214.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=355

 Score =   287 bits (734),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+ GCEV SVSA+TSH+DKT
Sbjct  162  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMITGCEVVSVSAITSHIDKT  221

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+ FQLENGCSGVF MVVSSRSPKI WRVVG+ GTL+VERGN+DG+HGY V+ 
Sbjct  222  LPPPDNISSNFQLENGCSGVFVMVVSSRSPKIFWRVVGMKGTLQVERGNQDGRHGYLVTQ  281

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y  DGQ KS FYPF GV EELK F+ DIS A  KG     EPR SF+EG RD+A+LEAML
Sbjct  282  YGADGQSKSMFYPFSGVTEELKAFIHDISEAK-KGINHVPEPRSSFLEGARDVALLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG ++GALV VKKF
Sbjct  341  ESGSKQGALVHVKKF  355


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK+IAEIGDMM+VQVI+EG+MNSSNP F
Sbjct  145  FVECKKLIAEIGDMMSVQVIVEGSMNSSNPYF  176



>ref|XP_006494722.1| PREDICTED: uncharacterized protein YMR315W-like [Citrus sinensis]
 gb|KDO64912.1| hypothetical protein CISIN_1g018445mg [Citrus sinensis]
Length=355

 Score =   287 bits (734),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+ GCEV SVSA+TSH+DKT
Sbjct  162  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMITGCEVVSVSAITSHIDKT  221

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+ FQLENGCSGVF MVVSSRSPKI WRVVG+ GTL+VERGN+DG+HGY V+ 
Sbjct  222  LPPPDNISSNFQLENGCSGVFVMVVSSRSPKIFWRVVGMKGTLQVERGNQDGRHGYLVTQ  281

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y  DGQ KS FYPF GV EELK F+ DIS A  KG     EPR SF+EG RD+A+LEAML
Sbjct  282  YGADGQSKSMFYPFSGVTEELKAFIHDISEAK-KGINHVPEPRSSFLEGARDVALLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG ++GALV VKKF
Sbjct  341  ESGSKQGALVHVKKF  355


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK+IAEIGDMM+VQVI+EG+MNSSNP F
Sbjct  145  FVECKKLIAEIGDMMSVQVIVEGSMNSSNPYF  176



>ref|XP_011461910.1| PREDICTED: uncharacterized protein YMR315W [Fragaria vesca subsp. 
vesca]
Length=359

 Score =   285 bits (728),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 158/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKT
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFNGGFILDMGVHFMAGLRMLAGCEIVSVSATTSHVDKT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+LFQLENGCSG+F MVVSSRSPKIVWR VGL GTLEVERGN+DG+HGY V  
Sbjct  224  LPPPDNISSLFQLENGCSGIFVMVVSSRSPKIVWRFVGLKGTLEVERGNQDGRHGYVVIF  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ K+ FYPF GV EE   F++DI  A   KG   + EPR+SF+EG RD+AVLEAM
Sbjct  284  YSADGQRKTSFYPFSGVTEEFIAFINDIKQATLKKGAGYEAEPRMSFLEGARDVAVLEAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA V VKKF
Sbjct  344  LESGGKQGAPVLVKKF  359


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIGD+M++QVI+EG+MNSSNP F
Sbjct  147  FVEGKKLMTEIGDVMSIQVIVEGSMNSSNPYF  178



>gb|ABK96297.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 161/199 (81%), Gaps = 4/199 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++    +   YFSSSWRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD T
Sbjct  165  QLIIEASMNSANPYFSSSWRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGY---S  355
            LPPPDNIS++F LENGCSGVFAMVVSS++PKI+WR+VG+NGT+E+ RGN+ G+HGY    
Sbjct  225  LPPPDNISSVFHLENGCSGVFAMVVSSKTPKILWRIVGINGTVEIGRGNQGGQHGYMPWQ  284

Query  354  VSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVL  178
            +S Y   G  KS FYPF GV  ELK FL DIS AN  KG   + EPRLSF+EG RD+AVL
Sbjct  285  ISFYGAGGHCKSNFYPFSGVTAELKAFLHDISQANLKKGSSYEVEPRLSFIEGARDVAVL  344

Query  177  EAMLESGKREGALVQVKKF  121
            +AMLESG + GALVQVKKF
Sbjct  345  DAMLESGNKNGALVQVKKF  363



>ref|XP_008243595.1| PREDICTED: uncharacterized protein YMR315W [Prunus mume]
Length=360

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 160/196 (82%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH+VAGLRML GCE+ SVSA+TSHVDKT
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFVAGLRMLAGCELVSVSAITSHVDKT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDN+S+LFQLENGCSGVF MVVSSRSPKIVWR VGL GTL++ERGN+DG+HGY V  
Sbjct  224  LPAPDNVSSLFQLENGCSGVFVMVVSSRSPKIVWRFVGLKGTLQIERGNQDGRHGYLVLF  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS FY F GV EE K F++DIS AN  KG   + EPR+SF+EG RD+AVLEAM
Sbjct  284  YGSDGQSKSSFYQFSGVDEEFKAFINDISQANLRKGNGYEAEPRMSFLEGARDVAVLEAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA V VKK+
Sbjct  344  LESGGKQGAPVHVKKY  359


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ +IGD+M++QVI+EG+MNSSNP F
Sbjct  147  FVEGKKLVNDIGDVMSIQVIVEGSMNSSNPYF  178



>ref|XP_009364714.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
 ref|XP_009364715.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
Length=357

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR+F GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKT
Sbjct  162  QVIVEGSMNSSNPYFSSSWRRDFTGGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKT  221

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PD+IS+LFQLENGCSGVF MVVSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  
Sbjct  222  LPAPDSISSLFQLENGCSGVFVMVVSSRSPKIVWRFSGLKGTLQIERGNQDGRHGYVVLF  281

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS FY F GV EE K F  DIS A  K G   + EPR+SF+EG RD+AVLEAM
Sbjct  282  YGSDGQSKSSFYQFSGVDEEFKAFFDDISQATLKKGTIYEAEPRMSFLEGARDVAVLEAM  341

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA VQVKKF
Sbjct  342  LESGTKQGAPVQVKKF  357


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ E+GD+M++QVI+EG+MNSSNP F
Sbjct  145  FVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYF  176



>ref|XP_010257400.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010257401.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
Length=359

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD T
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGCSGVF M VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS 
Sbjct  224  LPPPDNICSLFQLENGCSGVFVMAVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSF  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DG+ +S FYPF GV EELK F+ DI  +  K  G  + EPR SF+EG RD+AVLEAM
Sbjct  284  YTADGRCESSFYPFSGVNEELKAFVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA V VK+F
Sbjct  344  LESGMKQGAQVTVKRF  359


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++ +IG+MM VQVI+EG+MNSSNP F
Sbjct  147  FVECKKLMNDIGEMMCVQVIVEGSMNSSNPYF  178



>ref|XP_007150403.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
 gb|ESW22397.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
Length=383

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 163/197 (83%), Gaps = 4/197 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSS+WRR F GGFI+DMGVHY+AGLRMLVGCEV SVSAMTSHVD T
Sbjct  189  QVIIEGSMNSSNPYFSSNWRRKFTGGFIVDMGVHYIAGLRMLVGCEVVSVSAMTSHVDLT  248

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVF MVVSSR+PK +WRVVGLNGTL+VERG + G+HGY VSL
Sbjct  249  LPPPDNISSVFHLENGCSGVFVMVVSSRTPKTLWRVVGLNGTLQVERGFQ-GEHGYLVSL  307

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANT--KGGECKGEPRLSFVEGTRDIAVLEA  172
            Y  DGQ +S F+PF GV EELK F++D+S  NT  KG +   EPRLSFVEG RD+AVLEA
Sbjct  308  YGADGQNQSSFFPFGGVTEELKAFINDVS-ENTLKKGSQFVPEPRLSFVEGARDVAVLEA  366

Query  171  MLESGKREGALVQVKKF  121
            MLESG ++G LVQVKKF
Sbjct  367  MLESGAKQGELVQVKKF  383


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  751  ECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            ECKK+I  IG MM+VQVIIEG+MNSSNP F
Sbjct  174  ECKKLIGGIGKMMSVQVIIEGSMNSSNPYF  203



>ref|XP_010257399.1| PREDICTED: uncharacterized protein LOC104597515 isoform X2 [Nelumbo 
nucifera]
Length=376

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD T
Sbjct  181  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTT  240

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGCSGVF M VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS 
Sbjct  241  LPPPDNICSLFQLENGCSGVFVMAVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSF  300

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DG+ +S FYPF GV EELK F+ DI  +  K  G  + EPR SF+EG RD+AVLEAM
Sbjct  301  YTADGRCESSFYPFSGVNEELKAFVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAM  360

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA V VK+F
Sbjct  361  LESGMKQGAQVTVKRF  376


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++ +IG+MM VQVI+EG+MNSSNP F
Sbjct  164  FVECKKLMNDIGEMMCVQVIVEGSMNSSNPYF  195



>ref|XP_003543553.1| PREDICTED: uncharacterized protein YMR315W [Glycine max]
 gb|KHN30111.1| Hypothetical protein glysoja_010489 [Glycine soja]
Length=360

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 161/196 (82%), Gaps = 2/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD T
Sbjct  166  QVIIEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVF MVVSSRSPK +WRVVGLNGTL+VERG + G+HGY VS 
Sbjct  226  LPPPDNISSVFHLENGCSGVFVMVVSSRSPKTLWRVVGLNGTLQVERGFQ-GQHGYLVSF  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDIS-LANTKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PF GV EELK F++D+S +   K  +   EPRLS+VEG RD+AVLEAM
Sbjct  285  YGTDGQNKSSFFPFSGVTEELKAFINDVSEITLKKRNQFVTEPRLSYVEGARDVAVLEAM  344

Query  168  LESGKREGALVQVKKF  121
            LESG R+G LV++KKF
Sbjct  345  LESGARQGELVRLKKF  360


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  751  ECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            ECKK+IA IG MM+VQVIIEG+MNSSNP F
Sbjct  151  ECKKLIAGIGKMMSVQVIIEGSMNSSNPYF  180



>ref|XP_009364727.1| PREDICTED: uncharacterized protein LOC103954617 [Pyrus x bretschneideri]
Length=357

 Score =   277 bits (709),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR+F GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKT
Sbjct  162  QVIVEGSMNSSNPYFSSSWRRDFTGGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKT  221

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PD+IS+LFQLENGCSGVF MVVSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  
Sbjct  222  LPAPDSISSLFQLENGCSGVFVMVVSSRSPKIVWRFSGLKGTLQIERGNQDGRHGYVVLF  281

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS FY F GV EE + F  DIS A  K G   + EPR+SF+EG RD+AVLEAM
Sbjct  282  YGSDGQSKSSFYQFSGVDEEFRAFFYDISQATLKKGTSYEAEPRMSFLEGARDVAVLEAM  341

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA VQVKKF
Sbjct  342  LESGTKQGAPVQVKKF  357


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ E+GD+M++QVI+EG+MNSSNP F
Sbjct  145  FVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYF  176



>ref|XP_010257398.1| PREDICTED: uncharacterized protein LOC104597515 isoform X1 [Nelumbo 
nucifera]
Length=382

 Score =   278 bits (711),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD T
Sbjct  187  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTT  246

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGCSGVF M VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS 
Sbjct  247  LPPPDNICSLFQLENGCSGVFVMAVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSF  306

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DG+ +S FYPF GV EELK F+ DI  +  K  G  + EPR SF+EG RD+AVLEAM
Sbjct  307  YTADGRCESSFYPFSGVNEELKAFVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAM  366

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA V VK+F
Sbjct  367  LESGMKQGAQVTVKRF  382


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++ +IG+MM VQVI+EG+MNSSNP F
Sbjct  170  FVECKKLMNDIGEMMCVQVIVEGSMNSSNPYF  201



>ref|XP_004486934.1| PREDICTED: uncharacterized protein YMR315W-like [Cicer arietinum]
Length=361

 Score =   277 bits (708),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 161/197 (82%), Gaps = 4/197 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCEV SVSAMTSHVD T
Sbjct  167  QVIIEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEVVSVSAMTSHVDLT  226

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDN+S++F LENGCSGVF MVVSSRSPKI+WRVVG+NGTL++ERG + G+HGY VSL
Sbjct  227  LPPPDNLSSVFHLENGCSGVFVMVVSSRSPKILWRVVGMNGTLQIERGFQ-GQHGYLVSL  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANT--KGGECKGEPRLSFVEGTRDIAVLEA  172
            Y  +G+ KS FYPF GV EELK F +D+S  NT  K  +   E RLS+VEG RD+A+LEA
Sbjct  286  YDANGESKSSFYPFSGVTEELKAFFNDVS-ENTLKKDSQFVAEHRLSYVEGARDVAILEA  344

Query  171  MLESGKREGALVQVKKF  121
            MLESG R+G LV VKKF
Sbjct  345  MLESGSRKGELVHVKKF  361



>gb|AFK46300.1| unknown [Lotus japonicus]
Length=359

 Score =   276 bits (707),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD T
Sbjct  165  QVIIEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVF MVVSSR+PKI+WRVVGLNGTL++ERG + G+HGY VS 
Sbjct  225  LPPPDNISSVFHLENGCSGVFVMVVSSRTPKILWRVVGLNGTLQIERGFQ-GQHGYLVSS  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANT-KGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PF GV EELK F +D+  +N  KG     E RLSFVEG RD+AVLEAM
Sbjct  284  YGADGQCKSSFFPFSGVTEELKAFFNDVFESNPEKGNNFVAEQRLSFVEGARDVAVLEAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG R+G LV VK F
Sbjct  344  LESGARQGELVHVKNF  359


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  751  ECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            ECKK+IA+IG MM+VQVIIEG+MNSSNP F
Sbjct  150  ECKKLIADIGKMMSVQVIIEGSMNSSNPYF  179



>ref|XP_009145584.1| PREDICTED: uncharacterized protein YMR315W [Brassica rapa]
Length=355

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 156/195 (80%), Gaps = 5/195 (3%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKT
Sbjct  166  QLIIEGSMNSSNPYFSSSWRRNLDGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSSRSPKI+WRVVGL GT+++ERG +DG+HGY  ++
Sbjct  226  LPAPDNITSNFQLENGCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATV  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPF GV EELK F +DIS     G   + EPRLS+VEG RD+AVLEAML
Sbjct  286  YGEGGTSRTIFYPFSGVTEELKAFFNDIS-----GASKEQEPRLSYVEGARDVAVLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG R GA++ VKKF
Sbjct  341  ESGARNGAVIPVKKF  355


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIGDMMNVQ+IIEG+MNSSNP F
Sbjct  149  FVELKKLVEEIGDMMNVQLIIEGSMNSSNPYF  180



>ref|XP_008358864.1| PREDICTED: uncharacterized protein YMR315W-like isoform X2 [Malus 
domestica]
Length=351

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR+F GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKT
Sbjct  156  QVIVEGSMNSSNPYFSSSWRRDFAGGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKT  215

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PD+IS+LFQLENGCSGVF MVVSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  
Sbjct  216  LPAPDSISSLFQLENGCSGVFVMVVSSRSPKIVWRFSGLKGTLQIERGNQDGQHGYVVLF  275

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ  S FY F GV EE + F +DI+ A  K G   + EPR+SF+EG RD+AVLEAM
Sbjct  276  YGSDGQSTSSFYQFSGVDEEFRAFFNDITQATLKKGTSYEAEPRMSFLEGARDVAVLEAM  335

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA VQVKKF
Sbjct  336  LESGTKQGAPVQVKKF  351


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ E+GD+M++QVI+EG+MNSSNP F
Sbjct  139  FVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYF  170



>ref|XP_008358862.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
 ref|XP_008358863.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
Length=357

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR+F GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKT
Sbjct  162  QVIVEGSMNSSNPYFSSSWRRDFAGGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKT  221

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PD+IS+LFQLENGCSGVF MVVSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  
Sbjct  222  LPAPDSISSLFQLENGCSGVFVMVVSSRSPKIVWRFSGLKGTLQIERGNQDGQHGYVVLF  281

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ  S FY F GV EE + F +DI+ A  K G   + EPR+SF+EG RD+AVLEAM
Sbjct  282  YGSDGQSTSSFYQFSGVDEEFRAFFNDITQATLKKGTSYEAEPRMSFLEGARDVAVLEAM  341

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA VQVKKF
Sbjct  342  LESGTKQGAPVQVKKF  357


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ E+GD+M++QVI+EG+MNSSNP F
Sbjct  145  FVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYF  176



>ref|XP_004162028.1| PREDICTED: uncharacterized LOC101204258, partial [Cucumis sativus]
Length=244

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 156/195 (80%), Gaps = 3/195 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR+F GG ILDMGVH++AGLRMLVGCEV SVSA TS+VDK+
Sbjct  53   QVIVEGSMNSSNPYFSSSWRRDFVGGLILDMGVHFIAGLRMLVGCEVVSVSATTSYVDKS  112

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+LFQLENGCSGVF MVVSS+SPKI WRVVGL GTL++ERGN+DGKHGY VS 
Sbjct  113  LPPPDNISSLFQLENGCSGVFVMVVSSKSPKIFWRVVGLKGTLQIERGNQDGKHGYLVSF  172

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
                G  +  FYPF GV EELKTF+  IS    +G + K + R+SF+EG RD+AVLEAML
Sbjct  173  TDASGLNRCTFYPFSGVTEELKTFIHAIS---AEGSDDKADDRISFIEGARDVAVLEAML  229

Query  165  ESGKREGALVQVKKF  121
            ESG + GA VQVK+F
Sbjct  230  ESGAKHGAPVQVKRF  244


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECK +IA+IGDMM+VQVI+EG+MNSSNP F
Sbjct  36   FVECKNLIADIGDMMSVQVIVEGSMNSSNPYF  67



>ref|XP_003597479.1| Oxidoreductase, putative [Medicago truncatula]
 gb|AES67730.1| oxidoreductase family, NAD-binding rossmann fold protein [Medicago 
truncatula]
Length=356

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 159/195 (82%), Gaps = 2/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCEV SVSAMTSHVD T
Sbjct  164  QVIIEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEVVSVSAMTSHVDFT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F LENGCSGVF MVVSSRSPKI+WRVVG+NGTL++ERG + G+HGY +SL
Sbjct  224  LPPPDNISSVFHLENGCSGVFVMVVSSRSPKILWRVVGMNGTLQIERGFQ-GQHGYLISL  282

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G+ KS F+PF GV EELK F +D+S    K G  + E RLSFVEG RD+A+LEAML
Sbjct  283  YDAHGECKSSFFPFSGVTEELKAFFNDVSENTLKKG-SQPEHRLSFVEGARDVALLEAML  341

Query  165  ESGKREGALVQVKKF  121
            ESG ++G LV VKKF
Sbjct  342  ESGSKKGELVHVKKF  356



>ref|XP_010031848.1| PREDICTED: uncharacterized protein YMR315W [Eucalyptus grandis]
 gb|KCW51232.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=359

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 158/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+TSVSA T+HVD T
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFAGGFILDMGVHFIAGLRMLVGCEITSVSATTTHVDLT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDN+S+ FQLENGCSGVF M+VSS+SPKI WRVVGL GTL++ERGN+DG+HGY  +L
Sbjct  224  LPPPDNLSSSFQLENGCSGVFVMIVSSKSPKIFWRVVGLKGTLQLERGNQDGRHGYLATL  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDIS-LANTKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  +GQ KS FY F GV +ELK F++D+S +   K    + EPR SF+EG RD+AVLEAM
Sbjct  284  YDANGQSKSTFYSFSGVTDELKAFINDVSNMTLKKESGYEAEPRCSFLEGARDVAVLEAM  343

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV V+KF
Sbjct  344  LESGYKHGELVSVRKF  359


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++A+IGDMMNVQVI+EG+MNSSNP F
Sbjct  147  FVECKKLLADIGDMMNVQVIVEGSMNSSNPYF  178



>gb|KFK39395.1| hypothetical protein AALP_AA3G239500 [Arabis alpina]
Length=356

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 155/195 (79%), Gaps = 5/195 (3%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCE+TSVSA TSHVDKT
Sbjct  167  QLIIEGSMNSSNPYFSSSWRRNLGGGFILDMGVHYIAGLRMLVGCEITSVSATTSHVDKT  226

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSSRSPKI+WRVVGL GT+++ERG +DG+HGY  ++
Sbjct  227  LPAPDNITSNFQLENGCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATV  286

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPFCGV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAML
Sbjct  287  YEEGGTSRTIFYPFCGVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAML  341

Query  165  ESGKREGALVQVKKF  121
            ESG R  A+V V KF
Sbjct  342  ESGARNRAVVPVAKF  356


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK+I EIGDMMNVQ+IIEG+MNSSNP F
Sbjct  150  FVELKKLIGEIGDMMNVQLIIEGSMNSSNPYF  181



>ref|XP_006406349.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
 gb|ESQ47802.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
Length=356

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 155/195 (79%), Gaps = 4/195 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKT
Sbjct  166  QLIIEGSMNSSNPYFSSSWRRNLGGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSSRSPKI+WRVVGL GT+++ERG +DG+HGY  ++
Sbjct  226  LPAPDNITSNFQLENGCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATI  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPF GV EELK F SDIS    +  + + EPRLS+VEG  D+AVLEAML
Sbjct  286  YGEGGTSRTIFYPFSGVTEELKAFFSDIS----ETSKNEQEPRLSYVEGAHDVAVLEAML  341

Query  165  ESGKREGALVQVKKF  121
            ESG R GA+V V KF
Sbjct  342  ESGARNGAVVPVTKF  356


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++AE GDMMNVQ+IIEG+MNSSNP F
Sbjct  149  FVELKKLVAETGDMMNVQLIIEGSMNSSNPYF  180



>ref|XP_008449757.1| PREDICTED: uncharacterized protein YMR315W [Cucumis melo]
Length=355

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 157/195 (81%), Gaps = 3/195 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR+F GGFILDMGVH++AGLRMLVGCEV SVSA TS+VDK+
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRDFAGGFILDMGVHFIAGLRMLVGCEVVSVSATTSYVDKS  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+LFQLENGCSGVF MVVSS+SPKI WRVVGL GTL++ERGN+DGKHGY VS 
Sbjct  224  LPPPDNISSLFQLENGCSGVFVMVVSSKSPKIFWRVVGLKGTLQIERGNQDGKHGYLVSF  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
                G  +  F+PF GV EELKTF+  IS    +G + K + R+SF+EG RD+AVLEAML
Sbjct  284  TDASGLNRCTFHPFSGVTEELKTFIHAIS---AEGSDDKADDRISFIEGARDVAVLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG + GA VQVK+F
Sbjct  341  ESGAKHGAPVQVKRF  355


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  751  ECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            ECK +IA++GDMM+VQVI+EG+MNSSNP F
Sbjct  149  ECKNLIADVGDMMSVQVIVEGSMNSSNPYF  178



>ref|XP_010544236.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Tarenaya 
hassleriana]
Length=355

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 158/195 (81%), Gaps = 4/195 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA T+HVD +
Sbjct  165  QLIVEGSMNSSNPYFSSSWRRNLGGGFILDMGVHYIAGLRMLVGCEVTSVSATTTHVDTS  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSS+SPKI+WRVVGL GT+++ERG ++G+HGY  ++
Sbjct  225  LPAPDNITSNFQLENGCSGVFVMVVSSKSPKILWRVVGLKGTVQLERGMQEGRHGYLATV  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G+ ++ FYPF GV EELK F  D+S A+      +GEPRLS++EG RD+AVLEAML
Sbjct  285  YSDRGETRTIFYPFSGVTEELKAFFHDVSQASA----SEGEPRLSYLEGARDVAVLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG ++GALV VK+F
Sbjct  341  ESGAKDGALVPVKRF  355


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIG MMNVQ+I+EG+MNSSNP F
Sbjct  148  FVELKKLVGEIGTMMNVQLIVEGSMNSSNPYF  179



>ref|XP_010544235.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Tarenaya 
hassleriana]
Length=356

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 158/195 (81%), Gaps = 3/195 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA T+HVD +
Sbjct  165  QLIVEGSMNSSNPYFSSSWRRNLGGGFILDMGVHYIAGLRMLVGCEVTSVSATTTHVDTS  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSS+SPKI+WRVVGL GT+++ERG ++G+HGY  ++
Sbjct  225  LPAPDNITSNFQLENGCSGVFVMVVSSKSPKILWRVVGLKGTVQLERGMQEGRHGYLATV  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G+ ++ FYPF GV EELK F  D+S A+      +GEPRLS++EG RD+AVLEAML
Sbjct  285  YSDRGETRTIFYPFSGVTEELKAFFHDVSQASASQ---EGEPRLSYLEGARDVAVLEAML  341

Query  165  ESGKREGALVQVKKF  121
            ESG ++GALV VK+F
Sbjct  342  ESGAKDGALVPVKRF  356


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIG MMNVQ+I+EG+MNSSNP F
Sbjct  148  FVELKKLVGEIGTMMNVQLIVEGSMNSSNPYF  179



>ref|XP_010091995.1| Uncharacterized protein L484_007981 [Morus notabilis]
 gb|EXB48401.1| Uncharacterized protein L484_007981 [Morus notabilis]
Length=352

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH+VAG+RMLVG EV SVSA TSHVDKT
Sbjct  158  QVIIEGSMNSSNPYFSSSWRRNFSGGFILDMGVHFVAGMRMLVGSEVVSVSAATSHVDKT  217

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+LFQLENGCSGVF +VVSS SPKI+WRVVGL GTL+VERG  DG+HGY VS 
Sbjct  218  LPPPDNISSLFQLENGCSGVFVVVVSSSSPKILWRVVGLKGTLQVERGKHDGQHGYLVSF  277

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y  DGQ KS FY F GV EE K+F+ DIS A+ KGG    EPR+SFVEG RD+AVLEAML
Sbjct  278  YGADGQSKSTFYRFSGVTEEFKSFIHDISQASVKGGVHVAEPRMSFVEGARDVAVLEAML  337

Query  165  ESGKREGALVQVKKF  121
            ESG ++GA V VKKF
Sbjct  338  ESGAKQGAPVHVKKF  352


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++AE+GDMM+VQVIIEG+MNSSNP F
Sbjct  141  FVESKKLVAEVGDMMSVQVIIEGSMNSSNPYF  172



>ref|XP_010488066.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=355

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 155/195 (79%), Gaps = 5/195 (3%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVH++AGLRMLVGCEVTSVSA TSHVDKT
Sbjct  166  QLIIEGSMNSSNPYFSSSWRRNLSGGFILDMGVHFIAGLRMLVGCEVTSVSAATSHVDKT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSSRSPKI+WRVVGL GT+++ERG + G+HGY  ++
Sbjct  226  LPGPDNITSNFQLENGCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVEGGRHGYMATI  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y G G  ++ FYPF GV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAML
Sbjct  286  YGGGGTSRTIFYPFSGVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG + GA+V V KF
Sbjct  341  ESGAKNGAVVPVTKF  355


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIGDMMNVQ+IIEG+MNSSNP F
Sbjct  149  FVELKKLVVEIGDMMNVQLIIEGSMNSSNPYF  180



>gb|KJB66097.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=357

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  163  QVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRT  222

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSL
Sbjct  223  LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSL  282

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y  DGQ KS F+PFCGV EELK F+ DI  AN KG   + EPR SFVEG RD+AVLEAML
Sbjct  283  YSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKGNGYEAEPRSSFVEGARDVAVLEAML  342

Query  165  ESGKREGALVQVKKF  121
            ESG + G LV VKKF
Sbjct  343  ESGSKGGTLVNVKKF  357


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++A +GDMMNVQVIIEG+MNSSNP F
Sbjct  146  FVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  177



>gb|KJB66100.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=200

 Score =   261 bits (668),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  5    QVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRT  64

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSL
Sbjct  65   LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSL  124

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAM
Sbjct  125  YSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAM  184

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV VKKF
Sbjct  185  LESGSKGGTLVNVKKF  200



>ref|XP_006298014.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
 gb|EOA30912.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
Length=355

 Score =   267 bits (682),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 154/195 (79%), Gaps = 4/195 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEV SVSA TSHVDKT
Sbjct  165  QLIIEGSMNSSNPYFSSSWRRNLSGGFILDMGVHYIAGLRMLVGCEVASVSASTSHVDKT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSSRSPKI+WRVVGL GT+++ERG + G+HGY  ++
Sbjct  225  LPGPDNITSNFQLENGCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVEGGRHGYMTTI  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPF GV EELK F +DIS  + K    + EPRLS+VEG RD+AVLEAML
Sbjct  285  YGEGGTTRTIFYPFSGVTEELKAFFNDISDTSKK----EQEPRLSYVEGARDVAVLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG + GA+V V KF
Sbjct  341  ESGAKNGAVVPVPKF  355


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK+IAEIGDMMNVQ+IIEG+MNSSNP F
Sbjct  148  FVELKKLIAEIGDMMNVQLIIEGSMNSSNPYF  179



>ref|XP_010913917.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913918.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913919.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
Length=364

 Score =   266 bits (681),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 2/197 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR F GGFILDMGVH++AGLRM+VGCE+T+VSA+  HVD  
Sbjct  168  QVIVEGSMNSSNPYFSSSWRRKFIGGFILDMGVHFIAGLRMIVGCEITTVSAIARHVDMA  227

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDN+ ALFQLENGC+GVF M VSS SPKI WRV G NGTL++ERG+ +G+HGY V L
Sbjct  228  LPPPDNLCALFQLENGCAGVFVMAVSSTSPKIYWRVDGSNGTLQIERGSDNGQHGYMVLL  287

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEA  172
            Y  DG  +  F+PF GV EELK F+ DI+ A TK G    K EPR S+VEG RD+AVLEA
Sbjct  288  YKADGHCQRTFHPFSGVNEELKAFVHDITQATTKEGVAGQKAEPRSSYVEGARDVAVLEA  347

Query  171  MLESGKREGALVQVKKF  121
            ML+S ++EGA V VKKF
Sbjct  348  MLDSSRKEGAQVHVKKF  364


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K+I EIGDMMN+QVI+EG+MNSSNP F
Sbjct  151  FVEARKLINEIGDMMNIQVIVEGSMNSSNPYF  182



>gb|KJB66094.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=288

 Score =   264 bits (674),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  93   QVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRT  152

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSL
Sbjct  153  LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSL  212

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAM
Sbjct  213  YSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAM  272

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV VKKF
Sbjct  273  LESGSKGGTLVNVKKF  288


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++A +GDMMNVQVIIEG+MNSSNP F
Sbjct  76   FVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  107



>ref|NP_188715.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAM12966.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15398.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76423.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 154/195 (79%), Gaps = 5/195 (3%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA T+HVDKT
Sbjct  166  QLIIEGSMNSSNPYFSSSWRRNLSGGFILDMGVHYIAGLRMLVGCEVTSVSATTTHVDKT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSSRSPKI+WR+VGL GT+++ERG + G+HGY  ++
Sbjct  226  LPGPDNITSNFQLENGCSGVFVMVVSSRSPKILWRIVGLKGTVQLERGVEGGRHGYMATI  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPF GV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAML
Sbjct  286  YGEGGTSRTIFYPFSGVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG + GA+V V KF
Sbjct  341  ESGAKNGAVVPVNKF  355


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK+IAEIGDMMNVQ+IIEG+MNSSNP F
Sbjct  149  FVELKKLIAEIGDMMNVQLIIEGSMNSSNPYF  180



>ref|XP_010509356.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=354

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 155/195 (79%), Gaps = 5/195 (3%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVH++AGLRMLVGCEVTSVSA TSHVDKT
Sbjct  165  QLIIEGSMNSSNPYFSSSWRRNLSGGFILDMGVHFIAGLRMLVGCEVTSVSAATSHVDKT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSSRSPKI+WRVVGL GT+++ERG + G+HGY  ++
Sbjct  225  LPGPDNITSNFQLENGCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVEGGRHGYMATI  284

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPF GV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAML
Sbjct  285  YGEGGTSRTIFYPFSGVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAML  339

Query  165  ESGKREGALVQVKKF  121
            ESG++ GA+V V KF
Sbjct  340  ESGEKNGAVVTVTKF  354


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIGDMMNVQ+IIEG+MNSSNP F
Sbjct  148  FVELKKLMVEIGDMMNVQLIIEGSMNSSNPYF  179



>gb|KJB66101.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=259

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  64   QVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRT  123

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSL
Sbjct  124  LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSL  183

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAM
Sbjct  184  YSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAM  243

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV VKKF
Sbjct  244  LESGSKGGTLVNVKKF  259


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++A +GDMMNVQVIIEG+MNSSNP F
Sbjct  47   FVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  78



>ref|XP_010466287.1| PREDICTED: uncharacterized protein LOC104746495 [Camelina sativa]
Length=235

 Score =   260 bits (665),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 154/195 (79%), Gaps = 5/195 (3%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVH++AGLRMLVGCEVT VSA TSHVDKT
Sbjct  46   QLIIEGSMNSSNPYFSSSWRRNLSGGFILDMGVHFIAGLRMLVGCEVTLVSAATSHVDKT  105

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MVVSSRSPKI+WRVVGL GT+++ERG + G+HGY  ++
Sbjct  106  LPGPDNITSNFQLENGCSGVFVMVVSSRSPKILWRVVGLKGTIQLERGVEGGRHGYLATI  165

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPF GV EELK F +DIS  N+K    + EPRLS+VEG RD+AVLEAML
Sbjct  166  YGEGGTSRTIFYPFSGVTEELKAFFNDIS-ENSK----EQEPRLSYVEGARDVAVLEAML  220

Query  165  ESGKREGALVQVKKF  121
            ESG + GA+V V K 
Sbjct  221  ESGAKNGAVVPVTKL  235


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIGDMMNVQ+IIEG+MNSSNP F
Sbjct  29   FVELKKLMVEIGDMMNVQLIIEGSMNSSNPYF  60



>gb|KJB66098.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=356

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  161  QVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRT  220

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSL
Sbjct  221  LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSL  280

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAM
Sbjct  281  YSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAM  340

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV VKKF
Sbjct  341  LESGSKGGTLVNVKKF  356


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  745  KKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            +K++A +GDMMNVQVIIEG+MNSSNP F
Sbjct  148  EKLVAGVGDMMNVQVIIEGSMNSSNPYF  175



>gb|KJB66099.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  163  QVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRT  222

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSL
Sbjct  223  LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSL  282

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAM
Sbjct  283  YSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAM  342

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV VKKF
Sbjct  343  LESGSKGGTLVNVKKF  358


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++A +GDMMNVQVIIEG+MNSSNP F
Sbjct  146  FVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  177



>gb|KJB66096.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=352

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  157  QVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRT  216

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSL
Sbjct  217  LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSL  276

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAM
Sbjct  277  YSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAM  336

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV VKKF
Sbjct  337  LESGSKGGTLVNVKKF  352


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++A +GDMMNVQVIIEG+MNSSNP F
Sbjct  140  FVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  171



>ref|XP_010673579.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 153/195 (78%), Gaps = 3/195 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH +A LRMLVGCE+ SVSA+T+HVD T
Sbjct  164  QVIVEGSVNSSNPYFSSSWRRNFNGGFILDMGVHMIAALRMLVGCEMKSVSALTTHVDTT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+ +QLENGC G+F M VS+RSPK  WRVVGL GT+++ERGN DG+HGY VS 
Sbjct  224  LPPPDNISSTYQLENGCPGIFVMAVSTRSPKTFWRVVGLKGTVQIERGNIDGRHGYLVSK  283

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            +  DGQ  S F+PF GV EELKTFL DIS A+      K + RLS+VEG RD+AVLEAML
Sbjct  284  FNVDGQCTSSFHPFSGVTEELKTFLHDISEASNNH---KPDRRLSYVEGARDVAVLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ESG + GA+V VK+F
Sbjct  341  ESGMKGGAVVPVKRF  355


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ EIGDMM+VQVI+EG++NSSNP F
Sbjct  147  FIEGRKLVEEIGDMMSVQVIVEGSVNSSNPYF  178



>ref|XP_010673578.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=360

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 153/195 (78%), Gaps = 3/195 (2%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH +A LRMLVGCE+ SVSA+T+HVD T
Sbjct  169  QVIVEGSVNSSNPYFSSSWRRNFNGGFILDMGVHMIAALRMLVGCEMKSVSALTTHVDTT  228

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS+ +QLENGC G+F M VS+RSPK  WRVVGL GT+++ERGN DG+HGY VS 
Sbjct  229  LPPPDNISSTYQLENGCPGIFVMAVSTRSPKTFWRVVGLKGTVQIERGNIDGRHGYLVSK  288

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            +  DGQ  S F+PF GV EELKTFL DIS A+      K + RLS+VEG RD+AVLEAML
Sbjct  289  FNVDGQCTSSFHPFSGVTEELKTFLHDISEASNNH---KPDRRLSYVEGARDVAVLEAML  345

Query  165  ESGKREGALVQVKKF  121
            ESG + GA+V VK+F
Sbjct  346  ESGMKGGAVVPVKRF  360


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ EIGDMM+VQVI+EG++NSSNP F
Sbjct  152  FIEGRKLVEEIGDMMSVQVIVEGSVNSSNPYF  183



>ref|XP_008787293.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787294.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787295.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787297.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787298.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787299.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787300.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
Length=364

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 152/197 (77%), Gaps = 2/197 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR F GGFILDMGVH++AGLRM+VGCE+T+VSA+  HVD  
Sbjct  168  QVIVEGSMNSSNPYFSSSWRRKFAGGFILDMGVHFIAGLRMIVGCEITTVSAIARHVDMA  227

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDN+ ALFQ+ENGC+GVF MVVSS SPKI WRV G NGTL++ERG+ +G+HGY V L
Sbjct  228  LPPPDNLCALFQVENGCAGVFVMVVSSASPKIYWRVDGSNGTLQIERGSDNGQHGYMVLL  287

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEA  172
            Y  DG  +  F+PF GV EELK F+ DI+ A +K G    K EPR S+VEG RD+AVLEA
Sbjct  288  YKADGHCQRTFHPFSGVNEELKAFVQDITQATSKEGVAGQKAEPRSSYVEGARDVAVLEA  347

Query  171  MLESGKREGALVQVKKF  121
            MLES +++GA V VK F
Sbjct  348  MLESSRKQGAQVHVKNF  364


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ EIGDM+N+QVI+EG+MNSSNP F
Sbjct  151  FVEARKLVNEIGDMINIQVIVEGSMNSSNPYF  182



>ref|XP_002459955.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
 gb|EER96476.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
Length=364

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 153/195 (78%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+S+WRRNF GGFILDMGVH++AGLRMLVG E+TSVS+++ HVD T
Sbjct  171  QVIIEGSMNSSNPYFNSTWRRNFVGGFILDMGVHFIAGLRMLVGSEITSVSSISRHVDMT  230

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGC+GVF   V+SRSPKI+WRV G  GT++VERG   GKHGY V  
Sbjct  231  LPPPDNICSLFQLENGCAGVFVFAVNSRSPKILWRVDGTKGTIQVERGVDSGKHGYQVLF  290

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
               +GQ +  FYPFCGV EELKTF+ D+ LA  K G+ K EPR S+VEG RD+AVLEAML
Sbjct  291  SGENGQCQKTFYPFCGVNEELKTFVHDM-LAADKDGDHKAEPRSSYVEGARDVAVLEAML  349

Query  165  ESGKREGALVQVKKF  121
            ES  ++GA VQVK+F
Sbjct  350  ESSAKQGAPVQVKRF  364


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E  K+I +IGDMM++QVIIEG+MNSSNP F
Sbjct  154  FIESSKLINDIGDMMHIQVIIEGSMNSSNPYF  185



>gb|KHG07862.1| Uncharacterized protein F383_13730 [Gossypium arboreum]
Length=353

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  158  QVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMMVGCEVTSVSAITSHIDRT  217

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  G+++VERG  DGKHGY VSL
Sbjct  218  LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGSVQVERGKVDGKHGYLVSL  277

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAM
Sbjct  278  YSADGQSKSTFHPFCGVHEELKFFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAM  337

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV VKKF
Sbjct  338  LESGSKGGTLVNVKKF  353


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++A +GDMMNVQVIIEG+MNSSNP F
Sbjct  141  FVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  172



>ref|XP_009385566.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1 [Musa acuminata subsp. malaccensis]
Length=364

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 148/197 (75%), Gaps = 2/197 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRN+FGGFILDMGVH+VAGLRM+VGCE+++VSA+  HVD  
Sbjct  168  QVIIEGSMNSSNPYFSSSWRRNYFGGFILDMGVHFVAGLRMMVGCEISTVSAIARHVDMA  227

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI ALFQLENGC+GVF M V+S SPKI WR+ G  GTL++ERG   G+HGYSV  
Sbjct  228  LPPPDNICALFQLENGCAGVFVMAVNSISPKIYWRIDGSKGTLQIERGTDSGRHGYSVLF  287

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGG--ECKGEPRLSFVEGTRDIAVLEA  172
            Y   G  +  FYPFCGV EELK+F+ DIS AN K G    + EPR  + EG RD+AVLEA
Sbjct  288  YTAGGHCQRTFYPFCGVNEELKSFIHDISQANRKDGMTSHEPEPRSLYKEGARDVAVLEA  347

Query  171  MLESGKREGALVQVKKF  121
            MLES  ++GA V VKK 
Sbjct  348  MLESSAKQGAAVHVKKL  364


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ +IGDMM+VQVIIEG+MNSSNP F
Sbjct  151  FVESRKLLNDIGDMMHVQVIIEGSMNSSNPYF  182



>ref|NP_001062764.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAD26513.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24678.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAG93408.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84244.1| hypothetical protein OsI_30682 [Oryza sativa Indica Group]
Length=359

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 152/195 (78%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+SSWRRNF GGFILDMGVH++AGLRM+VG E+ +VS+++ HVDK 
Sbjct  166  QVIVEGSMNSSNPYFNSSWRRNFVGGFILDMGVHFIAGLRMMVGSEIATVSSISRHVDKA  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGC+GVF   V+SR+PKI+WRV G  GT+++ERG   GKHGY V  
Sbjct  226  LPPPDNICSLFQLENGCAGVFVFAVNSRTPKILWRVDGTRGTVQIERGIASGKHGYQVLF  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
               +GQ ++ FYPFCGV EELK F+ DI  AN K G+ K EPR S+VEG RD+AVLEAML
Sbjct  286  TNENGQCQTTFYPFCGVNEELKAFVHDIVQAN-KDGDHKAEPRSSYVEGARDVAVLEAML  344

Query  165  ESGKREGALVQVKKF  121
            ES  ++G +VQVKKF
Sbjct  345  ESSAKQGTMVQVKKF  359


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++++IGDMMN+QVI+EG+MNSSNP F
Sbjct  149  FVESRKLMSDIGDMMNIQVIVEGSMNSSNPYF  180



>ref|XP_004956459.1| PREDICTED: uncharacterized protein YMR315W-like [Setaria italica]
Length=365

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 153/195 (78%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+SSWRRNF GGFILDMGVH++AGLRMLVG E+TSVS+++ HVD +
Sbjct  171  QVIIEGSMNSSNPYFNSSWRRNFVGGFILDMGVHFIAGLRMLVGSEITSVSSISRHVDMS  230

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGC+GVF   V+SRSPKI+WRV G  GT++VERG   GKHGY V  
Sbjct  231  LPPPDNICSLFQLENGCAGVFVFAVNSRSPKILWRVDGTKGTIQVERGVDSGKHGYQVLF  290

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
               +GQ +  FYPFCGV EELKTF+ D+ LA +K G+ K EPR S+VEG RD+AVLEAML
Sbjct  291  SGENGQCQKTFYPFCGVNEELKTFVQDM-LAASKDGDHKAEPRSSYVEGARDVAVLEAML  349

Query  165  ESGKREGALVQVKKF  121
            ES  ++G  VQVK+F
Sbjct  350  ESSVKQGTPVQVKRF  364


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E  K+I +IGDMMN+QVIIEG+MNSSNP F
Sbjct  154  FVESSKLIKDIGDMMNIQVIIEGSMNSSNPYF  185



>gb|AFK42402.1| unknown [Lotus japonicus]
Length=177

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -2

Query  642  NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  463
            +F GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD TLPPPDNIS++F LENGCSGVF
Sbjct  4    HFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLTLPPPDNISSVFHLENGCSGVF  63

Query  462  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  283
             MVVSSRSPKI+WRVVGLNGTL +ERG + G+HGY VS Y   GQ KS F+PF GV EEL
Sbjct  64   VMVVSSRSPKILWRVVGLNGTLHIERGFQ-GQHGYLVSSYGAVGQCKSSFFPFSGVTEEL  122

Query  282  KTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  121
            K FL+D+S +N  KG     E RLSFVEG RD+AVLEAMLESG R+G LV VK F
Sbjct  123  KAFLNDVSESNPEKGNNFVAEQRLSFVEGARDVAVLEAMLESGARQGELVHVKNF  177



>ref|XP_002883268.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59527.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=360

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 153/201 (76%), Gaps = 11/201 (5%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEV SVSA TSHVDKT
Sbjct  165  QLIIEGSMNSSNPYFSSSWRRNLSGGFILDMGVHYIAGLRMLVGCEVASVSATTSHVDKT  224

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPK------IVWRVVGLNGTLEVERGNKDGKH  364
            LP PDNI++ FQLENGCSGVF MVVSSRSPK      I+WRVVGL GT+++ERG + G+H
Sbjct  225  LPGPDNITSNFQLENGCSGVFVMVVSSRSPKACSKTWILWRVVGLKGTVQLERGVEGGRH  284

Query  363  GYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIA  184
            GY  ++Y   G  ++ FYPF GV EELK F +DIS  +      + EPRLS+VEG RD+A
Sbjct  285  GYMATIYGEGGTSRTIFYPFSGVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVA  339

Query  183  VLEAMLESGKREGALVQVKKF  121
            VLEAMLESG + GA+V V KF
Sbjct  340  VLEAMLESGAKNGAVVPVTKF  360


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK+IAE GDMMNVQ+IIEG+MNSSNP F
Sbjct  148  FVELKKLIAETGDMMNVQLIIEGSMNSSNPYF  179



>ref|XP_006660493.1| PREDICTED: uncharacterized protein YMR315W-like [Oryza brachyantha]
Length=359

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+SSWRRNF GGFILDMGVH++AGLRMLVG E+ +VS+++ HVDK 
Sbjct  166  QVIVEGSMNSSNPYFNSSWRRNFVGGFILDMGVHFIAGLRMLVGSEIATVSSISRHVDKA  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGC+GVF   ++SRSPKI+WRV G  GT+++ERG   GKHGY V  
Sbjct  226  LPPPDNICSLFQLENGCAGVFVFAINSRSPKILWRVDGTKGTVQIERGIAGGKHGYQVLF  285

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            +  + Q ++ FYPFCGV EELK F+ DI   N K G+ K EPR S+VEG RD+AVLEAML
Sbjct  286  FSENAQCQTTFYPFCGVNEELKAFVHDIVQTN-KDGDHKAEPRSSYVEGARDVAVLEAML  344

Query  165  ESGKREGALVQVKKF  121
            +S  ++GA VQVKKF
Sbjct  345  KSSAKQGATVQVKKF  359


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K++ +IGDMMN+QVI+EG+MNSSNP F
Sbjct  149  FVESRKLMNDIGDMMNIQVIVEGSMNSSNPYF  180



>gb|KJB66095.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF   FILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+T
Sbjct  163  QVIIEGSMNSSNPYFSSSWRRNFEVCFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRT  222

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSL
Sbjct  223  LPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSL  282

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAM
Sbjct  283  YSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAM  342

Query  168  LESGKREGALVQVKKF  121
            LESG + G LV VKKF
Sbjct  343  LESGSKGGTLVNVKKF  358


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++A +GDMMNVQVIIEG+MNSSNP F
Sbjct  146  FVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  177



>ref|NP_001149836.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
 gb|ACG36942.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+S+WRRNF GGFILDMGVH++AGLRMLVG E+TSVS+++ HVD  
Sbjct  171  QVIIEGSMNSSNPYFNSTWRRNFVGGFILDMGVHFIAGLRMLVGSEITSVSSISRHVDMA  230

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGC+GVF   V+SRSPKI+WRV G  GT++VERG   GKHGY V  
Sbjct  231  LPPPDNICSLFQLENGCAGVFVFAVNSRSPKILWRVDGTKGTIQVERGVDSGKHGYQVLF  290

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
               +GQ +  FYPFCGV EELKTF+ D+ L   K G+ K EPR S+VEG RD+AVLEAML
Sbjct  291  SGENGQCQKTFYPFCGVNEELKTFVHDM-LEAGKDGDHKAEPRGSYVEGARDVAVLEAML  349

Query  165  ESGKREGALVQVKKF  121
            ES  ++GA VQVK+F
Sbjct  350  ESSAKQGAPVQVKRF  364


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E  K+I +IGDMM++QVIIEG+MNSSNP F
Sbjct  154  FIESSKLINDIGDMMHIQVIIEGSMNSSNPYF  185



>ref|XP_007014899.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
 gb|EOY32518.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
Length=358

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 158/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH D T
Sbjct  163  QIIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMMVGCEVTSVSAITSHRDTT  222

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ FQLENGCSGVF +VVSS SPK++WRVVGL GT++VERG ++G+HGY VSL
Sbjct  223  LPPPDIISSNFQLENGCSGVFVLVVSSSSPKVIWRVVGLKGTVQVERGKQEGRHGYLVSL  282

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS FYPFCGV EELK F+ DI  A  K G   + EPR SFVEG RD+AVLEAM
Sbjct  283  YSADGQCKSTFYPFCGVHEELKAFIHDILQATVKEGSGYEAEPRSSFVEGARDVAVLEAM  342

Query  168  LESGKREGALVQVKKF  121
            LESG + GALV VKK 
Sbjct  343  LESGNKGGALVHVKKL  358


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK+IA+IGDMMNVQ+IIEG+MNSSNP F
Sbjct  146  FVESKKLIADIGDMMNVQIIIEGSMNSSNPYF  177



>ref|XP_003577920.1| PREDICTED: uncharacterized protein LOC100827110 [Brachypodium 
distachyon]
Length=360

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+SSWRRNF GGF+LDMGVH++AGLRMLVG EV +VS+++ HVD  
Sbjct  167  QVIVEGSMNSSNPYFNSSWRRNFVGGFVLDMGVHFIAGLRMLVGSEVATVSSISRHVDTA  226

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGC+GVF   V+SRSPKI+WRV G  GT+++ERG   GKHGY V  
Sbjct  227  LPPPDNICSLFQLENGCAGVFVFAVNSRSPKILWRVDGTKGTVQIERGIDSGKHGYQVLF  286

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
               +GQ +  FYPFCGV EELK F+ DI L  +K  + K EPR S+VEG RD+AVLEAML
Sbjct  287  SHENGQCQKTFYPFCGVNEELKAFVHDI-LQASKDVDHKAEPRSSYVEGVRDVAVLEAML  345

Query  165  ESGKREGALVQVKKF  121
            ES  ++GALVQVKK 
Sbjct  346  ESSTKQGALVQVKKL  360


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E  K++++IGDMMN+QVI+EG+MNSSNP F
Sbjct  150  FVESNKLMSDIGDMMNIQVIVEGSMNSSNPYF  181



>ref|XP_008668038.1| PREDICTED: NAD-dependent dyhydrogenase, Gfo/Idh/MocA family isoform 
X1 [Zea mays]
 tpg|DAA39396.1| TPA: NAD-dependent dihydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+S+WRRNF GGFILDMGVH++AGLRMLVG E+TSVS+++ HVD  
Sbjct  171  QVIIEGSMNSSNPYFNSTWRRNFVGGFILDMGVHFIAGLRMLVGSEITSVSSISRHVDMA  230

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGC+GVF   V+SRSPKI+WRV G  GT++VERG   GKHGY V  
Sbjct  231  LPPPDNICSLFQLENGCAGVFVFAVNSRSPKILWRVDGTKGTIQVERGVDSGKHGYQVLF  290

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
               +GQ +  FYPFCGV EELKTF+ D+ L   K G+ K  PR S+VEG RD+AVLEAML
Sbjct  291  SGENGQCQKTFYPFCGVNEELKTFVHDM-LEAGKDGDHKAAPRGSYVEGARDVAVLEAML  349

Query  165  ESGKREGALVQVKKF  121
            ES  ++GA VQVK+F
Sbjct  350  ESSAKQGAPVQVKRF  364


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E  K+I +IGDMM++QVIIEG+MNSSNP F
Sbjct  154  FIESSKLINDIGDMMHIQVIIEGSMNSSNPYF  185



>emb|CDY06381.1| BnaC05g31490D [Brassica napus]
Length=348

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 148/195 (76%), Gaps = 12/195 (6%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKT
Sbjct  166  QLIIEGSMNSSNPYFSSSWRRNLDGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF MV       I+WRVVGL GT+++ERG +DG+HGY  ++
Sbjct  226  LPAPDNITSNFQLENGCSGVFVMV-------ILWRVVGLKGTVQLERGVQDGRHGYMATV  278

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPF GV EELK F  DIS     G   + EPRLS+VEG RD+AVLEAML
Sbjct  279  YGEGGTSRTIFYPFSGVTEELKAFFRDIS-----GTSKEQEPRLSYVEGARDVAVLEAML  333

Query  165  ESGKREGALVQVKKF  121
            ESG R GA++ VKKF
Sbjct  334  ESGARNGAVIPVKKF  348


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIGD+MNVQ+IIEG+MNSSNP F
Sbjct  149  FVELKKLVEEIGDIMNVQLIIEGSMNSSNPYF  180



>emb|CDY19604.1| BnaA05g20120D [Brassica napus]
Length=347

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 148/195 (76%), Gaps = 13/195 (7%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKT
Sbjct  166  QLIIEGSMNSSNPYFSSSWRRNLDGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKT  225

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDNI++ FQLENGCSGVF M        I+WRVVGL GT+++ERG +DG+HGY  ++
Sbjct  226  LPAPDNITSNFQLENGCSGVFVM--------ILWRVVGLKGTVQLERGVQDGRHGYMATV  277

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
            Y   G  ++ FYPF GV EELK F +DIS     G   + EPRLS+VEG RD+AVLEAML
Sbjct  278  YGEGGTSRTIFYPFSGVTEELKAFFNDIS-----GASKEQEPRLSYVEGARDVAVLEAML  332

Query  165  ESGKREGALVQVKKF  121
            ESG R GA++ VKKF
Sbjct  333  ESGARNGAVIPVKKF  347


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK++ EIGDMMNVQ+IIEG+MNSSNP F
Sbjct  149  FVELKKLVEEIGDMMNVQLIIEGSMNSSNPYF  180



>gb|EMT01460.1| hypothetical protein F775_26364 [Aegilops tauschii]
Length=355

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YF+SSWRRNF GGFILDMGVH++AGLRMLVG EV +VS+++ HVD  
Sbjct  162  QVIVEGSMNSSNPYFNSSWRRNFVGGFILDMGVHFIAGLRMLVGSEVATVSSISRHVDTD  221

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNI +LFQLENGC+GV    V SRSPKI+WRV G  GT+++ERG   GKHGY V  
Sbjct  222  LPPPDNICSLFQLENGCAGVLVFAVKSRSPKILWRVDGTKGTVQIERGVDGGKHGYQVLF  281

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
                G+ +  FYPFCGV EELK F+ D+  A +K G+ K EPR S+VEG RD+AVLEAML
Sbjct  282  SNESGECQKTFYPFCGVHEELKAFVHDMVQA-SKDGDHKAEPRSSYVEGARDVAVLEAML  340

Query  165  ESGKREGALVQVKKF  121
            ES  ++GA+VQVKKF
Sbjct  341  ESSAKQGAMVQVKKF  355


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E  K++ +IGDMMN+QVI+EG+MNSSNP F
Sbjct  145  FVESSKLMDDIGDMMNIQVIVEGSMNSSNPYF  176



>ref|XP_007205433.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
 gb|EMJ06632.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
Length=356

 Score =   248 bits (634),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 149/196 (76%), Gaps = 5/196 (3%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            ++L++G   +   YFSSSWRRNF     + M ++    L+ L GCE+ SVSA+TSHVDKT
Sbjct  164  QVLVEGSMNSSNPYFSSSWRRNF----TVRMNLNMSCSLQQLAGCELVSVSAITSHVDKT  219

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LP PDN+S+LFQLENGCSGVF MVVSSRSPKIVWR VGL GTL++ERGN+DG+HGY V  
Sbjct  220  LPAPDNVSSLFQLENGCSGVFVMVVSSRSPKIVWRFVGLKGTLQIERGNQDGRHGYLVLF  279

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            Y  DGQ KS FY F GV EE K F++DIS AN  KG   + EPR+SF+EG RD+AVLEAM
Sbjct  280  YGSDGQSKSSFYQFSGVDEEFKAFINDISQANLRKGTGYEAEPRMSFLEGARDVAVLEAM  339

Query  168  LESGKREGALVQVKKF  121
            LESG ++GA V VKK+
Sbjct  340  LESGGKQGAPVHVKKY  355


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLFLKLLEAQLLWRFHSRHGCAL  602
            F E KK++ +IGD+M++QV++EG+MNSSNP F          R +    C+L
Sbjct  147  FVEGKKLVNDIGDVMSIQVLVEGSMNSSNPYFSSSWRRNFTVRMNLNMSCSL  198



>ref|XP_006850072.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
 gb|ERN11653.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
Length=368

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = -2

Query  666  YFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQL  487
            YFSSSWRRNF GGFILDMGVH+VAGLRM+VG EVTS+SA++ HVD +LPPPDN+ A+FQL
Sbjct  186  YFSSSWRRNFAGGFILDMGVHFVAGLRMIVGYEVTSISAISRHVDTSLPPPDNVCAVFQL  245

Query  486  ENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP  307
            ENGC GV  + VS+RSPKI WRVVG  G++E ERG ++G+HGY+V+        +  FYP
Sbjct  246  ENGCGGVLVLSVSTRSPKISWRVVGSKGSVETERGIRNGQHGYTVTYSPAGEPPQCSFYP  305

Query  306  FCGVQEELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  130
            FCGV EELK F+ DIS AN K GE  + +PR +++EG RD+A++EAMLESG + G L  V
Sbjct  306  FCGVNEELKAFVQDISQANLKDGEAYEPDPRGTYLEGARDVALVEAMLESGLKNGELFHV  365

Query  129  KKF  121
            KK 
Sbjct  366  KKL  368



>gb|EEE69341.1| hypothetical protein OsJ_28659 [Oryza sativa Japonica Group]
Length=364

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNF-----FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTS  541
            +++++G   +   YF+SS  + F      GGFILDMGVH++AGLRM+VG E+ +VS+++ 
Sbjct  166  QVIVEGSMNSSNPYFNSSLEKKFCGKNQVGGFILDMGVHFIAGLRMMVGSEIATVSSISR  225

Query  540  HVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHG  361
            HVDK LPPPDNI +LFQLENGC+GVF   V+SR+PKI+WRV G  GT+++ERG   GKHG
Sbjct  226  HVDKALPPPDNICSLFQLENGCAGVFVFAVNSRTPKILWRVDGTRGTVQIERGIASGKHG  285

Query  360  YSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAV  181
            Y V     +GQ ++ FYPFCGV EELK F+ DI  AN K G+ K EPR S+VEG RD+AV
Sbjct  286  YQVLFTNENGQCQTTFYPFCGVNEELKAFVHDIVQAN-KDGDHKAEPRSSYVEGARDVAV  344

Query  180  LEAMLESGKREGALVQVKKF  121
            LEAMLES  ++G +VQVKKF
Sbjct  345  LEAMLESSAKQGTMVQVKKF  364


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLFLKLLEAQL  638
            F E +K++++IGDMMN+QVI+EG+MNSSNP F   LE + 
Sbjct  149  FVESRKLMSDIGDMMNIQVIVEGSMNSSNPYFNSSLEKKF  188



>ref|XP_011090402.1| PREDICTED: uncharacterized protein YMR315W-like [Sesamum indicum]
Length=358

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 147/196 (75%), Gaps = 1/196 (1%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            ++L++    +   YFSSSWR NF GG+ILDMGVH+VA LRML GCEVTSVSAMTSHVD T
Sbjct  163  QILVEAPMNSSNPYFSSSWRHNFTGGYILDMGVHFVAVLRMLAGCEVTSVSAMTSHVDTT  222

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD++S++ QLENG  GV    +  ++ KI  R VG+ GTL+++  N++GK GYSVSL
Sbjct  223  LPPPDSMSSIIQLENGRCGVLVASLPGKTLKIFHRFVGVKGTLQIDVENREGKFGYSVSL  282

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGG-ECKGEPRLSFVEGTRDIAVLEAM  169
            +  DGQ K+ +YPF GV EELKTF + +SLA  K     + EPRLS +EG RD+AV+EA+
Sbjct  283  FTADGQTKNSYYPFRGVTEELKTFFNVVSLATEKKDLTFRAEPRLSVIEGARDVAVIEAI  342

Query  168  LESGKREGALVQVKKF  121
            LESG ++GALVQV KF
Sbjct  343  LESGNKQGALVQVNKF  358



>emb|CAN75498.1| hypothetical protein VITISV_020272 [Vitis vinifera]
Length=364

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 140/192 (73%), Gaps = 16/192 (8%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSA+TSHVD  
Sbjct  151  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIASVSAITSHVDTM  210

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++F L                 +I WRVVGL GTL++ERGNK+G HGY  S 
Sbjct  211  LPPPDNISSVFPL---------------YLQIFWRVVGLKGTLQLERGNKEGSHGYQFSF  255

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            +  DGQ KS FYPF GV EELKTF+ DIS A   KG   + E RLSFVEG RD+A+L+AM
Sbjct  256  HGADGQCKSSFYPFSGVTEELKTFIHDISQATLKKGSSYEAETRLSFVEGARDVAILDAM  315

Query  168  LESGKREGALVQ  133
            LESG R+GAL+Q
Sbjct  316  LESGMRQGALIQ  327


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++ EIGDMM++QVI+EG+MNSSNP F
Sbjct  134  FVECKKLMEEIGDMMSIQVIVEGSMNSSNPYF  165



>ref|XP_010651283.1| PREDICTED: uncharacterized protein LOC100245027 isoform X2 [Vitis 
vinifera]
Length=322

 Score =   232 bits (592),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 137/195 (70%), Gaps = 36/195 (18%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSA+TSHVD  
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIASVSAITSHVDTM  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDNIS++FQLENGCSGVF MVVS+R+PKI WRVVGL GTL++ERGNK+G HGY    
Sbjct  224  LPPPDNISSVFQLENGCSGVFVMVVSTRAPKIFWRVVGLKGTLQLERGNKEGSHGYQ---  280

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
                                             KG   + E RLSFVEG RD+A+L+AML
Sbjct  281  ---------------------------------KGSSYEAETRLSFVEGARDVAILDAML  307

Query  165  ESGKREGALVQVKKF  121
            ESG R+GAL+QVKKF
Sbjct  308  ESGMRQGALIQVKKF  322


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++ EIGDMM++QVI+EG+MNSSNP F
Sbjct  147  FVECKKLMEEIGDMMSIQVIVEGSMNSSNPYF  178



>gb|EPS68382.1| hypothetical protein M569_06387, partial [Genlisea aurea]
Length=340

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 148/196 (76%), Gaps = 16/196 (8%)
 Frame = -2

Query  702  LLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTL  523
            ++++G   +   YFSSSWRRNF GGFILDMG+              TSVSA TSHVD T+
Sbjct  159  VIVEGSMNSSNPYFSSSWRRNFDGGFILDMGI--------------TSVSAFTSHVDTTV  204

Query  522  PPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLY  343
            PPPD++S+  QL+NG SGVF MVVSSRSPK++WR+VGLNGTL+VERG KDGKHGY+V+L+
Sbjct  205  PPPDHLSSTVQLDNGTSGVFVMVVSSRSPKVLWRIVGLNGTLQVERGTKDGKHGYTVALF  264

Query  342  MGD-GQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
              D  Q K++FYPF GV  EL+ FLSD+S+A+  K G+ + E RLSF+EG RD+AVL+AM
Sbjct  265  TADPSQNKNWFYPFSGVTLELEAFLSDVSMASLNKEGDHQVEKRLSFLEGARDVAVLDAM  324

Query  168  LESGKREGALVQVKKF  121
            LESG+R  + VQV KF
Sbjct  325  LESGRRGSSPVQVGKF  340



>gb|EYU46305.1| hypothetical protein MIMGU_mgv1a0096472mg, partial [Erythranthe 
guttata]
 gb|EYU46306.1| hypothetical protein MIMGU_mgv1a0096472mg, partial [Erythranthe 
guttata]
Length=150

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = -2

Query  567  VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVE  388
            + SVSA+TSHVD +LPPPD+IS+  QLE+G SGVF MVVSSRSPK++WR+VGL GTL+VE
Sbjct  1    IISVSAITSHVDTSLPPPDHISSTIQLEDGSSGVFVMVVSSRSPKVLWRMVGLKGTLQVE  60

Query  387  RGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLS  211
            RGNKDGKHGY+V L+  DGQ KS+FYPF GV EELKTFLSDIS+A   K G  + EPR+S
Sbjct  61   RGNKDGKHGYTVVLFTADGQTKSWFYPFSGVTEELKTFLSDISVATLKKDGRYEVEPRIS  120

Query  210  FVEGTRDIAVLEAMLESGKREGALVQVKKF  121
            F+EG RD+AVL+AMLESGKR+G  VQVKKF
Sbjct  121  FLEGARDVAVLDAMLESGKRKGETVQVKKF  150



>gb|EYU18011.1| hypothetical protein MIMGU_mgv1a008840mg [Erythranthe guttata]
Length=360

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 141/179 (79%), Gaps = 2/179 (1%)
 Frame = -2

Query  651  WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  472
            WR +F GG+ILDMGVH++A LRM+ GCE+TSVSAMTS+VD TLPPPD++S+L QLENG S
Sbjct  182  WRHSFAGGYILDMGVHFIAALRMMAGCEITSVSAMTSNVDTTLPPPDSMSSLIQLENGRS  241

Query  471  GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP-FCGV  295
            GV   VVS+++ K+ WRVVGLNGT +++  +++GK GY V+L+  DGQ KS FYP F GV
Sbjct  242  GVLVTVVSAKTLKLFWRVVGLNGTFQIDVESREGKFGYLVTLFTADGQTKSNFYPGFSGV  301

Query  294  QEELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  121
             EELK F SD++ A+ K     + E R+SF+EG RD+AV++AMLESG ++GALV VKKF
Sbjct  302  TEELKIFFSDVTQASLKKESIFEAEARMSFIEGARDLAVMDAMLESGNKQGALVHVKKF  360



>ref|XP_010913920.1| PREDICTED: uncharacterized protein LOC105039462 isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 136/197 (69%), Gaps = 19/197 (10%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRR F                 ++VGCE+T+VSA+  HVD  
Sbjct  168  QVIVEGSMNSSNPYFSSSWRRKF-----------------IIVGCEITTVSAIARHVDMA  210

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPDN+ ALFQLENGC+GVF M VSS SPKI WRV G NGTL++ERG+ +G+HGY V L
Sbjct  211  LPPPDNLCALFQLENGCAGVFVMAVSSTSPKIYWRVDGSNGTLQIERGSDNGQHGYMVLL  270

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEA  172
            Y  DG  +  F+PF GV EELK F+ DI+ A TK G    K EPR S+VEG RD+AVLEA
Sbjct  271  YKADGHCQRTFHPFSGVNEELKAFVHDITQATTKEGVAGQKAEPRSSYVEGARDVAVLEA  330

Query  171  MLESGKREGALVQVKKF  121
            ML+S ++EGA V VKKF
Sbjct  331  MLDSSRKEGAQVHVKKF  347


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E +K+I EIGDMMN+QVI+EG+MNSSNP F
Sbjct  151  FVEARKLINEIGDMMNIQVIVEGSMNSSNPYF  182



>gb|KGN54118.1| hypothetical protein Csa_4G286420 [Cucumis sativus]
Length=160

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 123/156 (79%), Gaps = 3/156 (2%)
 Frame = -2

Query  588  RMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGL  409
            + LVGCEV  VSA TS+VDK+LPPPDNIS+LFQLENGCSGVF MVVSS+SPKI WRVVGL
Sbjct  8    KQLVGCEVVLVSATTSYVDKSLPPPDNISSLFQLENGCSGVFVMVVSSKSPKIFWRVVGL  67

Query  408  NGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECK  229
             GTL++ERGN+DGKHGY VS     G  +  FYPF GV EELKTF+  IS    +G + K
Sbjct  68   KGTLQIERGNQDGKHGYLVSFTDASGLNRCTFYPFSGVTEELKTFIHAIS---AEGSDDK  124

Query  228  GEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  121
             + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  125  ADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  160



>ref|XP_007014900.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
 gb|EOY32519.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
Length=344

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 141/199 (71%), Gaps = 21/199 (11%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF                  +VGCEVTSVSA+TSH D T
Sbjct  163  QIIIEGSMNSSNPYFSSSWRRNF-----------------EMVGCEVTSVSAITSHRDTT  205

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
            LPPPD IS+ FQLENGCSGVF +VVSS SPK++WRVVGL GT++VERG ++G+HGY VSL
Sbjct  206  LPPPDIISSNFQLENGCSGVFVLVVSSSSPKVIWRVVGLKGTVQVERGKQEGRHGYLVSL  265

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLANTK----GGECKGEPRLSFVEGTRDIAVL  178
            Y  DGQ KS FYPFCGV EELK F+ DI  A  K    G   + EPR SFVEG RD+AVL
Sbjct  266  YSADGQCKSTFYPFCGVHEELKAFIHDILQATVKVRSDGSGYEAEPRSSFVEGARDVAVL  325

Query  177  EAMLESGKREGALVQVKKF  121
            EAMLESG + GALV VKK 
Sbjct  326  EAMLESGNKGGALVHVKKL  344


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK+IA+IGDMMNVQ+IIEG+MNSSNP F
Sbjct  146  FVESKKLIADIGDMMNVQIIIEGSMNSSNPYF  177



>ref|XP_001762266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73058.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 119/172 (69%), Gaps = 4/172 (2%)
 Frame = -2

Query  651  WRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENG  478
            WRR  NF GGF+LD GVH++AGLRM++GCEV SVSA  SHVD TLPPPDN+SAL QL+NG
Sbjct  183  WRREANFKGGFMLDGGVHFIAGLRMIMGCEVDSVSATVSHVDLTLPPPDNLSALIQLQNG  242

Query  477  CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCG  298
             +GV  +  S++S K++WRVVG  GT+EV+R  ++G+HGY  +     G+I+  F PF G
Sbjct  243  TAGVVYICYSAKSRKMIWRVVGSLGTVEVDRTVQNGQHGYKTTYQPAKGEIQEVFCPFAG  302

Query  297  VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
            V EEL+ F  D++     G E   + R S +E  RD+AV+EAM  S   +GA
Sbjct  303  VYEELRAFSEDVARCGQSGEEA--DKRSSVLEAMRDVAVIEAMFHSSDSKGA  352



>ref|XP_010651284.1| PREDICTED: uncharacterized protein LOC100245027 isoform X3 [Vitis 
vinifera]
Length=309

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 115/196 (59%), Gaps = 51/196 (26%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM                   
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRM-------------------  204

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSL  346
                                           I WRVVGL GTL++ERGNK+G HGY  S 
Sbjct  205  -------------------------------IFWRVVGLKGTLQLERGNKEGSHGYQFSF  233

Query  345  YMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAM  169
            +  DGQ KS FYPF GV EELKTF+ DIS A   KG   + E RLSFVEG RD+A+L+AM
Sbjct  234  HGADGQCKSSFYPFSGVTEELKTFIHDISQATLKKGSSYEAETRLSFVEGARDVAILDAM  293

Query  168  LESGKREGALVQVKKF  121
            LESG R+GAL+QVKKF
Sbjct  294  LESGMRQGALIQVKKF  309


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++ EIGDMM++QVI+EG+MNSSNP F
Sbjct  147  FVECKKLMEEIGDMMSIQVIVEGSMNSSNPYF  178



>ref|XP_002976631.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
 gb|EFJ22300.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
Length=341

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 115/168 (68%), Gaps = 7/168 (4%)
 Frame = -2

Query  663  FSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  484
            FSS WRR   GG++LD  VH +AGLR++ G EV SVSA+  HVD+ LPPPDN+SALF+LE
Sbjct  174  FSSIWRRELKGGYVLDGAVHQIAGLRVITGSEVKSVSAICRHVDEALPPPDNVSALFELE  233

Query  483  NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  304
            NGC+G   +  S  + K+ W++VG  GT+EV++  +DG+ G+ VS     G+  S FYP 
Sbjct  234  NGCAGTLMISFSCTTKKMSWKIVGTKGTVEVDQDTQDGQPGFMVSHATSVGK-NSIFYPC  292

Query  303  CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
            CGV+EEL++F+ D+S    +GGE   + R S  E   D+AV+EA+L S
Sbjct  293  CGVEEELRSFIHDLS----QGGE--ADKRSSPGEAFIDVAVIEAILNS  334



>ref|XP_002969664.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
 gb|EFJ28788.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
Length=348

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 116/183 (63%), Gaps = 12/183 (7%)
 Frame = -2

Query  666  YFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQL  487
            Y+SS+WRR+  GGF+LD GVH+VAGLR++ GCEVT VSA+  HVD  LP PDN+SAL   
Sbjct  173  YYSSAWRRD--GGFVLDGGVHFVAGLRLITGCEVTQVSAIARHVDPLLPSPDNVSAL---  227

Query  486  ENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP  307
                  ++A   S   PK+ WRV+G  GT+E  R  KDG HGY V+ Y   G + S F+P
Sbjct  228  ------LYAYSWSFYYPKVSWRVLGSKGTVEAVRDQKDGSHGYLVTFYPLGGTVLSKFFP  281

Query  306  FCGVQEELKTFLSDISLANTKGGECK-GEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  130
            F GV+ ELK F+ D+S    +G   +  + R + +E   D+AV+EAML+S   +G  V V
Sbjct  282  FSGVENELKAFVGDVSQIVYEGKTAEDADKRSNVIEAYHDVAVIEAMLKSSNNKGFPVHV  341

Query  129  KKF  121
             ++
Sbjct  342  DRY  344



>ref|XP_002973220.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
 gb|EFJ25594.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
Length=349

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 115/168 (68%), Gaps = 7/168 (4%)
 Frame = -2

Query  663  FSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  484
            FSS WRR   GG++LD  VH +AGLR++ G EV SVSA+  HVD+ LPPPDN+SALF+LE
Sbjct  174  FSSIWRRELKGGYVLDGAVHQIAGLRVITGSEVKSVSAICRHVDEALPPPDNVSALFELE  233

Query  483  NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  304
            NGC+G   +  S  + K+ W++VG  GT+EV++  +DG+ G+ VS     G+  S FYP 
Sbjct  234  NGCAGTLMISFSCTTKKMSWKIVGTKGTVEVDQDTQDGQPGFMVSHATSVGK-NSSFYPC  292

Query  303  CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
            CGV+EEL++F+ D+S    +GGE   + R S  E   D+AV+EA+L S
Sbjct  293  CGVEEELRSFIHDLS----QGGE--ADKRSSPGEAFIDVAVIEAILNS  334



>ref|XP_002981277.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
 gb|EFJ17465.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
Length=338

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 111/186 (60%), Gaps = 27/186 (15%)
 Frame = -2

Query  666  YFSSSWRRN----FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            Y+SS+WRR+    + GGF+LD GVH+VAGLR++ GCEVT VSA+  HVD  LP PDN+SA
Sbjct  173  YYSSAWRRDVAFTWQGGFVLDGGVHFVAGLRLITGCEVTQVSAIARHVDPLLPSPDNVSA  232

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            L                      +WRV+G  GT+E  R  KDG HGY V+ Y   G + S
Sbjct  233  L----------------------LWRVLGSKGTVEAVRDQKDGSHGYLVTFYPLGGTVLS  270

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
             F+PF GV+ ELK F+ D+S    +  E   + R +F+E   D+AV+EAML+S   +G  
Sbjct  271  KFFPFSGVENELKAFVGDVSQIVYEVNES-ADKRSNFIEAYHDVAVIEAMLKSSNNKGFP  329

Query  138  VQVKKF  121
            V V ++
Sbjct  330  VHVDRY  335



>ref|XP_001754780.1| predicted protein [Physcomitrella patens]
 gb|EDQ80234.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 109/181 (60%), Gaps = 23/181 (13%)
 Frame = -2

Query  651  WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  472
            WRR    GF+LD GVH++AGLRM VGCE+ SVSA  SH D+T PPPDN+SA  QL NG +
Sbjct  183  WRR----GFMLDGGVHFIAGLRMFVGCEIASVSATVSHFDQTQPPPDNLSASIQLWNGSA  238

Query  471  GVFAMVVSSRSPKI----------VWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  322
            GV  +  S+ + KI          +WRVVG  GT+E ER  K+G+ GY  +     G I+
Sbjct  239  GVVNICYSATTRKIQLIPGLHLQMMWRVVGSLGTVEAERVVKNGQQGYKATCQNASGDIQ  298

Query  321  SFFYPFCGVQEELKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKRE  148
              F PF GV EEL+ F  D+S       +C  + + R S +E  RD+AV+EAML S   +
Sbjct  299  ETFSPFAGVYEELQAFAEDVS-------KCVVQADRRSSVLEAMRDVAVIEAMLNSSDNK  351

Query  147  G  145
            G
Sbjct  352  G  352



>ref|XP_004142242.1| PREDICTED: uncharacterized LOC101204258 [Cucumis sativus]
Length=220

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = -2

Query  474  SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  295
            SGVF MVVSS+SPKI WRVVGL GTL++ERGN+DGKHGY VS     G  +  FYPF GV
Sbjct  106  SGVFVMVVSSKSPKIFWRVVGLKGTLQIERGNQDGKHGYLVSFTDASGLNRCTFYPFSGV  165

Query  294  QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  121
             EELKTF+  IS    +G + K + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  166  TEELKTFIHAIS---AEGSDDKADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  220



>ref|XP_006445973.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59213.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=268

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM+ GCEV SVSA+TSH+DKT
Sbjct  162  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMITGCEVVSVSAITSHIDKT  221

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPK  433
            LPPPDNIS+ FQLENGCSGVF MVVSSRSPK
Sbjct  222  LPPPDNISSNFQLENGCSGVFVMVVSSRSPK  252


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK+IAEIGDMM+VQVI+EG+MNSSNP F
Sbjct  145  FVECKKLIAEIGDMMSVQVIVEGSMNSSNPYF  176



>ref|XP_002973823.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
 ref|XP_002983567.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ15468.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ24778.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
Length=341

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 107/168 (64%), Gaps = 7/168 (4%)
 Frame = -2

Query  663  FSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  484
            FSS WRR   GG+I+D  VH +AGLR++ G E+ SVSA++ HVD  LP PDN+SAL +LE
Sbjct  174  FSSVWRRQLQGGYIMDSAVHQIAGLRLITGFEIRSVSAISRHVDNALPSPDNVSALIELE  233

Query  483  NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  304
            NGC G   +  S  + K+ W+VVG  GT+ V++  KD + G+ V+     G+  S FYP 
Sbjct  234  NGCVGTLMISFSCITKKMSWKVVGTEGTIYVDQDVKDDQPGFLVTCSTSTGK-NSVFYPC  292

Query  303  CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
            CGV+EEL  F++DI++          + R S  E   D+AV+EA+L+S
Sbjct  293  CGVEEELGAFINDITMGGVP------DKRSSPSEAYADVAVIEAILKS  334



>gb|KCW51233.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=270

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+TSVSA T+HVD T
Sbjct  164  QVIVEGSMNSSNPYFSSSWRRNFAGGFILDMGVHFIAGLRMLVGCEITSVSATTTHVDLT  223

Query  525  LPPPDNISALFQLENGCSGVFAMVVSSRSPK  433
            LPPPDN+S+ FQLENGCSGVF M+VSS+SPK
Sbjct  224  LPPPDNLSSSFQLENGCSGVFVMIVSSKSPK  254


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK++A+IGDMMNVQVI+EG+MNSSNP F
Sbjct  147  FVECKKLLADIGDMMNVQVIVEGSMNSSNPYF  178



>ref|XP_001776337.1| predicted protein [Physcomitrella patens]
 gb|EDQ58836.1| predicted protein [Physcomitrella patens]
Length=366

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 112/189 (59%), Gaps = 15/189 (8%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF   WRR+    GGFILD GVH+VAGLR++ GC++  V+A+ +H D ++P PD ++ L 
Sbjct  180  YFGCEWRRDPALKGGFILDCGVHFVAGLRVMTGCDIKLVTAIATHRDPSVPAPDTLTTLI  239

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG-NKDGKHGYSVSLY--MGDGQIK  322
            + +NGCSG   +  ++   K  WRVV   GT+ VERG   DG+ GY + +   +GD  ++
Sbjct  240  KFDNGCSGAMVISYAASVSKACWRVVCSKGTVIVERGVGDDGRFGYQLKMQPRVGDSSLQ  299

Query  321  SFFYPFCGVQEELKTFLSDISLANTKGG----ECKGEPRLSFVEGTRDIAVLEAMLESGK  154
              FYP  G++ E K+F++D+  A    G      +G PR    E  +D+A++EA L SG 
Sbjct  300  --FYPLSGLELEWKSFIADVQKAIDHTGYGSVNTRGSPR----EALKDLAIVEAALASGL  353

Query  153  REGALVQVK  127
               A + +K
Sbjct  354  HADAPMSIK  362



>dbj|BAB02487.1| unnamed protein product [Arabidopsis thaliana]
Length=316

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 106/196 (54%), Gaps = 46/196 (23%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +L+++G   +   YFSSSWRRN                       +V S+  ++S  D  
Sbjct  166  QLIIEGSMNSSNPYFSSSWRRNL---------------------SDVCSI--VSSRTD--  200

Query  525  LPPPDNISAL-FQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVS  349
                    AL F L     G+   V       I+WR+VGL GT+++ERG + G+HGY  +
Sbjct  201  --------ALGFLLWLCLQGLQRHV-------ILWRIVGLKGTVQLERGVEGGRHGYMAT  245

Query  348  LYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAM  169
            +Y   G  ++ FYPF GV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAM
Sbjct  246  IYGEGGTSRTIFYPFSGVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAM  300

Query  168  LESGKREGALVQVKKF  121
            LESG + GA+V V KF
Sbjct  301  LESGAKNGAVVPVNKF  316


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F E KK+IAEIGDMMNVQ+IIEG+MNSSNP F
Sbjct  149  FVELKKLIAEIGDMMNVQLIIEGSMNSSNPYF  180



>gb|KEH18356.1| NAD(P)-binding rossmann-fold protein, putative [Medicago truncatula]
Length=114

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -2

Query  411  LNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC  232
            +NGTL++ER  + G+HGY +SLY   G+ KS F+PF GV EELK F +D+S  NT   + 
Sbjct  1    MNGTLQIERRFQ-GQHGYLISLYDAHGECKSSFFPFSGVTEELKAFFNDVS-ENTLKKDS  58

Query  231  KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  121
            + E  LSFVEG RD+A+LEAMLESG ++G LV VKKF
Sbjct  59   QPEHCLSFVEGARDVALLEAMLESGSKQGELVHVKKF  95



>gb|KEH18355.1| NAD(P)-binding rossmann-fold protein, putative [Medicago truncatula]
Length=125

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -2

Query  411  LNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC  232
            +NGTL++ER  + G+HGY +SLY   G+ KS F+PF GV EELK F +D+S  NT   + 
Sbjct  1    MNGTLQIERRFQ-GQHGYLISLYDAHGECKSSFFPFSGVTEELKAFFNDVS-ENTLKKDS  58

Query  231  KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  121
            + E  LSFVEG RD+A+LEAMLESG ++G LV VKKF
Sbjct  59   QPEHCLSFVEGARDVALLEAMLESGSKQGELVHVKKF  95



>emb|CDY27562.1| BnaC01g32450D [Brassica napus]
Length=180

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = -2

Query  429  VWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLAN  250
            +  +  +  ++++ERG KDG+HGY  ++Y   G  ++ FYPF GV EELK F SDIS  +
Sbjct  82   IMEICRIKRSVQLERGVKDGRHGYMATVYGEGGTSRTIFYPFSGVTEELKAFFSDISETS  141

Query  249  TKGGECKGEP-RLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  121
                  + EP RLS VEGTRD+AVL AMLESG R GA+V V KF
Sbjct  142  K-----EQEPRRLSCVEGTRDVAVLGAMLESGARNGAVVPVAKF  180



>ref|XP_001942427.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU47289.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=349

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 100/191 (52%), Gaps = 26/191 (14%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDN  508
            + YF ++WR+   + GG +LD GVH+VAG+R+++G    ++   SA T+ + + L P D 
Sbjct  175  SKYFETAWRKKPEYQGGLLLDGGVHFVAGIRLILGGSGVKIVKTSAFTTRLQEHLSPVDT  234

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYM  340
            + A  QL NG SG  ++   ++     +      GT+ V R      +DG+HG       
Sbjct  235  VDATMQLSNGASGTASISFGTQFSGSEYAFACEKGTVVVTRAKVAVKRDGEHG-------  287

Query  339  GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
               ++K F     GV+ E+  +   +        E K +PR S  EG RD+ VLEAML S
Sbjct  288  ---EVKEFKDEGSGVKPEVAAWGKGLQ-------EGKMDPRQSAEEGLRDLEVLEAMLTS  337

Query  159  GKREGALVQVK  127
            G++ GA V++K
Sbjct  338  GEKGGAPVELK  348



>gb|ACU17312.1| unknown [Glycine max]
Length=225

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  526
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD T
Sbjct  166  QVIIEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLT  225


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  751  ECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            ECKK+IA IG MM+VQVIIEG+MNSSNP F
Sbjct  151  ECKKLIAGIGKMMSVQVIIEGSMNSSNPYF  180



>gb|KEQ84242.1| NAD(P)-binding protein [Aureobasidium pullulans EXF-150]
Length=346

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 99/186 (53%), Gaps = 22/186 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            Y+ + WR+   + GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A
Sbjct  175  YYETEWRKTPEYQGGFLLDGGVHFIAAMRQLLGQEAKMSQVAAFTAQLQPHLPPIDTINA  234

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--I  325
              +L NG SG F++   +      + V   NGT++V         G+  ++   DG    
Sbjct  235  TVKLANGTSGTFSVSFGTTFSGAEYIVACQNGTVDV---------GFDKTIVKKDGNEST  285

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
            K F     GV++ELK +   I+       + K  P  +  E   D+ VLEAM++SG+ +G
Sbjct  286  KDFTEDKNGVRQELKAWGESIA-------QGKAHPLQTPEEALADLEVLEAMIKSGEADG  338

Query  144  ALVQVK  127
              +++K
Sbjct  339  KAIELK  344



>gb|EMD87949.1| hypothetical protein COCHEDRAFT_1183091 [Bipolaris maydis C5]
 gb|ENI03464.1| hypothetical protein COCC4DRAFT_82671 [Bipolaris maydis ATCC 
48331]
Length=343

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 101/192 (53%), Gaps = 26/192 (14%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDN  508
            + Y+ ++WR+     GGF+LD GVH+VA  R+L+   G +V  VSA T+ + + LPP D 
Sbjct  168  SKYYETAWRKKPEHQGGFVLDGGVHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDT  227

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYM  340
            ++A+ QLENG SG  ++ V S      + V    G + V RG     + GK         
Sbjct  228  LNAVLQLENGSSGTLSISVGSTDQGAEYVVACEKGVVTVSRGKVVIKRQGK---------  278

Query  339  GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
             D + K F     GV++E+K +    SL + K  E +     S  E  +D+ +LE+ L+S
Sbjct  279  -DDEAKEFPDEGNGVKQEIKAWAK--SLEDGKRNEMQ-----SPEEALKDLEILESCLKS  330

Query  159  GKREGALVQVKK  124
            G++ G  + VK+
Sbjct  331  GEQAGTPIDVKQ  342



>ref|XP_007713573.1| hypothetical protein COCCADRAFT_99511 [Bipolaris zeicola 26-R-13]
 gb|EUC32122.1| hypothetical protein COCCADRAFT_99511 [Bipolaris zeicola 26-R-13]
Length=343

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 100/192 (52%), Gaps = 25/192 (13%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDN  508
            + Y+ + WR+     GGF+LD G+H+VA  R+L+   G +V  VSA T+ + + LPP D 
Sbjct  168  SKYYETEWRKKPEHQGGFVLDGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPLDT  227

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYM  340
            ++A+ QLENGCSG  ++ V +      + V    G + V RG     + G+         
Sbjct  228  LNAVLQLENGCSGTLSISVGTTDKGSEYVVACEKGVVTVSRGKVVVKRQGEE--------  279

Query  339  GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
             + Q K F     GV++E+K +    SL   K  E +     S  E  +D+ +LE+ L+S
Sbjct  280  -EEQTKEFPDEGNGVKQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKS  331

Query  159  GKREGALVQVKK  124
            G++ G  + VK+
Sbjct  332  GEQSGTPIDVKQ  343



>gb|KEQ61018.1| oxidoreductase-like protein family [Aureobasidium melanogenum 
CBS 110374]
Length=346

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 100/186 (54%), Gaps = 22/186 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            Y+ + WR+   + GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A
Sbjct  175  YYETEWRKKPEYQGGFLLDGGVHFIAAMRQLLGQEAKMSQVAAFTAQLQPHLPPIDTINA  234

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              +L NG SG F++   +      + V    GT++V         G+  ++   DG+  S
Sbjct  235  TVKLANGRSGTFSVSFGTTFSGAEYVVACQKGTVDV---------GFDKTIVKKDGKESS  285

Query  318  FFYP--FCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
              +P    GV++ELK +   IS         K +P  +  E   D+ VLE+M++SG+ +G
Sbjct  286  KDFPEDKNGVRQELKAWGESIS-------RGKADPLQTPQEALADLEVLESMIKSGEADG  338

Query  144  ALVQVK  127
              +++K
Sbjct  339  KAIELK  344



>gb|KEQ74017.1| NAD(P)-binding protein [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=347

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 97/184 (53%), Gaps = 18/184 (10%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISA  499
            Y+ + WR+   + GGF+LD GVH++A +R L+G   ++T V+A T+ +   LPP D I+A
Sbjct  175  YYETEWRKTPEYQGGFLLDGGVHFIAAMRQLLGQSAKMTHVAAFTAQLQPHLPPLDTINA  234

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              +L NG SG F++   +      + V   NGT++V       K G        D   K 
Sbjct  235  TVKLANGRSGTFSVSFGTTFSGAEYVVACQNGTVDVGFDKTIVKKG-------KDESSKD  287

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
            F     GV++ELK +   I     KG   K +P  S  E   D+ VLE+M++SG+ +G  
Sbjct  288  FLEDKNGVRQELKAWGESIQ----KG---KADPMQSPEEALADLEVLESMIKSGEADGKA  340

Query  138  VQVK  127
            +++K
Sbjct  341  IELK  344



>ref|XP_007785079.1| hypothetical protein W97_09025 [Coniosporium apollinis CBS 100218]
 gb|EON69762.1| hypothetical protein W97_09025 [Coniosporium apollinis CBS 100218]
Length=342

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 98/190 (52%), Gaps = 26/190 (14%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNI  505
            T YF ++WR+   + GGF+LD GVH++AG R+L+  E   T VSA T+ + + LPP D +
Sbjct  170  TKYFETAWRKTPEYQGGFLLDGGVHFIAGTRLLLQPENAPTRVSAFTARLQEHLPPVDTV  229

Query  504  SALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYMG  337
             A ++ ++G SG F++   +      + +    GT+ V R      KDGK          
Sbjct  230  DATWKTKSGVSGTFSVSFGTTFSGSEYTLACEKGTVTVLRSMVKIVKDGKE---------  280

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
              + K F     GV++E+K +   I   N        +PR +  E  +D+ VLEAML+SG
Sbjct  281  --ETKEFSGEGAGVKQEVKAWGEGIESGNQ-------DPRQTPEEALKDLEVLEAMLQSG  331

Query  156  KREGALVQVK  127
            +  G  + +K
Sbjct  332  EGNGVPIDLK  341



>ref|XP_007699535.1| hypothetical protein COCSADRAFT_89105 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD65015.1| hypothetical protein COCSADRAFT_89105 [Bipolaris sorokiniana 
ND90Pr]
Length=342

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 99/188 (53%), Gaps = 18/188 (10%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDN  508
            + Y+ ++WR+     GGF+LD GVH+VA  R+L+   G +V  VSA T+ + + LPP D 
Sbjct  168  SKYYETAWRKKPEHQGGFVLDGGVHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDT  227

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ  328
            ++A+ QLENG SG  ++ V +      + V    G + V RG         V     +G+
Sbjct  228  LNAVLQLENGSSGTLSISVGTTDQGSEYVVACEKGVVTVSRGK------VVVKRQGEEGE  281

Query  327  IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKRE  148
             K F     GV++E+K +    SL   K  E +     S  E  +D+ +LE+ L+SG++ 
Sbjct  282  TKEFPDEGNGVKQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQG  334

Query  147  GALVQVKK  124
            G  + V++
Sbjct  335  GTPIDVEQ  342



>gb|EUN24448.1| hypothetical protein COCVIDRAFT_106168 [Bipolaris victoriae FI3]
Length=343

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 99/192 (52%), Gaps = 25/192 (13%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDN  508
            + Y+ + WR+     GGF+LD G+H+VA  R+L+   G +V  VSA T+ + + LPP D 
Sbjct  168  SKYYETEWRKKPEHQGGFVLDGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPLDT  227

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYM  340
            ++A+ QLENG SG  ++ V +      + V    G + V RG     + G+         
Sbjct  228  LNAVLQLENGSSGTLSISVGTTDKGSEYVVACEKGVVTVSRGKVVVKRQGEE--------  279

Query  339  GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
             + Q K F     GV++E+K +    SL   K  E +     S  E  +D+ +LE+ L+S
Sbjct  280  -EEQTKEFPDEGNGVKQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKS  331

Query  159  GKREGALVQVKK  124
            G++ G  + VK+
Sbjct  332  GEQSGTPIDVKQ  343



>gb|KDQ06959.1| hypothetical protein BOTBODRAFT_60302 [Botryobasidium botryosum 
FD-172 SS1]
Length=354

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 96/189 (51%), Gaps = 22/189 (12%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ + WR    + GGF+LD GVH+ A LR ++   +T VSA  S     L P D I+A
Sbjct  180  SKWYQTPWRTKPEYQGGFLLDGGVHFTALLRTILPSPITEVSAFASLNKAILAPHDTINA  239

Query  498  LFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  331
            + +  +G  G+    F    S+R       + G  G +++    KDGK    V ++ GD 
Sbjct  240  ILRCADGTHGIWELSFGSPSSTRGALNATSITGTEGWIQIGNTQKDGKTHIKVDVHKGD-  298

Query  330  QIKSFFYPFCGVQEELKTFLSDISLANTKGG--ECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + K+   P CGV++EL+ FL  +      GG  E  GEPR       +D+A +EA L S 
Sbjct  299  ETKTTVLPSCGVEKELEHFLELL------GGRDEGFGEPRSVL----KDVAFIEAALNS-  347

Query  156  KREGALVQV  130
              EG L+++
Sbjct  348  --EGNLIKL  354



>gb|KEQ94380.1| hypothetical protein AUEXF2481DRAFT_270651 [Aureobasidium subglaciale 
EXF-2481]
Length=346

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 97/183 (53%), Gaps = 22/183 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            Y+ + WR+   + GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A
Sbjct  175  YYETEWRKTPEYQGGFLLDGGVHFIAAMRQLLGEEARMSQVAAFTAQLQPHLPPIDTINA  234

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLY-MGDGQI-  325
              +L NG SG F++   +      + V   +GT++V         G+  ++   GD +I 
Sbjct  235  TVKLTNGRSGTFSVSFGTTFSGAEYIVACQDGTVDV---------GFDKTIVKKGDNEIT  285

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
            K F     GV++ELK +   IS         K +P  S  E   D+ VLE+M++SG+  G
Sbjct  286  KEFPEDKNGVRQELKAWGESIS-------RGKADPLQSPEEALADLEVLESMIKSGEANG  338

Query  144  ALV  136
              +
Sbjct  339  KAI  341



>ref|XP_003300258.1| hypothetical protein PTT_11448 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91648.1| hypothetical protein PTT_11448 [Pyrenophora teres f. teres 0-1]
Length=342

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 95/192 (49%), Gaps = 26/192 (14%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDN  508
            + Y+ + WR+     GGF+LD GVH+VA  R+L+   G ++T VSA T+ + + LPP D 
Sbjct  168  SKYYETEWRKKPEHQGGFLLDGGVHFVAATRLLLQGGGQKITKVSAFTAQLQEYLPPVDT  227

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYM  340
            ++A  QL+NG SG  ++   +      + V    G++ V RG     +DGK         
Sbjct  228  LNATMQLDNGASGTLSISFGTTDTGSEYLVACEKGSVHVSRGKVVVTRDGKK--------  279

Query  339  GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
               + K F     GV +E+K +   +   N    +       S  E  +D+ +LE  L+S
Sbjct  280  --AETKEFPDEGNGVNQEIKAWAKSLEEGNRNEMQ-------SPEEALKDLEILEVCLKS  330

Query  159  GKREGALVQVKK  124
            G++ G  + VK+
Sbjct  331  GEQGGKPIDVKQ  342



>ref|XP_007686203.1| hypothetical protein COCMIDRAFT_90481 [Bipolaris oryzae ATCC 
44560]
 gb|EUC47328.1| hypothetical protein COCMIDRAFT_90481 [Bipolaris oryzae ATCC 
44560]
Length=343

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 99/192 (52%), Gaps = 25/192 (13%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDN  508
            + Y+ ++WR+     GGFILD G+H+VA  R+L+   G +V  VSA T+ + + LPP D 
Sbjct  168  SKYYETAWRKKPEHQGGFILDGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDT  227

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYM  340
            ++A+ Q ENG SG  ++ V +      + V    G + V RG     + G+    V  + 
Sbjct  228  LNAVLQAENGSSGSLSISVGTTDQGSEYVVACEKGVVTVSRGKVVVKRQGEEKEEVKEFP  287

Query  339  GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
             +G          GV++E+K +    SL   K  E +     S  E  +D+ +LE+ L+S
Sbjct  288  DEGN---------GVKQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKS  331

Query  159  GKREGALVQVKK  124
            G++ G  + VK+
Sbjct  332  GEQGGTPIDVKQ  343



>gb|EFQ28397.1| oxidoreductase family protein [Colletotrichum graminicola M1.001]
Length=347

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 100/185 (54%), Gaps = 20/185 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISA  499
            Y  ++WR+  ++ GGF+LD GVH+ A LR+L+G E    SV+A +    + LPP D I+A
Sbjct  176  YIETTWRKKPDYQGGFLLDGGVHFAAALRLLLGKEAAADSVAAFSDLTQEHLPPIDTINA  235

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              +  +G +G FA+ V S      ++V G  G++ +         G+ +++ + DG+ ++
Sbjct  236  AIRTRSGATGSFAVSVGSSLSAFDFQVAGEKGSVTL--------SGHDLTVKLFDGEART  287

Query  318  F-FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
              F    GV+EE+K +   +          +  P  S  E   D+ +LE + +SG+++GA
Sbjct  288  IQFEQTSGVKEEVKAWAEGLVAG-------RPNPLQSPEEALADLELLEKIFKSGEKDGA  340

Query  141  LVQVK  127
            + +++
Sbjct  341  VQKLQ  345



>ref|XP_011399715.1| Uncharacterized protein F751_0699 [Auxenochlorella protothecoides]
 gb|KFM26767.1| Uncharacterized protein F751_0699 [Auxenochlorella protothecoides]
Length=375

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 100/206 (49%), Gaps = 23/206 (11%)
 Frame = -2

Query  672  TXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGC----EVTSVSAMTSHVDKTLPPPDNI  505
            + Y++S+WRR   G F+L+ GVH+VA LR++       E   VSA+ +   + +P PD +
Sbjct  170  SRYYASAWRRQLPGSFLLEGGVHFVAALRLVCAAAGAGEPGRVSALLTRGSEGVPGPDTL  229

Query  504  SALFQLENGCSGVFAMVVSSRSPKI--------VWRVVGL--NGTLEVERGNKDGKHGYS  355
                + + G     ++  +   P++        VW VV +   GT+E +RG         
Sbjct  230  VGWARFDGGVPAGVSITQAGAIPRLCVTLVGTQVWMVVWIARGGTIEAKRGQWGAWTAAP  289

Query  354  VSLYM------GD--GQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEG  199
             + Y       GD    +     PF GV  ++  F++  + A   G + + +  LS  E 
Sbjct  290  ANSYTLHAESSGDVPASVDQRVLPFDGVGTQVGAFVAHAA-ALRDGRDAELDASLSVQEA  348

Query  198  TRDIAVLEAMLESGKREGALVQVKKF  121
             RD+A++EA+L SG+R+G  V V++ 
Sbjct  349  ARDLALMEALLRSGERQGEAVDVERL  374



>gb|KIO22407.1| hypothetical protein M407DRAFT_118073 [Tulasnella calospora MUT 
4182]
Length=372

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 103/194 (53%), Gaps = 18/194 (9%)
 Frame = -2

Query  675  QTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
            ++ ++ +SWR   ++ GGF+LD GVH +A LR ++   V S+S   S     L P D+I 
Sbjct  184  ESKWYQTSWRTVPDYQGGFLLDGGVHSMAVLRTILPSPVVSLSGHASLTKPYLLPHDSIQ  243

Query  501  ALFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERG-NKDGKHGYSVSLYMG  337
            ++  L++G  G+    FA   S+R   +   + G  G LE+  G N+ G  G+++   +G
Sbjct  244  SVLALDSGAHGILELSFAAPSSARGESLT-VITGTEGFLELTSGKNETGVQGWTIKTVVG  302

Query  336  --DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLE  163
              D + +  FY   G+  E++ F+  + L   +     GEPR +     RD+A+++A L 
Sbjct  303  TKDPKEEKQFYKGQGIDNEIEWFVQAV-LKGEQNSVSVGEPRGAI----RDVALIQAALT  357

Query  162  SGKREGALVQVKKF  121
            SG   GALV +KK 
Sbjct  358  SG---GALVDIKKL  368



>ref|XP_008025728.1| hypothetical protein SETTUDRAFT_135946 [Setosphaeria turcica 
Et28A]
 gb|EOA87278.1| hypothetical protein SETTUDRAFT_135946 [Setosphaeria turcica 
Et28A]
Length=346

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 98/196 (50%), Gaps = 27/196 (14%)
 Frame = -2

Query  678  AQTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV----GCEVTSVSAMTSHVDKTLPP  517
            A + Y+ +SWR+   + GGF+LD G+H+VA  R+L+    G ++T  +A T+ +   LPP
Sbjct  167  AGSKYYETSWRQKPEYQGGFVLDGGIHFVAATRLLLHGAGGRKITKAAAFTAQLQPHLPP  226

Query  516  PDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKH-GYSV  352
             D ++A  QL+NG SG F++   +      + V    GT+ V RG     + G+      
Sbjct  227  VDTLNATLQLDNGASGTFSVSFGTSDSASEYLVACERGTVHVSRGKVVVRRQGREDAEET  286

Query  351  SLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEA  172
              + G+G          GV+ E+K +   +         C  E + S  E   D+ VLEA
Sbjct  287  REFPGEGN---------GVKSEIKAWAQSLEQG------CPNEMQ-SPQEALSDLQVLEA  330

Query  171  MLESGKREGALVQVKK  124
             L+SG + G  V+V++
Sbjct  331  CLKSGGQGGTPVEVQQ  346



>emb|CCF43203.1| oxidoreductase [Colletotrichum higginsianum]
Length=348

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 94/184 (51%), Gaps = 18/184 (10%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISA  499
            Y  ++WR+  ++ GGF+LD GVH+ A LR+L+G E    SV+A +    K LPP D I+A
Sbjct  176  YIETAWRKKPDYQGGFLLDGGVHFAAALRLLLGKEAAPDSVAAFSDLTQKHLPPIDTINA  235

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +  +G +G FA+ V S      + V G  G++ +        H  +V  + G+ +   
Sbjct  236  IVRTRSGATGSFAVSVGSPLSAFDFHVAGEKGSVTL------SSHDLTVKPFDGEARTAQ  289

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
             F    GV+EE+K +   +          K  P  S  E   D+  LE + +SG+++GA 
Sbjct  290  -FEQTSGVKEEVKAWAEGLVAG-------KPNPLQSPEEALADLEFLEKIFKSGEQDGAT  341

Query  138  VQVK  127
             +++
Sbjct  342  QKLQ  345



>ref|XP_001935897.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU48484.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=342

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 95/192 (49%), Gaps = 26/192 (14%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDN  508
            + Y+ + WR+     GGF+LD GVH+VA  R+L+   G ++  VSA T+ + + LPP D 
Sbjct  168  SKYYETEWRKKPEHQGGFLLDGGVHFVAATRLLLQGGGQKINKVSAFTAQLQEYLPPVDT  227

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYM  340
            ++A  QL NG SG  ++   +      + V    G++ V RG     +DGK         
Sbjct  228  LNATMQLGNGASGTLSISFGTTDTGSEYLVACEKGSVHVSRGKVIVTRDGK---------  278

Query  339  GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
             + + K F     GV +E+K +    SL   K  E +     S  E  +D+ +LE  L S
Sbjct  279  -EAETKEFPDEGNGVNQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILEVCLMS  330

Query  159  GKREGALVQVKK  124
            G++ G  + VK+
Sbjct  331  GEQGGKPIDVKQ  342



>gb|EPS29944.1| hypothetical protein PDE_04894 [Penicillium oxalicum 114-2]
Length=349

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 91/180 (51%), Gaps = 21/180 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISA  499
            ++++ WR+     GGFILD GVH+ AGLR L+G +V  T VSA T+ +   LPP D ++A
Sbjct  172  FYNTDWRKVPTHQGGFILDGGVHFTAGLRYLLGSDVHITQVSAFTTLIKDYLPPVDTVNA  231

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--I  325
            + +   G  G   + + +  P   W V   NG++ V  G+       SV++ M DGQ  +
Sbjct  232  ILKANTGAQGTLQVSMGTHGPAPEWTVGCENGSVSV--GDS------SVTVRMADGQEHV  283

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                    GV  E++ +   ++     GG  K  P  S  +   D+ ++E ML SG+  G
Sbjct  284  DKIENERSGVPPEVRLWAKALA-----GG--KVNPEQSPSQALADLELIELMLRSGENNG  336



>gb|KIH88824.1| hypothetical protein SPBR_07486 [Sporothrix brasiliensis 5110]
Length=343

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 90/176 (51%), Gaps = 17/176 (10%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            Y+ + WR+   + GGF+LD GVH  A LR + G EV         V   LPP D ++A  
Sbjct  177  YYETPWRKVPAYQGGFLLDGGVHQTAMLRYIAGQEVVETHGYARQVAPHLPPLDTVNAGL  236

Query  492  QLENGCSGVFAMVVSS--RSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
             L  G +G  +M  +S  R+ ++V  ++G  G+  +     DG  GY ++L +  G+ ++
Sbjct  237  VLSGGATGTLSMSFASPRRATELV--ILGTQGSFHL----TDGPDGYVLTLELLSGERRT  290

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  151
                  GV+ E+K FL  I+     GG  K +PR    E   D+A++E++ + G +
Sbjct  291  ETIKSRGVELEVKAFLEAIA-----GG--KAQPRAGPEEALNDLAIIESLCQGGGK  339



>ref|XP_007603283.1| oxidoreductase [Colletotrichum fioriniae PJ7]
 gb|EXF73078.1| oxidoreductase [Colletotrichum fioriniae PJ7]
Length=348

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 96/183 (52%), Gaps = 18/183 (10%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISA  499
            Y  ++WR+  ++ GGF+LD GVH+ A LR+L+G +    SV+A +    + LPP D I+A
Sbjct  176  YIETAWRKKPDYQGGFLLDGGVHFAAALRLLLGKDAAPASVAAFSDLTREHLPPIDTINA  235

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + + + G +G FA+ V S      + V G NG++ +        H  +V  + G+    +
Sbjct  236  VVKTKQGATGSFAVSVGSTLSAFDFHVAGENGSVTL------SSHDLTVKPFDGEATT-T  288

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
             F    GV+EE+K +   + +A T        P  S  E   D+  LE +  SG+++GA+
Sbjct  289  HFEQTSGVKEEVKAWAEGL-VAGTPN------PLQSAEEALADLEFLEKIFTSGEQDGAI  341

Query  138  VQV  130
             ++
Sbjct  342  QKL  344



>ref|XP_007588173.1| putative oxidoreductase nad-binding rossmann fold protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD44322.1| putative oxidoreductase nad-binding rossmann fold protein [Neofusicoccum 
parvum UCRNP2]
Length=330

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 97/186 (52%), Gaps = 15/186 (8%)
 Frame = -2

Query  663  FSSSWRR--NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISAL  496
             ++SWR   ++ GGF+LD GVH++A  R+L+      TSVSA T+   + LPP D + A+
Sbjct  152  LATSWRTKPSYQGGFLLDGGVHFIAATRVLLSDSAHATSVSAFTALHQEHLPPVDTVDAI  211

Query  495  FQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG---QI  325
            ++L NG SG F+   ++  P   +RVV   GT+    G       Y V++   D    + 
Sbjct  212  WKLSNGSSGTFSNSFAAPVPVTEYRVVCERGTVTTGFGTVPFAPAY-VAVKRADADDEEK  270

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
            K F     GV  E+  +   +     KGG    + R    E  +D+ +LEAML+SG++ G
Sbjct  271  KEFPEVGFGVNPEVAAWGQKLE----KGG---FDERQLPEEALKDLEILEAMLKSGEQGG  323

Query  144  ALVQVK  127
            A V ++
Sbjct  324  APVTLQ  329



>gb|ENH79899.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
orbiculare MAFF 240422]
Length=349

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 95/184 (52%), Gaps = 18/184 (10%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISA  499
            Y  + WR+   + GGF+LD GVH+ A LR+L+G +    SVSA ++     LPP D ++A
Sbjct  177  YIETEWRKKPAYQGGFLLDGGVHFAAALRLLLGSDAAPLSVSAFSALTRDHLPPIDTVNA  236

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + + ++G  G FA+ V S      ++V   NG++ V        H  +V  + G+ +   
Sbjct  237  VVKTKSGAIGSFAVSVGSTLNAFDFQVACENGSVTV------SSHELTVKPFEGEARTVR  290

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
             F    GV+EE+K +   ++         K  P  S  E   D+  LE + +SG+++GAL
Sbjct  291  -FEETNGVKEEVKAWAEALAAG-------KPNPLQSPEEALADLEFLEKIFQSGEQDGAL  342

Query  138  VQVK  127
             +++
Sbjct  343  QKLE  346



>ref|XP_002183307.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45007.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=416

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 100/215 (47%), Gaps = 29/215 (13%)
 Frame = -2

Query  711  MSKLLLKGQ*IAQTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSH  538
            ++ L ++   +    + ++ WR+N  ++GG  +D  VH+ AGLR ++G EV +VSA+TS 
Sbjct  213  LASLQIRAPFLPDNQFLNTPWRKNASWYGGLFIDSFVHHAAGLRAVLG-EVETVSAVTSD  271

Query  537  VDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN-------  379
                LP  D ++A     +G  GV ++  + R  +  + + G  GT+ +ER         
Sbjct  272  RADYLPGVDTLAAQLTWSSGVQGVVSVTYAGRDLQYEFGITGTTGTVSLERAGLGHRLTV  331

Query  378  -------KDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGE-  223
                     G     V+         +  Y F GV+EE   F           G C+G+ 
Sbjct  332  VSSSHTASTGTDREKVATTDNTSTTTTTEYGFTGVEEEFLAF----------AGACRGQG  381

Query  222  -PRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  121
              R +  E  RD+A++E +L SG++ G  + V K+
Sbjct  382  SDRNTPREALRDLALVETLLASGQQNGRPLPVPKY  416



>gb|KIV83264.1| hypothetical protein PV11_05309 [Exophiala sideris]
Length=343

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 80/172 (47%), Gaps = 13/172 (8%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            Y+ + WR+   + GGF+LD GVH  A LR + G EV         V   LPP D ++A  
Sbjct  177  YYETEWRKVPEYQGGFLLDGGVHQTAMLRWISGQEVVETRGFARQVAHHLPPLDTVNAGI  236

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  313
             L  G +G  +M  +S        ++G  G+  +     DG  GY V+L +  G+ ++  
Sbjct  237  LLSGGGTGTISMSFASAKRATELTIIGTKGSFFL----TDGPDGYIVTLELTSGEKRTET  292

Query  312  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
                GVQ E+K FL  I   N    + +  P     E   D+A++E++   G
Sbjct  293  LKTNGVQVEIKAFLEAIQAGN---AQARSGPE----EALNDLAIIESLCSGG  337



>ref|XP_007674297.1| hypothetical protein BAUCODRAFT_22896 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC98052.1| hypothetical protein BAUCODRAFT_22896 [Baudoinia compniacensis 
UAMH 10762]
Length=353

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 94/186 (51%), Gaps = 21/186 (11%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            Y  + WR+   + GGF+LD GVH++AG+R+L+G E  V   S  T+ +   L P D + A
Sbjct  181  YLETEWRKKPEYQGGFLLDGGVHFMAGMRLLLGEEAKVVKASGFTTQLQPYLLPIDTVDA  240

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            +F+L NG +G F+    +      W V   NG++ V         G  V++   DG  + 
Sbjct  241  VFKLANGSTGNFSASFGTTFKGGEWSVACENGSVTV--------SGQKVTINPKDGDEEV  292

Query  318  FFYP--FCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
               P    GV++E+  F    SL +      K EPR    +   D+ VLEAML SG++ G
Sbjct  293  VEKPDEQGGVKQEV--FAWAESLVS-----GKQEPRQLPEQALADLEVLEAMLTSGEKGG  345

Query  144  ALVQVK  127
              +++K
Sbjct  346  QPIELK  351



>gb|KEZ45810.1| Oxidoreductase-like protein [Scedosporium apiospermum]
Length=347

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 93/186 (50%), Gaps = 24/186 (13%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRML---VGCEVTSVSAMTSHVDKTLPPPDNIS  502
            Y+++ WR+   + GGF+LD GVH+VAG+R     VG E+  +SA T+ +   LPP D + 
Sbjct  173  YYNTEWRKIPEYQGGFLLDGGVHFVAGIRHFLAAVGQEIKHLSAHTALIQAKLPPVDTVH  232

Query  501  ALFQLENGCSGVFAMVVSSR-SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG--  331
             L    +G SG F +   S         +V  NG + +  G        +V+   GDG  
Sbjct  233  GLLTTTSGRSGTFIVSFGSEFKSGFTIELVTTNGAVRLTPGV------VNVTRKAGDGER  286

Query  330  --QIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
              + K+F +   GV+ E+  F   I+         K + R +  E  +D+ +L+A+LESG
Sbjct  287  VEETKTFEFD-SGVKAEVAAFAQSINAG-------KVDARQTASEALKDLEILQALLESG  338

Query  156  KREGAL  139
            +  GA+
Sbjct  339  EDSGAI  344



>ref|XP_011117421.1| hypothetical protein AOL_s00004g470 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53811.1| hypothetical protein AOL_s00004g470 [Arthrobotrys oligospora 
ATCC 24927]
Length=366

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 96/182 (53%), Gaps = 21/182 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKTLPPPDNISAL  496
            YF ++WR+   + GGF LD GVH+ A LR LVG  ++ S+SA T+     LPP D I + 
Sbjct  173  YFETAWRKVPTYQGGFCLDAGVHFTAALRRLVGEDQIASLSAFTNLAQPHLPPIDTIMST  232

Query  495  FQLENGCSGVFAMVVSSRSPKIV-WRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDG  331
             +L++G  G FAM   + + K+  W +V   GT++V  G     K  +     + + GD 
Sbjct  233  IKLKSGVCGTFAMSHGTPATKVFEWFIVCEQGTVKVSDGPKVVVKQLEMPEEWTEFGGDR  292

Query  330  QIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  151
                    + GV++E++ F+   S+ N KG E      LS      D+ ++E M++SG++
Sbjct  293  N------EWSGVKKEVRVFVE--SVKNGKGVEG-----LSPENALADLEMIEKMIQSGEQ  339

Query  150  EG  145
             G
Sbjct  340  GG  341



>ref|XP_008085160.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis 
ATCC 20868]
 gb|EPE27801.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis 
ATCC 20868]
Length=346

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 98/189 (52%), Gaps = 20/189 (11%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNI  505
            + YF ++WR+   + GGF+LD GVH++A  R+L+G E   T+++A T+ + + LPP D +
Sbjct  168  SKYFETAWRKKPEYQGGFLLDGGVHFIAATRLLLGEEATPTALTAFTTLLQEHLPPVDTV  227

Query  504  SALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ-  328
            ++++Q + G SG F++   +      + +    G++ VE          +V L M   + 
Sbjct  228  NSVWQTKTGISGTFSVSFGTTLSGSEYVIACEKGSVAVEFSK------VTVRLGMEKDKK  281

Query  327  --IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGK  154
              +K F     GV++E+  +   +S      G+    P  +      D+ +LE ML+SG+
Sbjct  282  ETVKEFKEEGAGVKQEVAAWAKSLSEGTPNPGQA---PEQALA----DLEILEKMLKSGE  334

Query  153  REGALVQVK  127
             +GA   +K
Sbjct  335  NQGAAQSLK  343



>gb|KFY61799.1| hypothetical protein V496_04887 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY99520.1| hypothetical protein V498_00671 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=852

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 96/192 (50%), Gaps = 20/192 (10%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPD  511
            A T YF + WR+  ++ GGF+LD GVH+ A  R+L+G      S+SA T+ +   LPP D
Sbjct  671  AGTKYFETEWRKVPSYQGGFLLDGGVHFTAATRLLLGANYRPKSLSAYTALLQPHLPPVD  730

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  331
             +++++Q  NG SG   +   +      + +   NG++ V R     + G        DG
Sbjct  731  TVNSIWQTANGISGTVQISFGTSLSGDEYTIACYNGSVVVSRDTVSVRSGEE-----KDG  785

Query  330  QIKSFFYPF--CGVQEELKTFLSDISLANTKGGECKGEPRL-SFVEGTRDIAVLEAMLES  160
             + +   P    GV+ E+K +         +G E  GE  L S  E   D+ +LEAM++S
Sbjct  786  NVTTRVLPASGSGVKAEVKAW--------AEGIESGGENGLQSPAEALADLELLEAMIKS  837

Query  159  GKREGALVQVKK  124
            G+ EG  V + +
Sbjct  838  GEGEGVKVILTR  849



>gb|ERT02500.1| hypothetical protein HMPREF1624_00799 [Sporothrix schenckii ATCC 
58251]
Length=343

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 82/174 (47%), Gaps = 13/174 (7%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            Y+ + WR+   + GGF+LD GVH  A LR + G EV         V   LPP D ++A  
Sbjct  177  YYETPWRKVPAYQGGFLLDGGVHQTAMLRYISGQEVVETHGYARQVAPHLPPLDTVNAGL  236

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  313
             L  G +G  +M  +S        ++G  G+  +     DG  GY ++L +  G+ ++  
Sbjct  237  VLSGGATGTLSMSFASTRRATELVIIGTQGSFHL----TDGPDGYVLTLELLSGERRTET  292

Query  312  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  151
                GV+ E+K FL  I+         K + R    E   D+A++E++ + G +
Sbjct  293  IKSRGVELEVKAFLEAIA-------SGKAQSRAGPEEALNDLAIIESLCQGGGK  339



>gb|KFX44107.1| Uncharacterized protein GQ26_0300340 [Talaromyces marneffei PM1]
 gb|KFX46380.1| Uncharacterized protein GQ26_0191180 [Talaromyces marneffei PM1]
Length=182

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 88/180 (49%), Gaps = 21/180 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISA  499
            +F +SWR+N    GGF+LD GVHY A LR L+G +V  T ++A T+ + + LPP D + A
Sbjct  5    FFQTSWRKNPTHQGGFLLDGGVHYTAALRGLLGPDVHFTRLAAFTTLLKEHLPPVDTMDA  64

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--I  325
            + +   G  G F   V++      W +    GT+ V         G  V++   DG+  +
Sbjct  65   ILKTNTGIQGTFQSSVATTLTGPEWTIACEKGTVTVV--------GSDVTVRPVDGEELV  116

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
            ++      GV  E++ +   ++         +  P  +  E   D+ ++E ML SG+ EG
Sbjct  117  QTIADERTGVPPEIRAWGEALAAG-------RQNPEQTPEEALADLELIELMLRSGESEG  169



>gb|KFZ16228.1| hypothetical protein V501_02319 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=350

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 94/190 (49%), Gaps = 24/190 (13%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPD  511
            A T YF + WR+  ++ GGF+LD GVH+ AG R+L+G      S+SA T+ +   LPP D
Sbjct  169  AGTKYFETEWRKIPSYQGGFLLDGGVHFTAGTRLLLGSLNRPVSLSAYTALIQPHLPPID  228

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG--  337
             +++++Q   G SG   +   +      + +   +G++ V R         +VS++ G  
Sbjct  229  TVNSIWQTAKGISGTVQISFGTSLSGDEYTIACYDGSVSVSRD--------TVSVHTGEE  280

Query  336  -DGQI--KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
             DG +  +       GV+ E++ +   I          K  P  S  E   D+ +LEAM+
Sbjct  281  KDGNVTKRVLLSSGSGVKAEVQAWAEGIEAG-------KENPLQSPAEALADLELLEAMI  333

Query  165  ESGKREGALV  136
            +SG+ EG  V
Sbjct  334  KSGEGEGVKV  343



>gb|ERT03209.1| hypothetical protein HMPREF1624_01515 [Sporothrix schenckii ATCC 
58251]
Length=348

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 98/191 (51%), Gaps = 30/191 (16%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNIS  502
            Y++++WR+   + GGF+LD GVH+VAGLR L+   G EV  V++ +S ++K LPP D+I 
Sbjct  175  YYNTAWRKEPGYQGGFLLDGGVHFVAGLRFLLAAAGDEVARVASFSSLLEKRLPPVDSIH  234

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS------VSLYM  340
            A+     G +G  +M   +               LE+E    +G+  ++      VS+  
Sbjct  235  AVASTRGGVNGTISMSFGTE----------FKNVLEIEVVTTEGRVTWTWAPSSIVSVRR  284

Query  339  GDGQIKSFFY-PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLE  163
            G    K+  Y P  GV       +S+++         + +P+ S  E  +D+A+L+A+LE
Sbjct  285  GQTDPKTDTYEPDFGV-------VSEVAAFAASVAAGQADPQQSPQEALKDLALLQALLE  337

Query  162  SGKREGALVQV  130
            SG   GA+  V
Sbjct  338  SGP-TGAITNV  347



>dbj|GAM35894.1| oxidoreductase [Talaromyces cellulolyticus]
Length=349

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 86/178 (48%), Gaps = 17/178 (10%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            +F +SWR+N    GGF+LD GVHY A LR L+G +  VT ++A T+ + + LPP D + A
Sbjct  172  FFETSWRKNPTHQGGFLLDGGVHYTAALRGLLGSDVHVTRLAAFTTLLKEHLPPVDTMDA  231

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +   G  G F   V++      W +    GT+ V       K   +V    G+   K+
Sbjct  232  ILKTNTGIQGTFQSSVATTLTGPEWTIACEKGTVTV------AKSEVTVRPVDGEEVTKT  285

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                  GV  E++ +   ++         +  P  S  E   D+ +++ ML SG++EG
Sbjct  286  IPDERTGVPPEIRAWGEALAAG-------RQNPEQSPEEALADLELIQLMLRSGEKEG  336



>ref|XP_003840030.1| similar to oxidoreductase family [Leptosphaeria maculans JN3]
 emb|CBX96551.1| similar to oxidoreductase family [Leptosphaeria maculans JN3]
Length=342

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 94/183 (51%), Gaps = 27/183 (15%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNIS  502
            YF ++WR+   + GGF+LD GVH++A +R+++   G ++  VSA T+ + K LPP D ++
Sbjct  171  YFETAWRKVPEYQGGFLLDGGVHFIAAMRVMLQGGGEKIHGVSAFTAQLQKHLPPVDTLN  230

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYMGD  334
            +  +L +G SG  ++   +      + V    G++ V RG     K+GK           
Sbjct  231  STLKLGSGASGTLSVSFGTTDKGSEYMVACEKGSVHVSRGKVTVVKEGKE----------  280

Query  333  GQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGK  154
              +K F     GV++E+K +    SL   +  E +     S  E   D+ +LEA L SG+
Sbjct  281  -VVKEFGDEGNGVRQEIKAWSE--SLEKGQRNEAQ-----SPEEALSDLKILEACLRSGE  332

Query  153  REG  145
            ++G
Sbjct  333  QDG  335



>gb|KIH86578.1| hypothetical protein SPBR_08549 [Sporothrix brasiliensis 5110]
Length=369

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 98/192 (51%), Gaps = 30/192 (16%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNIS  502
            Y++++WR+   + GGF+LD GVH+VAGLR L+   G EV  V++ +S ++K LPP D+I 
Sbjct  196  YYNTAWRKEPGYQGGFLLDGGVHFVAGLRFLLAAAGDEVARVASFSSLLEKRLPPVDSIH  255

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS------VSLYM  340
            A+     G +G  +M   +               LE+E    +G+  ++      VS+  
Sbjct  256  AVASTHGGVNGTISMSFGTE----------FKNVLEIEVVTTEGRVTWTWAPSSIVSVRR  305

Query  339  GDGQIKSFFY-PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLE  163
            G    K+  Y P  GV       +S+++         + +P  S  E  +D+A+L+A+LE
Sbjct  306  GQADPKTDTYEPDFGV-------VSEVAAFAASVAAGQADPLQSPQEALKDLALLQALLE  358

Query  162  SGKREGALVQVK  127
            SG   GA+  V+
Sbjct  359  SGP-TGAITNVE  369



>ref|XP_006962588.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR51025.1| predicted protein [Trichoderma reesei QM6a]
Length=325

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 82/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            ++ + WR+   + GGF+LD GVH  A LR + G EV   +     V   LPP D ++A  
Sbjct  159  WYETPWRKVPEYQGGFLLDGGVHQTAMLRFISGQEVVETAGFARQVLPHLPPLDTLNAGI  218

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  313
             L  G +G  +M  +S        ++G  G+  +     DG  G ++SL +  G+ +S  
Sbjct  219  LLSGGGTGTISMSFASIRRATELTIIGSKGSFSL----TDGPDGSTLSLDLATGERRSET  274

Query  312  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
                GV+ E+K FL  I     K G  K E R    E   D+A++E+M   G
Sbjct  275  IRSKGVELEIKAFLEAI-----KAG--KSEKRAGPEEALNDLAIIESMCSGG  319



>ref|XP_007793174.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
 gb|EMR67736.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
Length=317

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 89/186 (48%), Gaps = 28/186 (15%)
 Frame = -2

Query  657  SSWRRN--FFGGFILDMGVHYVAGLRMLVGC----EVTSVSAMTSHVDKTLPPPDNISAL  496
            + WRR     GG++LD GVHYVAGLR+L+G     E+  ++A TS + + LPP D    +
Sbjct  145  TEWRRTPTHQGGYLLDGGVHYVAGLRLLIGTEPGNEIAKLAAFTSQIKEYLPPVDTADVI  204

Query  495  FQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQ  328
             Q ++G +G F +   +      W V   NG +++E      ++DGK             
Sbjct  205  LQTKSGITGTFQISRGTSLSADEWTVACENGWIKIENDKVTISRDGKE-----------D  253

Query  327  IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKRE  148
            +K+      GV  E++ +   +     +    + EP  +      D+ ++E ML SG++ 
Sbjct  254  VKTVANERSGVPPEVRAWGEALVAGKIR---PEQEPEAALA----DLEIIELMLRSGEQG  306

Query  147  GALVQV  130
            GA ++ 
Sbjct  307  GAPLET  312



>ref|XP_007275100.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
gloeosporioides Nara gc5]
 gb|ELA35828.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
gloeosporioides Nara gc5]
Length=349

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 99/185 (54%), Gaps = 20/185 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISA  499
            Y  ++WR+  ++ GGF+LD GVH+ A +R+L+G E    SV+A +      LPP D I+A
Sbjct  177  YIETAWRKKPDYQGGFLLDGGVHFAATVRLLLGTEAAPESVAAFSDLTRPHLPPIDTINA  236

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +  +G +G FA+ V S      + V   NG++ V         G+ + +   DG+ ++
Sbjct  237  VIKTRSGATGSFAVSVGSSLSAFDFEVACENGSVTV--------SGHELIVKPLDGEART  288

Query  318  F-FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
              F    GV+EE+K + +++ ++       K  P  S  E   D+  LE + +SG+++G 
Sbjct  289  TQFEQTTGVKEEVKAW-AEVLVSG------KPNPLQSTDEALADLEFLEKIFKSGEQDGT  341

Query  141  LVQVK  127
             ++++
Sbjct  342  RLKLE  346



>gb|KFY75511.1| hypothetical protein V499_04510 [Pseudogymnoascus pannorum VKM 
F-103]
Length=350

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 94/190 (49%), Gaps = 24/190 (13%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPD  511
            A T YF + WR+  ++ GGF+LD GVH+ AG R+L+G      S+SA T+ +   LPP D
Sbjct  169  AGTKYFETEWRKIPSYQGGFLLDGGVHFTAGTRLLLGSVNRPVSLSAYTALIQPHLPPID  228

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG--  337
             +++++Q   G SG   +   +      + +   +G++ V R         +VS++ G  
Sbjct  229  TVNSIWQTAKGISGTVQISFGTSLSGDEYTIACYDGSVSVSRD--------TVSVHTGEE  280

Query  336  -DGQI--KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
             DG +  +       GV+ E++ +   I          K  P  S  E   D+ +LEAM+
Sbjct  281  KDGNVTKRVLLSSGSGVKAEVQAWAEGIEAG-------KENPLQSPAEALADLELLEAMI  333

Query  165  ESGKREGALV  136
            +SG+ +G  V
Sbjct  334  KSGEGDGVKV  343



>gb|ETS04874.1| NAD-binding Rossmann fold oxidoreductase [Trichoderma reesei 
RUT C-30]
Length=343

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 82/172 (48%), Gaps = 13/172 (8%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            ++ + WR+   + GGF+LD GVH  A LR + G EV   +     V   LPP D ++A  
Sbjct  177  WYETPWRKVPEYQGGFLLDGGVHQTAMLRFISGQEVVETAGFARQVLPHLPPLDTLNAGI  236

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  313
             L  G +G  +M  +S        ++G  G+  +     DG  G ++SL +  G+ +S  
Sbjct  237  LLSGGGTGTISMSFASIRRATELTIIGSKGSFSL----TDGPDGSTLSLDLATGERRSET  292

Query  312  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
                GV+ E+K FL  I     K G  K E R    E   D+A++E+M   G
Sbjct  293  IRSKGVELEIKAFLEAI-----KAG--KSEKRAGPEEALNDLAIIESMCSGG  337



>ref|XP_007839104.1| hypothetical protein PFICI_12332 [Pestalotiopsis fici W106-1]
 gb|ETS75388.1| hypothetical protein PFICI_12332 [Pestalotiopsis fici W106-1]
Length=346

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 92/188 (49%), Gaps = 20/188 (11%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDN  508
            T Y  + WR+   F GGF+LD GVH +A LR+++   G +V  VSA T+ + + LPP D 
Sbjct  168  TKYIETPWRKTPEFSGGFLLDGGVHQIAALRLMLKGGGVKVQKVSAFTTQLREWLPPVDT  227

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ  328
            + A   L++G +G  +M   S        V    GT+ V+R      +G       G+ +
Sbjct  228  VDATLLLDSGATGFLSMSFGSSFDDAEIAVACERGTVSVDR------NGNVTVRAAGEKE  281

Query  327  IKSFFYPF--CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGK  154
              +   P    GV  E+  +   I     K G+   E   S  E   D+ +LEA+L+SG+
Sbjct  282  AATVHKPNEEGGVATEVWAWARSI-----KNGKPDAEQ--SPEEALADLEMLEALLKSGE  334

Query  153  REGALVQV  130
            + GA VQ+
Sbjct  335  QGGAPVQL  342



>gb|EQB57311.1| hypothetical protein CGLO_02580 [Colletotrichum gloeosporioides 
Cg-14]
Length=349

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 96/185 (52%), Gaps = 20/185 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISA  499
            Y  ++WR+  ++ GGF+LD GVH+ A +R+L+G E    SV+A +      LPP D I+A
Sbjct  177  YIETAWRKKPDYQGGFLLDGGVHFAATVRLLLGTEAAPESVAAFSDLTRPHLPPIDTINA  236

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +  +G +G FA+ V S      ++V   NG++ V         G+ + +   DG+ ++
Sbjct  237  VIKTRSGVTGSFAVSVGSSLSAFDFQVACENGSVTV--------SGHELIVKPLDGEART  288

Query  318  F-FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
              F    GV+EE+K +   +          K  P  +  E   D+  LE + +SG+++G 
Sbjct  289  TQFEQTTGVKEEVKAWAEALV-------SGKPNPLQATDEALADLEFLEKIFKSGEQDGT  341

Query  141  LVQVK  127
             ++++
Sbjct  342  RLKLE  346



>gb|EWC48565.1| hypothetical protein DRE_01787 [Drechslerella stenobrocha 248]
Length=363

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 91/184 (49%), Gaps = 16/184 (9%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGC-EVTSVSAMTSHVDKTLPPPDNISAL  496
            Y ++ WR+   + GGF LD GVH+ A LRML+G  E + VSA TS     LPP D + A 
Sbjct  173  YVNTEWRKVPQYQGGFCLDAGVHFTAALRMLIGNDEASRVSAFTSLNQPHLPPIDTVMAT  232

Query  495  FQLENGCSGVFAMVVSSRSPKIV-WRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              L++G  G F+M   + S K   W +V   GT+ V  G K       +   + D    S
Sbjct  233  VMLKSGACGTFSMSHGTPSAKTFDWGIVCEGGTVRVADGQKVIVKKVDMPEVVSDF---S  289

Query  318  FFYPFCGVQEELKTFLSDISLANTKG-GECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
                + GV+ E++ F      A  KG G     P ++      D+ ++E M++SG++ GA
Sbjct  290  DNEDWSGVKAEVRAFAE----AVRKGVGNEDQSPEMAVA----DLELIEKMIKSGEQSGA  341

Query  141  LVQV  130
              ++
Sbjct  342  PFEI  345



>ref|XP_011318574.1| hypothetical protein FGSG_02628 [Fusarium graminearum PH-1]
 gb|ESU08089.1| hypothetical protein FGSG_02628 [Fusarium graminearum PH-1]
 gb|EYB30901.1| hypothetical protein FG05_02628 [Fusarium graminearum]
 emb|CEF74956.1| unnamed protein product [Fusarium graminearum]
Length=358

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 91/179 (51%), Gaps = 16/179 (9%)
 Frame = -2

Query  672  TXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ +SWR    F GGF+LD GVH+VA +R L       VSA TS V   L P D ++A
Sbjct  186  SQWYGTSWRAKPQFQGGFLLDGGVHFVAAMRQLFDEPAADVSAFTSQVQPHLAPVDTVNA  245

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     ++     ++     G++ V+ G+K      +V+ + G+  +K 
Sbjct  246  VIRLKSGVSGTYQQSCGTKMSTSAFQFGYEKGSVVVD-GDK-----VTVTPWEGEQVVKD  299

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
            F     GV EE++ + + +        + K + R S  E   D+ +LE M ESG   GA
Sbjct  300  FERT-SGVDEEIEAWANALV-------DGKPDKRQSVEEALADLELLEMMFESGSDGGA  350



>ref|XP_003045334.1| hypothetical protein NECHADRAFT_70521 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU39621.1| hypothetical protein NECHADRAFT_70521 [Nectria haematococca mpVI 
77-13-4]
Length=345

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 91/190 (48%), Gaps = 23/190 (12%)
 Frame = -2

Query  678  AQTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNI  505
            A T +++++WR    + GGF+LD GVH+ A  RML+      V A T+     LPP D +
Sbjct  172  ADTQWYATAWRAKPEYQGGFLLDGGVHFAAATRMLLTTRAADVRAQTALTQPHLPPIDTV  231

Query  504  SALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQI  325
            +A+ +LE+G SGV+     SR     +      GT+ V  G+K      +V+   G+  +
Sbjct  232  NAVVRLESGVSGVYQQSAGSRLSAFDFDFSYEKGTVSVS-GDK-----VTVTPLEGEAVV  285

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKR  151
            K F     GV EE++ +   +           G+P  R S  +   D+  LE M ESG  
Sbjct  286  KEFERT-SGVSEEVEAWGKAL---------VAGKPDERQSVEKALGDLEFLEQMFESGSN  335

Query  150  EGALVQVKKF  121
             G   + KK+
Sbjct  336  GG---ETKKY  342



>ref|XP_009263289.1| hypothetical protein FPSE_11897 [Fusarium pseudograminearum CS3096]
 gb|EKJ67888.1| hypothetical protein FPSE_11897 [Fusarium pseudograminearum CS3096]
Length=354

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 91/179 (51%), Gaps = 16/179 (9%)
 Frame = -2

Query  672  TXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ +SWR    F GGF+LD GVH+VA +R L       VSA TS V   L P D ++A
Sbjct  182  SKWYGTSWRAKPQFQGGFLLDGGVHFVAAMRQLFDEPAADVSAFTSQVQPHLAPVDTVNA  241

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     ++     ++     G++ V+ G+K      +V+ + G+  +K 
Sbjct  242  VIRLKSGVSGTYQQSCGTKMSTSAFQFGYEKGSVVVD-GDK-----VTVTPWEGEQVVKD  295

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
            F     GV EE++ + + +        + K + R S  E   D+ +LE M ESG   GA
Sbjct  296  FERT-SGVDEEIEAWANALV-------DGKPDKRQSVEEALADLELLEMMFESGSDGGA  346



>gb|KFZ09203.1| hypothetical protein V502_08867 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=350

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 90/187 (48%), Gaps = 18/187 (10%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPD  511
            A T YF + WR+  ++ GGF+LD GVH+ AG R+L+G     +S+SA T+ +   LPP D
Sbjct  169  AGTKYFETEWRKVPSYQGGFLLDGGVHFTAGTRLLLGPHNRPSSLSAYTALLQPHLPPID  228

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  331
             +++++Q  NG SG   +   +      + +    G++ V R     + G        DG
Sbjct  229  TVNSIWQTTNGISGTVQISFGTSLSGDEYTIACYEGSVTVSRDTVTVRSGEE-----KDG  283

Query  330  QIKS--FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
             + S        GV+ E+K +   I        +       S  E   D+ +LEAM++SG
Sbjct  284  NLTSRVILGSGSGVKAEVKAWAEGIEAGVENAAQ-------SPAEALADLELLEAMIKSG  336

Query  156  KREGALV  136
            + EG  V
Sbjct  337  EGEGVKV  343



>gb|KFY88446.1| hypothetical protein V500_06334 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=350

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 90/187 (48%), Gaps = 18/187 (10%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPD  511
            A T YF + WR+  ++ GGF+LD GVH+ AG R+L+G     +S+SA T+ +   LPP D
Sbjct  169  AGTKYFETEWRKVPSYQGGFLLDGGVHFTAGTRLLLGPHNRPSSLSAYTALLQPHLPPID  228

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  331
             +++++Q  NG SG   +   +      + +    G++ V R     + G        DG
Sbjct  229  TVNSIWQTTNGISGTVQISFGTSLSGDEYTIACYEGSVTVSRDTVTVRSGEE-----KDG  283

Query  330  QIKS--FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
             + S        GV+ E+K +   I        +       S  E   D+ +LEAM++SG
Sbjct  284  NLTSRVILGSGSGVKAEVKAWAEGIEAGVENAAQ-------SPAEALADLELLEAMIKSG  336

Query  156  KREGALV  136
            + EG  V
Sbjct  337  EGEGVKV  343



>ref|XP_002146783.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
marneffei ATCC 18224]
 gb|EEA26236.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
marneffei ATCC 18224]
Length=346

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 88/180 (49%), Gaps = 21/180 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISA  499
            +F +SWR+N    GGF+LD GVHY A LR L+G +V  T ++A T+ + + LPP D + A
Sbjct  169  FFQTSWRKNPTHQGGFLLDGGVHYTAALRGLLGPDVHFTRLAAFTTLLKEHLPPVDTMDA  228

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--I  325
            + +   G  G F   V++      W +    GT+ V         G  V++   DG+  +
Sbjct  229  ILKTNTGIQGTFQSSVATTLTGPEWTIACEKGTVTVV--------GSDVTVRPVDGEELV  280

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
            ++      GV  E++ +   ++         +  P  +  E   D+ ++E ML SG+ EG
Sbjct  281  QTIADERTGVPPEIRAWGEALAAG-------RQNPEQTPEEALADLELIELMLRSGESEG  333



>ref|XP_007295758.1| oxidoreductase family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD13668.1| oxidoreductase family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=344

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 96/185 (52%), Gaps = 23/185 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISA  499
            YF ++WR+  +  GGF+LD GVH+VAG+R+L+G   + T++SA T  + + L P D + +
Sbjct  169  YFETAWRKRPDHQGGFLLDGGVHFVAGIRLLLGNNAKPTALSAFTHLLQEHLAPVDTVDS  228

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            ++Q ++G +G F+    +      + V   NG++ V    K       V + +G+   K+
Sbjct  229  IWQTKSGVTGTFSACFGTTLSGSEYTVACENGSVTVIVREK-------VIVRLGEESDKN  281

Query  318  FFYPF-----CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGK  154
            F   +      GV++E+K +   +        + K  P  S  E   D+ +LE ML SG+
Sbjct  282  FKEEWFKEEGSGVKQEVKAWAQSLV-------DRKPLPAQSPEEALIDLEILEKMLRSGE  334

Query  153  REGAL  139
            + G L
Sbjct  335  QNGQL  339



>ref|XP_009153161.1| glucose-fructose oxidoreductase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY52700.1| glucose-fructose oxidoreductase [Exophiala dermatitidis NIH/UT8656]
Length=341

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 93/184 (51%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH+ AGLR+++G +  + +VSA ++ + + LPP D + A
Sbjct  172  YFETSWRKTPTHQGGFLLDGGVHFTAGLRLMLGKDNPLATVSAFSAQLQEHLPPVDTVEA  231

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + +NG  G  ++   + +    W V   NG + + R          V++   DG+ + 
Sbjct  232  TGRTKNGAVGTISISFGTTAKGSEWTVGCENGAVSISRDQ--------VTV---DGKTER  280

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +   ++   T         + S  E   D+ ++EAML SG++ G  
Sbjct  281  IEDEKSGVPPEVRNWGKALAAGTTN-------EQQSPEEALADLELIEAMLRSGEQGGVP  333

Query  138  VQVK  127
            ++++
Sbjct  334  IKLE  337



>gb|KIW21209.1| hypothetical protein PV08_01789 [Exophiala spinifera]
Length=340

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 96/184 (52%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH+ A LR+++G +  + S+SA ++ + + LPP D + A
Sbjct  171  YFETSWRKVPTHQGGFLLDGGVHFTAALRLMLGKDNPLVSISAHSALLQEHLPPVDTVEA  230

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + + + G  G  ++   + +    W V   NG + + R NK       V++   D ++  
Sbjct  231  IAKSKKGAVGTISISFGTTAKGSEWTVAAENGFVSISR-NK-------VTI---DDKVDE  279

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +    +LA  K  E +     S  E   D+ ++EAML SG++ GA 
Sbjct  280  IEDERTGVPPEVRAWGE--ALAAGKANEQQ-----SPEEALADLELVEAMLRSGEQGGAP  332

Query  138  VQVK  127
            V+++
Sbjct  333  VKLQ  336



>gb|EPS32813.1| hypothetical protein PDE_07773 [Penicillium oxalicum 114-2]
Length=336

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 91/181 (50%), Gaps = 27/181 (15%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            Y+ + WR++  + GGF+LD GVH +AGLRM++G +  + SVSA T  +   LPP D + A
Sbjct  164  YYLTLWRQSPGYQGGFLLDGGVHMLAGLRMILGPKNRIVSVSAQTQQLQNYLPPIDTLDA  223

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + Q E G +G  ++   SR    ++      GT++++  +            M + ++  
Sbjct  224  VTQTELGATGTISLSWGSRFTDSLFEFECEKGTVKIQFDD-----------VMVNDEVHH  272

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEP---RLSFVEGTRDIAVLEAMLESGKRE  148
              +   GV  E++ F   I          +G+P   R S  E   D+++LE M+ SG+ +
Sbjct  273  IEFDGKGVVPEVREFAETI---------LRGDPVAKRQSPEEALADLSLLEQMMRSGEHD  323

Query  147  G  145
            G
Sbjct  324  G  324



>gb|KIM99483.1| hypothetical protein OIDMADRAFT_89802, partial [Oidiodendron 
maius Zn]
Length=339

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 80/176 (45%), Gaps = 13/176 (7%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            Y+ + WRR   + GGF+LD GVH+ A +R + G EV         V   LPP D I+A  
Sbjct  175  YYETPWRRVPGYQGGFLLDGGVHHAAMVRYVSGQEVVETHGYARQVAAHLPPLDTINAGI  234

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  313
             L  G +G  +M  +S      + ++G  G+  +     DG +G+ + L    G+ +   
Sbjct  235  LLSGGGTGTISMSFASTKRATEFTIIGTQGSFFL----TDGPNGFILKLSQLSGETREET  290

Query  312  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                GVQ E+  FL  +          K + R    E   D+A++E++   G + G
Sbjct  291  IKSNGVQLEIDAFLEAVKTG-------KAQSRSGPEEAMNDLAIIESLCSGGGKVG  339



>gb|KEZ39853.1| Oxidoreductase-like protein [Scedosporium apiospermum]
Length=348

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 90/186 (48%), Gaps = 24/186 (13%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNIS  502
            YF++ WR+  ++ GGF+LD GVH+VAG+R  +   G EV  +SA TS + + LPP D + 
Sbjct  173  YFNTDWRKIPDYQGGFLLDGGVHFVAGIRSFLAAAGQEVKQLSARTSLIQEKLPPVDTVH  232

Query  501  ALFQLENGCSGVFAMVVSSR-SPKIVWRVVGLNGTLEVE----RGNKDGKHGYSVSLYMG  337
             L    +G SG F +   +         +V   G + +        K G  G        
Sbjct  233  GLLTTGSGRSGTFCVSFGTEFKSDFCIELVTTKGAVRLTPVEVTTTKQGTDGEK------  286

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
              + K  F    GV+ E+  F   I     + GE   +PR +  +G +D+ +L+ +LESG
Sbjct  287  -AEEKKIFEFSVGVKPEIVAFAKSI-----QKGEV--DPRQTPEQGYKDLEILQGLLESG  338

Query  156  KREGAL  139
            +  GA+
Sbjct  339  ECSGAI  344



>gb|EHK50187.1| hypothetical protein TRIATDRAFT_233440, partial [Trichoderma 
atroviride IMI 206040]
Length=343

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 82/174 (47%), Gaps = 13/174 (7%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            ++ + WR+   + GGF+LD GVH  A LR + G EV         V   LPP D ++A  
Sbjct  177  WYETPWRKVPEYQGGFLLDGGVHQTALLRFITGQEVVETQGFARQVVPHLPPLDTLNAGI  236

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  313
             L  G +G  +M  +S        ++G  G+ ++     DG  G+ ++L +  G+ +S  
Sbjct  237  LLSGGGTGTISMSFASLRSAGELTLIGTKGSFQI----VDGPSGFVLTLDLVSGESRSET  292

Query  312  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  151
                GV+ E+K FL  I +        K E R    E   D+A +E+M + G +
Sbjct  293  VNSKGVELEIKAFLEAIKIG-------KAEKRSGPEEALNDLASIESMCQGGGK  339



>ref|XP_006455042.1| hypothetical protein AGABI2DRAFT_194743 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV43777.1| hypothetical protein AGABI2DRAFT_194743 [Agaricus bisporus var. 
bisporus H97]
Length=376

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 94/201 (47%), Gaps = 25/201 (12%)
 Frame = -2

Query  675  QTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
            +T ++ + WR   ++ GGF+LD GVH +A LR+++   +T VS   S     L P D I 
Sbjct  181  ETKWYKTPWRTIPDYQGGFLLDGGVHTIAALRVMLPHPLTHVSGFASLNKAYLAPHDTIH  240

Query  501  ALFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM--  340
            A+ Q   G SGV    FA    SR     + ++G NG L V   +K G  G  + + +  
Sbjct  241  AIVQAGPGVSGVADLIFASPTKSRPAGSEFAILGTNGWLSVNHVSKPGVSGSVIRVIIHS  300

Query  339  ----GDGQ----IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIA  184
                 DG      +    P  GVQ EL +F + IS      G+  G+P    +    D+A
Sbjct  301  IVRSKDGTEVEEEEIIDEPGIGVQAELASFFAAIS--GKDDGKGLGDP----LAALGDVA  354

Query  183  VLEAMLESGKREGALVQVKKF  121
             ++A L SG   G LV + + 
Sbjct  355  FIQAALNSG---GNLVDLTQL  372



>ref|XP_011112776.1| hypothetical protein H072_7001 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39213.1| hypothetical protein H072_7001 [Dactylellina haptotyla CBS 200.50]
Length=364

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 99/187 (53%), Gaps = 22/187 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKTLPPPDNISAL  496
            YF ++WR+   + GGF LD GVHY AGLRMLVG  + +S+SA T+   + L P D I + 
Sbjct  173  YFETAWRKVPEYQGGFCLDAGVHYTAGLRMLVGEDQFSSLSAFTALNQQHLVPIDTIMST  232

Query  495  FQLENGCSGVFAMVVSSRSPKIV-WRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
             +L++G  G FAM   + S K   + +V   GT+++  G+K       V++   D   +S
Sbjct  233  IKLKSGVCGTFAMSHGTPSAKAFDFLIVCEEGTVKIGDGSK-------VTVKKTDMPEES  285

Query  318  FFY----PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  151
              +     + GV+ E+K F   ++    KG    G    S  +   D+ ++E M++SG++
Sbjct  286  VAFGGEDGWNGVKAEVKAFAEAVA----KG---VGNDDQSPEKAVADLELIEKMIQSGEQ  338

Query  150  EGALVQV  130
             G   +V
Sbjct  339  GGKPFEV  345



>gb|KIL95797.1| glucose-fructose oxidoreductase [Fusarium avenaceum]
Length=345

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 94/188 (50%), Gaps = 19/188 (10%)
 Frame = -2

Query  678  AQTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNI  505
            A + ++S++WR    F GGF+LD GVH+ A  R L+      VSA T+ V   L P D +
Sbjct  171  ADSQWYSTAWRAKPEFQGGFLLDGGVHFTAATRQLLTEPAADVSAFTAQVQAHLAPIDTV  230

Query  504  SALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQI  325
            +A+ +L++G SG +     ++     ++     G++EV+ G+K      +V+ + G+  +
Sbjct  231  NAVIRLKSGVSGTYQQSCGAKMSTSTFQFGYEKGSIEVD-GDK-----VTVTPWEGEKSV  284

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
            K F     GV EE+  +    +L + K  E     + S  E   D+  LE M ESG   G
Sbjct  285  KEFERT-SGVTEEVAAWAK--ALVDGKPNE-----KQSPEEALADLEFLELMFESGANGG  336

Query  144  ALVQVKKF  121
               + KK+
Sbjct  337  ---EAKKY  341



>ref|XP_006696746.1| hypothetical protein CTHT_0064410 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS18415.1| hypothetical protein CTHT_0064410 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=510

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 92/191 (48%), Gaps = 26/191 (14%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNIS  502
            YF++ WRR   + GGF+LD GVH+VA LR L+G    E+  V+A TS ++  L P D + 
Sbjct  175  YFNTEWRRVPQYQGGFLLDGGVHFVAALRFLLGAAGHELDKVAAFTSLLEPRLLPADTVH  234

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVW-RVVGLNGTL-----EVERGNKDGKHGYSVSLYM  340
            A+   + G SG   +   +    ++   VV  NG +      V   N+ G         +
Sbjct  235  AVAFTKGGKSGTINITFGTEFKDVLEVEVVTTNGAVTWTPNAVTTVNRKGD-------CL  287

Query  339  GDGQIKSFFYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLE  163
             D  +K+  +P+C GV  E+ +F   +            + R    EG +D+ V++ MLE
Sbjct  288  ADKAVKTKEFPYCSGVLAEVASFAQALESGRL-------DLRQMPAEGLKDLEVVQRMLE  340

Query  162  SGKREGALVQV  130
            SG+  G L  V
Sbjct  341  SGEDHGVLKTV  351



>gb|ELR09495.1| hypothetical protein GMDG_00677 [Pseudogymnoascus destructans 
20631-21]
Length=350

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 94/188 (50%), Gaps = 26/188 (14%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPD  511
            A T YF + WR+  ++ GGF+LD GVH+ AG R+L+G      S+SA T+ +   LPP D
Sbjct  169  AGTKYFETEWRKIPSYQGGFLLDGGVHFTAGTRLLLGPLNRPVSLSAYTALIQPHLPPID  228

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG--  337
             +++++Q   G SG   +   +      + +   +G++ V R         +VS++ G  
Sbjct  229  TVNSIWQTTKGVSGTVQISFGTSLSGDEYTIACYDGSVSVSRD--------TVSVHNGEE  280

Query  336  -DGQIKS--FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRL-SFVEGTRDIAVLEAM  169
             DG + +        GV+ E+  +         +G E   E  L S  E   D+ +LEAM
Sbjct  281  KDGNVTTRVLLSSGSGVKAEVHAW--------AEGIETGKENSLQSPAEALADLELLEAM  332

Query  168  LESGKREG  145
            ++SG+ EG
Sbjct  333  IKSGEGEG  340



>gb|EHK17838.1| hypothetical protein TRIVIDRAFT_136949, partial [Trichoderma 
virens Gv29-8]
Length=331

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 81/168 (48%), Gaps = 13/168 (8%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            ++ + WR+   + GGF+LD GVH  A LR + G EV   +     V   LPP D ++A  
Sbjct  175  WYETPWRKVPEYQGGFLLDGGVHQTAMLRYISGQEVVETAGFARQVAPHLPPLDTLNAGI  234

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  313
             L  G +G  +M  +S        ++G  G+  +     DG  G+ +SL +  G+ +S  
Sbjct  235  LLSGGGTGTISMSFASTRRASELTIIGSKGSFFL----TDGPDGFLLSLDLATGERRSET  290

Query  312  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAM  169
                GV+ E++ FL  + +  +   E K  P     E   D+A++E+M
Sbjct  291  IRSKGVELEIQAFLEAVKMGKS---EKKAGPE----EALNDLAIIESM  331



>ref|XP_007330917.1| hypothetical protein AGABI1DRAFT_114560 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78203.1| hypothetical protein AGABI1DRAFT_114560 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=377

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 95/202 (47%), Gaps = 26/202 (13%)
 Frame = -2

Query  675  QTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
            +T ++ + WR   ++ GGF+LD GVH +A LR+++   +T VS   S     L P D I 
Sbjct  181  ETKWYKTPWRTIPDYQGGFLLDGGVHTIAALRVMLPHPLTHVSGFASLNKAYLAPHDIIH  240

Query  501  ALFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHG-------YS  355
            A+ Q   G SGV    FA    SR     + ++G NG L V   +K G  G       +S
Sbjct  241  AIVQAGPGVSGVADLIFASPTKSRPAGSEFAILGTNGWLSVNHVSKPGVSGSVIRVIIHS  300

Query  354  VSLYMGDGQIKS----FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDI  187
            +     D +++        P  GVQ EL +F + IS      G+  G+P    +    D+
Sbjct  301  IVKSKDDTEVEEKEEIIDEPGIGVQAELASFFAAIS--GKDDGKGLGDP----LAALGDV  354

Query  186  AVLEAMLESGKREGALVQVKKF  121
            A ++A L SG   G LV + + 
Sbjct  355  AFIQAALNSG---GNLVDLTQL  373



>gb|KIW39301.1| hypothetical protein PV06_09085 [Exophiala oligosperma]
Length=340

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 96/184 (52%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH+ A LR+++G +  + S+SA ++ + + LPP D + A
Sbjct  171  YFETSWRKVPTHQGGFLLDGGVHFTAALRLMLGKDNPLVSISAHSALLQEHLPPVDTVEA  230

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + + G  G  ++   + +    W V   NG + + + NK       V++   D ++  
Sbjct  231  TAKSKKGAVGTISISFGTTAKGSEWTVATENGFVSISK-NK-------VTI---DDKVDE  279

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +    +LA  K  E +     S  E   D+ ++EAML SG+++GA 
Sbjct  280  IEDERTGVPPEVRAWGE--ALAAGKVNELQ-----SPEEALADLELIEAMLRSGEQDGAP  332

Query  138  VQVK  127
            ++++
Sbjct  333  IKLQ  336



>gb|KFX44108.1| Uncharacterized protein GQ26_0300340 [Talaromyces marneffei PM1]
Length=275

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 86/177 (49%), Gaps = 21/177 (12%)
 Frame = -2

Query  657  SSWRRN--FFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQ  490
            +SWR+N    GGF+LD GVHY A LR L+G +V  T ++A T+ + + LPP D + A+ +
Sbjct  101  TSWRKNPTHQGGFLLDGGVHYTAALRGLLGPDVHFTRLAAFTTLLKEHLPPVDTMDAILK  160

Query  489  LENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSF  316
               G  G F   V++      W +    GT+ V         G  V++   DG+  +++ 
Sbjct  161  TNTGIQGTFQSSVATTLTGPEWTIACEKGTVTVV--------GSDVTVRPVDGEELVQTI  212

Query  315  FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                 GV  E++ +   ++         +  P  +  E   D+ ++E ML SG+ EG
Sbjct  213  ADERTGVPPEIRAWGEALAAG-------RQNPEQTPEEALADLELIELMLRSGESEG  262



>gb|KIM22883.1| hypothetical protein M408DRAFT_332653 [Serendipita vermifera 
MAFF 305830]
Length=372

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 96/195 (49%), Gaps = 25/195 (13%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            ++ + WR   ++ GGF+LD GVH  A LR ++   +  +S + S   + L P D I  L 
Sbjct  185  WYKTPWRTVPDYQGGFLLDGGVHSAAALRTVLPSPLQQLSGLASLNREHLAPHDTIHTLI  244

Query  492  QLENGCSGVFAM---VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM------  340
            + ++G  G+F +   + SS      +RVVG  G L + + NK G+     + Y+      
Sbjct  245  RSKDGSHGLFELSFGLPSSAGGGDSFRVVGTEGILLITKFNKPGEKEGESTQYIKVQITS  304

Query  339  -GDGQIKSFFYPFCGVQEELKTFLSDISLANTKG-GECKGEPRLSFVEGTRDIAVLEAML  166
              DG  +      CGV++EL +F      A+ +G  +  G+P    +   +D+AV++A L
Sbjct  305  AKDGSTEEIIEKTCGVKQELSSF-----AAHVRGQDDGLGKP----LRALQDVAVIQAAL  355

Query  165  ESGKREGALVQVKKF  121
             S    G++V + K 
Sbjct  356  NS---NGSVVDLTKL  367



>ref|XP_003347717.1| hypothetical protein SMAC_03815 [Sordaria macrospora k-hell]
 emb|CCC11108.1| unnamed protein product [Sordaria macrospora k-hell]
Length=355

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 91/191 (48%), Gaps = 25/191 (13%)
 Frame = -2

Query  675  QTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPD  511
            +  YF + WR+  ++ GGF+LD GVH+VAGLR+L+     +++ V   +  +++ L P D
Sbjct  181  ENKYFKTEWRKVPSYQGGFLLDGGVHFVAGLRLLLSSLDQDISQVVGFSHLLEERLLPVD  240

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGK---HGYSVSLYM  340
             + A+     G SG  ++   ++              LEVE    +G    +   V    
Sbjct  241  TVHAVALTSEGKSGTISISFGTQ----------FKSGLEVEVVTTNGSVYWNPTEVKTKT  290

Query  339  GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  160
             DG+    F    GV+EE+  F   I    T+  +    P     E  RD+ V++ +LES
Sbjct  291  KDGEKAEQFERRSGVKEEMAAFAQAIERGKTEKNQT---PE----EALRDLEVVQRLLES  343

Query  159  GKREGALVQVK  127
            G+ +GA+  ++
Sbjct  344  GEAKGAVKAIE  354



>gb|KIO22409.1| hypothetical protein M407DRAFT_245182 [Tulasnella calospora MUT 
4182]
Length=372

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 97/194 (50%), Gaps = 18/194 (9%)
 Frame = -2

Query  675  QTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
            ++ ++ SSWR   ++ GGF+LD GVH +A LR ++   V S+S   S     L P D+I 
Sbjct  184  ESQWYQSSWRTVPDYQGGFLLDGGVHSMAVLRTILPSPVVSLSGHASLTKPYLLPHDSIQ  243

Query  501  ALFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERG-NKDGKHGYSVSLYMG  337
            ++  L +G  G+    +A   S+R+      V G  G LE+  G N+ G  G++    +G
Sbjct  244  SVLALNSGAHGLIELSWAAPSSARAESFT-IVTGTEGFLELTFGKNEAGVIGWTFKTVVG  302

Query  336  --DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLE  163
              D +    FY   G++ E++ F   + L   +     GEPR       RD+A+++A L 
Sbjct  303  TKDPKEDKQFYRGQGMENEIEWFAQAV-LKGEQNSISVGEPR----GAVRDVALIQASLT  357

Query  162  SGKREGALVQVKKF  121
            S    GA V +KK 
Sbjct  358  SA---GAPVDIKKL  368



>gb|KFX46381.1| Uncharacterized protein GQ26_0191180 [Talaromyces marneffei PM1]
Length=311

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 86/177 (49%), Gaps = 21/177 (12%)
 Frame = -2

Query  657  SSWRRN--FFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQ  490
            +SWR+N    GGF+LD GVHY A LR L+G +V  T ++A T+ + + LPP D + A+ +
Sbjct  137  TSWRKNPTHQGGFLLDGGVHYTAALRGLLGPDVHFTRLAAFTTLLKEHLPPVDTMDAILK  196

Query  489  LENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSF  316
               G  G F   V++      W +    GT+ V         G  V++   DG+  +++ 
Sbjct  197  TNTGIQGTFQSSVATTLTGPEWTIACEKGTVTVV--------GSDVTVRPVDGEELVQTI  248

Query  315  FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                 GV  E++ +   ++         +  P  +  E   D+ ++E ML SG+ EG
Sbjct  249  ADERTGVPPEIRAWGEALAAG-------RQNPEQTPEEALADLELIELMLRSGESEG  298



>gb|EEQ92492.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
ER-3]
Length=345

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  675  QTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
            +  YF ++WR    + GGF+LD GVH+VA +RM+ G E+    + T+     L P D ++
Sbjct  173  ENKYFQTAWRAEPGYQGGFVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVN  232

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  322
            A  +   G  G  ++  ++ +    +  +G  G L V+    D     +V +  GD  + 
Sbjct  233  AALRFSKGAQGTLSISFAAATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVV  288

Query  321  S-FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            S   +P  G   E++ F+  I+      G+  G PR    E   D+AV+E++   G
Sbjct  289  SEEVFPADGNVNEIRAFVQAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>gb|EQL35203.1| hypothetical protein BDFG_03181 [Blastomyces dermatitidis ATCC 
26199]
Length=345

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  675  QTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
            +  YF ++WR    + GGF+LD GVH+VA +RM+ G E+    + T+     L P D ++
Sbjct  173  ENKYFQTAWRAEPGYQGGFVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVN  232

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  322
            A  +   G  G  ++  ++ +    +  +G  G L V+    D     +V +  GD  + 
Sbjct  233  AALRFSKGAQGTLSISFAAATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVV  288

Query  321  S-FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            S   +P  G   E++ F+  I+      G+  G PR    E   D+AV+E++   G
Sbjct  289  SEEVFPADGNVNEIRAFVQAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>ref|XP_002626131.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76920.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
SLH14081]
Length=345

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  675  QTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
            +  YF ++WR    + GGF+LD GVH+VA +RM+ G E+    + T+     L P D ++
Sbjct  173  ENKYFQTAWRAEPGYQGGFVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVN  232

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  322
            A  +   G  G  ++  ++ +    +  +G  G L V+    D     +V +  GD  + 
Sbjct  233  AALRFSKGAQGTLSISFAAATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVL  288

Query  321  S-FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            S   +P  G   E++ F+  I+      G+  G PR    E   D+AV+E++   G
Sbjct  289  SEEVFPADGNVNEIRAFVQAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>ref|XP_007324396.1| hypothetical protein SERLADRAFT_364213 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN93362.1| hypothetical protein SERLA73DRAFT_97769 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO18743.1| hypothetical protein SERLADRAFT_364213 [Serpula lacrymans var. 
lacrymans S7.9]
Length=376

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 100/204 (49%), Gaps = 34/204 (17%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            ++ + WR   ++ GGF+LD GVH  A LR+++  ++T +S+  S   K LPP D I+A+ 
Sbjct  184  WYKTPWRTIPDYQGGFLLDGGVHSTAALRVMLPGKMTHLSSFASLNKKYLPPHDTINAIV  243

Query  492  QLENGCSGVFAMVVS------SRSPKIVWRVVGLNGTLEVERGNKDGKHG------YSVS  349
            ++++G  G+F M  +      S+  +I+  + G +G L VE+    G  G        ++
Sbjct  244  KVDDGSHGIFEMSFAAPATSLSQGNRII--ITGTDGWLSVEQAKVLGTQGGIEIPVLRIN  301

Query  348  LYM--------GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTR  193
            L M        G  + +    P  GV+ EL +F + ++     G    G P    V    
Sbjct  302  LRMVTKVNDKPGPERTEIIDEPVKGVEAELGSFFAAVAGTRDDG---LGSP----VGALE  354

Query  192  DIAVLEAMLESGKREGALVQVKKF  121
            D+A ++A L S   EG LV+++  
Sbjct  355  DVAFIQAALNS---EGCLVELQNM  375



>gb|KIV93979.1| hypothetical protein PV10_05146 [Exophiala mesophila]
Length=341

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 82/174 (47%), Gaps = 22/174 (13%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLV--GCEVTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH+VAGLR L+  G  + ++SA ++ +   LPP D + A
Sbjct  175  YFETSWRKVPTHQGGFLLDGGVHFVAGLRYLLGKGNPIVTISAHSAQLQDHLPPVDTVEA  234

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + +NG  G  ++   + +    W +           G +DG      S    DG  + 
Sbjct  235  TARTKNGAIGTLSISFGTTAKGTEWTI-----------GAEDGVVSIIDSDLTIDGNKQD  283

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            F     GV  E++ +   ++  +        + R +  E   D+ ++EAML SG
Sbjct  284  FTNERSGVPPEVRAWGEALAAGSI-------DARQTPEEALADLELIEAMLVSG  330



>emb|CCA69637.1| hypothetical protein PIIN_03576 [Piriformospora indica DSM 11827]
Length=367

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 90/185 (49%), Gaps = 19/185 (10%)
 Frame = -2

Query  672  TXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++++ WR    + GGF+LD GVH  A LR ++  + T ++   S   + L P D I A
Sbjct  179  SMWYNTPWRTVPEYQGGFLLDGGVHSAAALRTVLPSKFTELAGFASLNREHLAPHDTIHA  238

Query  498  LFQLENGCSGVFAMV--VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM-----  340
            + + E+G  G+F +   + S      +RVVG +GTL++ R ++          ++     
Sbjct  239  IIRSEDGSHGIFELSFGLPSSPGHDSFRVVGTDGTLDINRYHEKDPETQKDQAFIKVTIK  298

Query  339  --GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
                GQ +      CGV+ EL+ F + ++  +   G  +G          +D++V++A L
Sbjct  299  NAKTGQKEEIVERSCGVERELENFAAHLNGHDDGLGTPQG--------ALQDVSVIQAAL  350

Query  165  ESGKR  151
            +S  R
Sbjct  351  DSHGR  355



>gb|EGE83963.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
ATCC 18188]
Length=345

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 84/176 (48%), Gaps = 14/176 (8%)
 Frame = -2

Query  675  QTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
            +  YF ++WR    + GGF+LD GVH+VA +RM+ G E+    + T+     L P D ++
Sbjct  173  ENKYFQTAWRVEPGYQGGFVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVN  232

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  322
            A  +   G  G  ++  ++ +    +  +G  G L V+    D     +V +  GD  + 
Sbjct  233  AALRFSKGAQGTLSISFAAATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVV  288

Query  321  S-FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            S   +P  G   E++ F+  I+      G+  G PR    E   D+AV+E++   G
Sbjct  289  SEEVFPADGNVNEIRAFVQAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>gb|KIX08304.1| hypothetical protein Z518_02960 [Rhinocladiella mackenziei CBS 
650.93]
Length=334

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 89/178 (50%), Gaps = 22/178 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH+VAGLR+++G    + S+SA ++ + + LPP D + A
Sbjct  165  YFETSWRKVPTHQGGFLLDGGVHFVAGLRLMLGKHNPLVSLSAHSAQLQEHLPPVDTVEA  224

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + + G  G  ++   + +    W V    G + + R NK       V++   D + + 
Sbjct  225  TAKSKKGTIGTISISFGTTAKGSEWTVGCDKGFVSLTR-NK-------VTI---DDKTEE  273

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                  GV  E++ +   ++   T        PR S  E   D+ ++EAML SG++ G
Sbjct  274  IEDEKTGVPPEIRKWGEALAAGTTN-------PRQSPEEALADLELIEAMLRSGEQGG  324



>emb|CCT69021.1| related to dehydrogenases and related proteins [Fusarium fujikuroi 
IMI 58289]
Length=322

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 90/186 (48%), Gaps = 19/186 (10%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A
Sbjct  150  SQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNA  209

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L+ G SG +     S+    V++     G++ V+ G+K      +V  + G+  +K 
Sbjct  210  VIRLKGGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVKPWDGEPAVKE  263

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
            F     GV EE++ +   ++       E K + R S  E   D+  LE M ESG   G  
Sbjct  264  FERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG--  313

Query  138  VQVKKF  121
             Q KK+
Sbjct  314  -QAKKY  318



>gb|KFY00135.1| hypothetical protein O988_03504 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=343

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 77/172 (45%), Gaps = 13/172 (8%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            Y+ + WR+   + GGF+LD GVH  A +R + G EV         +   LPP D ++A  
Sbjct  177  YYETQWRKVPGYQGGFLLDGGVHQTAMIRYISGQEVVETRGFARQLAAHLPPLDTVNAGI  236

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  313
             L  G +G  +M  +S        ++G  G+  +     DG  G+ + L    G ++   
Sbjct  237  LLSGGATGTISMSFASTKRATELTIIGSQGSFFL----TDGPDGFILKLSQLSGSVREET  292

Query  312  YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
                GV+ E+K FL  + +        K + R    E   D+A++E++   G
Sbjct  293  IKSKGVELEIKAFLEAVRVG-------KAQTRSGPEEALNDLAIIESLCSGG  337



>ref|XP_002839683.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83874.1| unnamed protein product [Tuber melanosporum]
Length=348

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 91/182 (50%), Gaps = 10/182 (5%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE-VTSVSAMTSHVDKTLPPPDNISAL  496
            Y+ +SWR+  ++ GGF+LD GVHY A +R+L+  E +  VSA T+   + LPP D ISA+
Sbjct  168  YYETSWRKTPDYQGGFLLDAGVHYAASMRILLSDEKIVKVSAFTASNFEHLPPVDTISAI  227

Query  495  FQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF  316
            F+ + G  G F + V +      + V   NG++ V   ++             D  +K F
Sbjct  228  FKTDKGVVGSFEVSVGTTFEGWEFAVACENGSVTVRPVSEVVILRRKPGGGFEDEIVKKF  287

Query  315  FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  136
                 GV  E+  F   +        + +  P L+      D+ ++E ML SG+ +GA++
Sbjct  288  PDDKKGVGPEVAAFAKAVIAG---APDERQTPELA----VGDLEMIEKMLRSGENDGAVM  340

Query  135  QV  130
            ++
Sbjct  341  EI  342



>gb|EPE09779.1| nad-binding rossmann fold oxidoreductase family protein [Ophiostoma 
piceae UAMH 11346]
Length=368

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 89/196 (45%), Gaps = 37/196 (19%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGC---------EVTSVSAMTSHVDKTLP  520
            YF+++WR+N    GGF+LD G+HYVA LR L+           ++T ++     + + LP
Sbjct  174  YFNTAWRKNPTHPGGFLLDGGIHYVASLRSLLAAAGAPPSKSNKITKLAGTMEQLLEILP  233

Query  519  PPDNISALFQLENGCSGVFAMV------------VSSRSPKIVWRVVGLNGTLEVERGNK  376
            P D +  +   E+G SGV  M             V++    + W         +V    +
Sbjct  234  PADTVRNIAVTESGASGVVTMSFGTEFGCPLEISVTTTEGMVTWT------PKKVTVATR  287

Query  375  DGKHGYSVSLYMGDGQIKSFFYPF---CGVQEELKTFLSDISLANTKGGECKGEPRLSFV  205
            +    ++  +   D   K+  +P     GV+ E + F ++I+      G+   E RLS  
Sbjct  288  NEADLFNPHIVEHDCSPKNPAFPADEGTGVKAEFRAFAANIA-----AGKKAVETRLSPA  342

Query  204  EGTRDIAVLEAMLESG  157
            E   D+ +LEAM +SG
Sbjct  343  EALADLELLEAMFDSG  358



>ref|XP_001906379.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP67045.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP28788.1| Putative Oxidoreductase [Podospora anserina S mat+]
Length=352

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 88/178 (49%), Gaps = 23/178 (13%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNIS  502
            YF++ WR+  ++ GGF+LD GVH+VA LR L+G    E++ V+A T+ +++ L P D I 
Sbjct  179  YFNTQWRKVPDYQGGFLLDGGVHFVAALRYLLGASGQELSKVAAYTALLEERLQPLDTIH  238

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS---VSLYMGDG  331
             +   + G +G   +   +            NGT ++E    +G   +S   V     +G
Sbjct  239  GVASTKQGVNGSIVLSFGTEFK---------NGT-DLEIITTNGTVSWSPTEVKTVTKEG  288

Query  330  QIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + K  F    GV EE+  F   I     K G  K +   +  E  RD+ VLE +LESG
Sbjct  289  ESKKEFEYSSGVGEEVAVFARAI-----KAGTGKVDGLQTPEEAFRDLEVLEGLLESG  341



>gb|KFH44383.1| hypothetical protein ACRE_048520 [Acremonium chrysogenum ATCC 
11550]
Length=348

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 82/181 (45%), Gaps = 21/181 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVT---SVSAMTSHVDKTLPPPDNIS  502
            YF++ WR    + GGF+LD GVH+ A  R+ +  +     +V A T      LPP D +S
Sbjct  175  YFNTPWRTKPQYQGGFLLDGGVHHAAATRLFLHGDANGAHTVQAFTQQAQAHLPPIDTVS  234

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  322
            A+ +  +G +G +     S      W +    G++ V        +G +V++    G+  
Sbjct  235  AIIKTRSGATGTYQHSAGSNVRAFEWDLGYEKGSVNV--------NGETVTVTPAGGEKT  286

Query  321  -SFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
               F    GV+EE+  +   ++       + K  PR S  E   D+  LE M +SG  +G
Sbjct  287  VKHFERTSGVEEEVAAWAQSLA-------DGKPNPRQSPEEALADLEFLEKMFKSGDEKG  339

Query  144  A  142
            +
Sbjct  340  S  340



>gb|KIY03803.1| hypothetical protein Z520_00494 [Fonsecaea multimorphosa CBS 
102226]
Length=339

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 92/183 (50%), Gaps = 22/183 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF + WR+     GGF+LD GVH+ AGLR+++G +  + S+SA ++ + + LPP D + A
Sbjct  170  YFETEWRKVPTHQGGFLLDGGVHFTAGLRLMMGKDNPLVSLSAHSAQLQEHLPPVDTVEA  229

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + +NG  G  ++   +      W V    G++ +  GNK             DG+ + 
Sbjct  230  TAKSKNGNVGTISISFGTTHKGSEWAVGCEKGSVSLS-GNK----------VTYDGKTEE  278

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +    +LA  K  E +     S  EG  D+ ++EAML SG++ G  
Sbjct  279  VQDERTGVPGEVRAWGE--ALAAGKVNESQ-----SPEEGLADLELIEAMLRSGEQGGVP  331

Query  138  VQV  130
            +++
Sbjct  332  IKL  334



>ref|XP_568129.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAW46612.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
Length=358

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 88/186 (47%), Gaps = 20/186 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T +SA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKRPQHQGGYLLDAGVHNAGVLRTVLPSPITHLSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E N   G   +   +R  + +W  R+ G +G +  E  N DG     V +  G     
Sbjct  239  RSEPNNIHGQILIDYGARGREPMWELRLTGSDGEIYSEDINDDGVDSIKVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + +IK F  P  GV EE + F   I+    + G  +G           D+A+++A L S 
Sbjct  299  NREIKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQAALTSN  348

Query  156  KREGAL  139
              E AL
Sbjct  349  GNEVAL  354



>ref|XP_007760853.1| hypothetical protein A1O7_08673 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ55743.1| hypothetical protein A1O7_08673 [Cladophialophora yegresii CBS 
114405]
Length=340

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 93/184 (51%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF + WR+     GGF+LD GVH+ AG+RM++G +  + S+SA ++ + K LPP D +  
Sbjct  171  YFETDWRKVPTHQGGFLLDGGVHFTAGIRMMLGKDNPLVSLSAHSAQLQKHLPPVDTVEG  230

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + + G  G  ++   +      W V   +G + V  GNK       V++   DG+ + 
Sbjct  231  TAKSKQGTVGTISISFGTTHKGSEWAVGCEDGFVSV-TGNK-------VTV---DGKTEE  279

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +    +LA  K  E     R S  E   D+ ++EAML SG++ G  
Sbjct  280  IQDEGTGVPHEVRAWGE--ALAAGKVNE-----RQSPEEALADLELIEAMLRSGEQGGVP  332

Query  138  VQVK  127
            ++++
Sbjct  333  IKLE  336



>ref|XP_007733422.1| hypothetical protein A1O3_05105 [Capronia epimyces CBS 606.96]
 gb|EXJ84437.1| hypothetical protein A1O3_05105 [Capronia epimyces CBS 606.96]
Length=330

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 92/184 (50%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH VA LR+++G +  + ++SA ++ + + LPP D + A
Sbjct  161  YFETSWRKTPTHQGGFLLDGGVHTVAALRLMLGKDNPLVTLSAHSAQLQEHLPPVDTVEA  220

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + +NG  G  +M   + +    W +    G++ + R          V++   DG+ + 
Sbjct  221  TGKTKNGAVGTISMSFGTTAKGSEWNIGSEKGSVSISRDQ--------VTV---DGKTEK  269

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +  +  +A T         R S  E   D+ ++E ML SG++ G  
Sbjct  270  VEDEGTGVAPEVRKW-GEALVAGTSN------ERQSPEEALADLELIEVMLRSGEQGGVP  322

Query  138  VQVK  127
            ++++
Sbjct  323  IKLE  326



>ref|XP_007794424.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
 gb|EMR66479.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
Length=350

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 91/185 (49%), Gaps = 27/185 (15%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            Y+ +SWR    + GGF+LD GVH+ A LR L+G E  V S+ A TS V   LPP D+I+A
Sbjct  176  YYQTSWRMKPEYQGGFLLDGGVHFTAALRRLLGEENTVKSLIAQTSLVSSHLPPVDSINA  235

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQI--  325
            + +L++G  G + + V +      + +    G ++ E  NK       V +  G G+   
Sbjct  236  VLKLKSGAVGSYIVSVGTTMNAFEFHIACEQGVVKAET-NK-------VVVVKGIGEDAT  287

Query  324  --KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRL--SFVEGTRDIAVLEAMLESG  157
              +  +    GV+ E++ +   I           G+P L  S  +   D+ +LE ML SG
Sbjct  288  TEEKAWERNTGVKNEVQAWAEGI---------ASGKPNLEQSPEQALADLELLEKMLTSG  338

Query  156  KREGA  142
              +GA
Sbjct  339  DNDGA  343



>gb|ERS96910.1| hypothetical protein HMPREF1624_06237 [Sporothrix schenckii ATCC 
58251]
Length=351

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 95/201 (47%), Gaps = 43/201 (21%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGC-----EVTSVSAMTSHVDKTLPPPDN  508
            +F++ WR+   + GGF+LD GVH++AGLR L+G      ++  VSA T+ +   L P D 
Sbjct  173  FFNTEWRKVPGYQGGFLLDGGVHFIAGLRHLLGATAAKHDIAKVSAFTTLLQPKLAPVDT  232

Query  507  ISALFQLENGCSGVFAM-------------VVSSRSPKIVWRVVGLNGTLEVERGN-KDG  370
            + ++   + G  G F +             VV+++    +      +  +E   GN K+ 
Sbjct  233  VQSILATDKGAIGTFCVSFGTEFKSAFEIEVVTTKGAVTLTPTAVTSTWVEAAGGNKKED  292

Query  369  KHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRD  190
            K  +S S                GV+ E+  F + ++    KG     +PR S  E  +D
Sbjct  293  KKEFSFS---------------SGVKPEVVAFGASLA----KGAV---DPRQSAEEALKD  330

Query  189  IAVLEAMLESGKREGALVQVK  127
            +A+LEA+L S  + GA + V+
Sbjct  331  LAILEALLTSADQGGAPLAVE  351



>gb|EWG49872.1| glucose-fructose oxidoreductase [Fusarium verticillioides 7600]
 gb|EWG49873.1| glucose-fructose oxidoreductase [Fusarium verticillioides 7600]
Length=345

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 92/186 (49%), Gaps = 19/186 (10%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A
Sbjct  173  SQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNA  232

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     S+    V++     G++ V+ G+K      +V+ + G+  +K 
Sbjct  233  VVRLKSGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDGEPAVKE  286

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
            F     GV EE++ +   ++       E + + R S  E   D+  LE M ESG   G  
Sbjct  287  FERT-SGVTEEVEAWSKALA-------EGRPDKRQSVEEALADLEFLELMFESGLNGG--  336

Query  138  VQVKKF  121
             Q KK+
Sbjct  337  -QAKKY  341



>ref|XP_001216107.1| predicted protein [Aspergillus terreus NIH2624]
 gb|EAU31748.1| predicted protein [Aspergillus terreus NIH2624]
Length=523

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 93/174 (53%), Gaps = 14/174 (8%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            +  ++WR++  + GGF+LD GVH++A +R + G E+   +++T+ +   LPP D ++A  
Sbjct  354  WLETAWRKSPAYQGGFVLDGGVHFIALVRYVSGLEIVRTASLTAQMRAFLPPLDTVNAAV  413

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG-DGQI-KS  319
            +  NG +G  ++  +SR     +  VG  G + V+     G+   SV +  G DG++   
Sbjct  414  EFANGAAGSVSISFASRRAAFEFVFVGEEGAVVVKASKTAGE---SVVVLEGRDGEVLLE  470

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
                  GV EE++ FL  +    T   + + +PR ++     D+AV+E++ + G
Sbjct  471  ESIEGRGVSEEVRVFLEGV---ETGRMDERLDPRQAYA----DLAVIESVCQGG  517



>ref|XP_002479070.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
stipitatus ATCC 10500]
 gb|EED22107.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
stipitatus ATCC 10500]
Length=354

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (48%), Gaps = 17/178 (10%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            ++ +SWR+     GG+ILD GVH+ AGLR+L+G +  V  V+A T+ + + LPP D + A
Sbjct  174  FYHTSWRKEPTHQGGYILDGGVHFTAGLRLLLGSDVFVERVAAFTTSLKEHLPPVDTVDA  233

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +   G  G F   V++      W +   NG++ V           +V    G+  +K 
Sbjct  234  ILKTNTGIQGTFQSSVATTLTGPEWTIACENGSVTVSSSTV------TVLSVDGEEVVKE  287

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                  GV  E++ +   ++         +  P  +  EG  D+ ++E ML SG  +G
Sbjct  288  IPNERSGVPPEVRAWGEALAAG-------RQNPEQTPEEGLADLELIELMLRSGNHDG  338



>gb|EER41723.1| NAD-binding Rossmann fold oxidoreductase [Histoplasma capsulatum 
H143]
Length=352

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 84/173 (49%), Gaps = 14/173 (8%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            +  ++WR    + GGF+LD GVH+VA +RM+ G E+   ++ T+     L P D ++A  
Sbjct  181  FCKTAWRATPGYQGGFVLDAGVHFVALMRMVAGQEIVETTSFTAQFAPHLSPVDTVNAAL  240

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ-IKSF  316
            +   G  G F+M  ++ +    +  +G  G L V+R      H  +V +   D + I   
Sbjct  241  KFSGGAQGTFSMSFAAATFVADFIFIGTAGMLTVKR----AVHETTVRVDGPDLKPISEE  296

Query  315  FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
             +   G+  E+  F+  ++    + G+  G PR    E   D+AV+E++   G
Sbjct  297  AFKADGMMNEISAFVQAVA---ARKGDKAGSPR----EALADVAVIESICSGG  342



>gb|KEF53140.1| hypothetical protein A1O9_11048 [Exophiala aquamarina CBS 119918]
Length=326

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 86/178 (48%), Gaps = 22/178 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH+ AGLR+L+G +  + ++SA ++ + + LPP D + A
Sbjct  155  YFETSWRKVPTHQGGFLLDGGVHFTAGLRLLLGKDNPLVTISAHSAQLQEHLPPVDTVQA  214

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + + G  G  ++   + +    W V           G+  G    S +    DG++++
Sbjct  215  TGKTKQGTIGTISISFGTTAKGREWTV-----------GSDKGSVSVSYTDVTIDGKMEA  263

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                  GV  E++ +   ++             + S  E   D+ ++EAML SG ++G
Sbjct  264  VANEGSGVIPEVRAWGEALAAGTVN-------EKQSPEEALADLELIEAMLVSGAQDG  314



>ref|XP_755974.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus Af293]
 gb|EAL93936.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus Af293]
 gb|EDP55143.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus A1163]
 gb|KEY76538.1| oxidoreductaseNAD binding Rossmann fold protein [Aspergillus 
fumigatus var. RP-2014]
Length=379

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 90/190 (47%), Gaps = 38/190 (20%)
 Frame = -2

Query  672  TXYFSSSWR-----RNFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPP  514
            + YFS  +R      ++ GGFILD GVH VA LR+++G    V ++SA +    + LPP 
Sbjct  205  SKYFSKLYRLRSTSHDYLGGFILDGGVHVVAALRLILGSNDPVATISAQSCLQQQHLPPL  264

Query  513  DNISALFQLENGCSGVFAMVVSSRSPKIVWR------VVGLNG-TLEVERGNKDGKHGYS  355
            D ++A+ + ++G +GV ++   S     V+       VV LN  TL ++           
Sbjct  265  DTVNAVMKTKSGATGVLSLSFGSAFDDSVFEFDCEGGVVALNSDTLTIK-----------  313

Query  354  VSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLE  175
                   G+     +   GV  E+  F + I+     GG    + R S  E   D+ ++E
Sbjct  314  -------GESNELAFDGRGVSREVAVFATTIA----SGGSV--DKRQSPEEALADLEIME  360

Query  174  AMLESGKREG  145
             ML SG+R+G
Sbjct  361  KMLTSGERDG  370



>ref|XP_003047008.1| hypothetical protein NECHADRAFT_95358 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU41295.1| hypothetical protein NECHADRAFT_95358 [Nectria haematococca mpVI 
77-13-4]
Length=342

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 82/179 (46%), Gaps = 18/179 (10%)
 Frame = -2

Query  666  YFSSSWR--RNFFGGFILDMGVHYVAGLRMLV--GCEVTSVSAMTSHVDKTLPPPDNISA  499
            ++S+ WR    + GG +LD GVHY A  R+ +       SVSA+TS   K LPP D ++A
Sbjct  171  WYSTPWRGQAQYQGGPLLDGGVHYAAATRLFLQGDSSAASVSALTSLTQKHLPPADTVNA  230

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            L + ++G SG       S+     W      GT++V  GN        V    G+  +K 
Sbjct  231  LVKTKSGTSGTVQFSFGSQIEASEWDFGLERGTVKVS-GNT-----VIVKPAGGEAVVKE  284

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
             F    GV EE+  +   +          K  P  S  EG  D+  +E ML S +++GA
Sbjct  285  -FPETSGVSEEIAAWAESLV-------SGKQNPLQSAEEGMADVEFVEIMLRSAEKDGA  335



>gb|KFY14890.1| hypothetical protein V492_02347 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=350

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 72/139 (52%), Gaps = 7/139 (5%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPD  511
            A T YF + WR+  +  GGFILD GVH+ AG R+L+G +   TS+SA T+ +   LPP D
Sbjct  169  AGTKYFETEWRKTPSHQGGFILDGGVHFTAGTRLLLGPQNRPTSLSAYTALLQPHLPPID  228

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  331
             +++++Q   G SG   +   +      + +   NG++ V R   D  H  +     G+ 
Sbjct  229  TVNSIWQTAKGISGTVQISFGTSLSGDEYTIACYNGSVTVSR---DTVHVRTGEEKDGNV  285

Query  330  QIKSFFYPFCGVQEELKTF  274
              K F     GV+ E+K +
Sbjct  286  STKVFVGGGSGVKAEVKAW  304



>emb|CCX08562.1| Similar to Putative uracil phosphoribosyltransferase urg2; acc. 
no. Q9US43 [Pyronema omphalodes CBS 100304]
Length=603

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            Y  ++WR+     GGF+LD GVH+ AGLR+++G E+ +VSA+T+   + LPP D ++A+ 
Sbjct  176  YLETTWRKEPTHQGGFLLDGGVHFTAGLRLMLGEEIKTVSALTALTREYLPPVDTVNAVL  235

Query  492  QLENGCSGVF  463
            + E+G  G F
Sbjct  236  KTESGVVGTF  245



>gb|EIT72400.1| putative dehydrogenase [Aspergillus oryzae 3.042]
 gb|KDE75123.1| putative dehydrogenase [Aspergillus oryzae 100-8]
Length=412

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 93/197 (47%), Gaps = 31/197 (16%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPP  514
            ++  ++ + WR+   F GG++LD GVH+ A LR L+   G  V  VSA T+ + + LPP 
Sbjct  223  SKNPFYHTDWRQKPTFQGGYLLDGGVHFAAVLRTLLAALGQRVDVVSAYTTSLQENLPPL  282

Query  513  DNISALFQLENGCSGVFAMVVSSRSPK-IVWRVVGLNG-------TLEVERGNKDGKHGY  358
            D + A+ +   G SG +   V  ++ + + + +V   G        +E+      G    
Sbjct  283  DTVHAILRTNKGRSGTYTSSVGIQAKRGMEFEIVTDKGYVTYRPFQMEILVKQDQG----  338

Query  357  SVSLYMGDGQIKSFFYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAV  181
                  G+ + +S   P   GV+EE+  F + IS         + + RLS  E   D+ +
Sbjct  339  ------GNWEERSEPAPLMWGVKEEIAAFATSISTG-------RLDSRLSTTEALEDLKI  385

Query  180  LEAMLESGKREGALVQV  130
            +EAML SG  +   V +
Sbjct  386  VEAMLRSGDAQALPVDI  402



>dbj|BAE63558.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=359

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 93/201 (46%), Gaps = 39/201 (19%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPP  514
            ++  ++ + WR+   F GG++LD GVH+ A LR L+   G  V  VSA T+ + + LPP 
Sbjct  170  SKNPFYHTDWRQKPTFQGGYLLDGGVHFAAVLRTLLAALGQRVDVVSAYTTSLQEDLPPL  229

Query  513  DNISALFQLENGCSGVFAMVVSSRSPK------------IVWRVVGLNGTLEVERGNKDG  370
            D + A+ +   G SG +   V  ++ +            + +R   +   ++ ++G    
Sbjct  230  DTVHAILRTNKGGSGTYTSSVGIQAKRGMEFEIVTDKGYVTYRPFQMEILVKQDQG----  285

Query  369  KHGYSVSLYMGDGQIKSFFYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTR  193
                      G+ + +S   P   GV+EE+  F + IS         + + RLS  E   
Sbjct  286  ----------GNWEERSEPAPLMWGVKEEIAAFATSISTG-------RLDSRLSTTEALE  328

Query  192  DIAVLEAMLESGKREGALVQV  130
            D+ ++EAML SG  +   V +
Sbjct  329  DLKIVEAMLRSGDAQALPVDI  349



>gb|ENH74564.1| hypothetical protein FOC1_g10009984 [Fusarium oxysporum f. sp. 
cubense race 1]
Length=322

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 91/186 (49%), Gaps = 19/186 (10%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A
Sbjct  150  SQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNA  209

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K 
Sbjct  210  VIRLKSGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKE  263

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
            F     GV EE++ +   ++       E K + R S  E   D+  LE M ESG   G  
Sbjct  264  FERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG--  313

Query  138  VQVKKF  121
             Q KK+
Sbjct  314  -QAKKY  318



>gb|EMT70613.1| hypothetical protein FOC4_g10009079 [Fusarium oxysporum f. sp. 
cubense race 4]
 gb|EMT70614.1| hypothetical protein FOC4_g10009080 [Fusarium oxysporum f. sp. 
cubense race 4]
Length=322

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 91/186 (49%), Gaps = 19/186 (10%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A
Sbjct  150  SQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNA  209

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K 
Sbjct  210  VIRLKSGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKE  263

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
            F     GV EE++ +   ++       E K + R S  E   D+  LE M ESG   G  
Sbjct  264  FERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG--  313

Query  138  VQVKKF  121
             Q KK+
Sbjct  314  -QAKKY  318



>gb|EWZ38499.1| glucose-fructose oxidoreductase [Fusarium oxysporum Fo47]
 gb|EWZ83059.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA46087.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK40591.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXL79085.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL99025.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM22188.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=345

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 91/186 (49%), Gaps = 19/186 (10%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A
Sbjct  173  SQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNA  232

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K 
Sbjct  233  VIRLKSGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKE  286

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
            F     GV EE++ +   ++       E K + R S  E   D+  LE M ESG   G  
Sbjct  287  FERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG--  336

Query  138  VQVKKF  121
             Q KK+
Sbjct  337  -QAKKY  341



>gb|EXK91996.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. raphani 
54005]
Length=345

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 91/186 (49%), Gaps = 19/186 (10%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A
Sbjct  173  SQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNA  232

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K 
Sbjct  233  VIRLKSGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKE  286

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
            F     GV EE++ +   ++       E K + R S  E   D+  LE M ESG   G  
Sbjct  287  FERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG--  336

Query  138  VQVKKF  121
             Q KK+
Sbjct  337  -QAKKY  341



>gb|EWY91836.1| glucose-fructose oxidoreductase [Fusarium oxysporum FOSC 3-a]
Length=345

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 91/186 (49%), Gaps = 19/186 (10%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A
Sbjct  173  SQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNA  232

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K 
Sbjct  233  VIRLKSGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKE  286

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
            F     GV EE++ +   ++       E K + R S  E   D+  LE M ESG   G  
Sbjct  287  FERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG--  336

Query  138  VQVKKF  121
             Q KK+
Sbjct  337  -QAKKY  341



>ref|XP_007367395.1| oxidoreductase family protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF59932.1| oxidoreductase family protein [Dichomitus squalens LYAD-421 SS1]
Length=368

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 91/202 (45%), Gaps = 28/202 (14%)
 Frame = -2

Query  672  TXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++++ WR   ++ GGF+LD GVH +A LR+++    T++SA  S   + LPP D I+A
Sbjct  180  SKWYNTPWRTVPDYQGGFLLDGGVHTIAALRLILDSPFTTLSAHASLAKEILPPQDTINA  239

Query  498  LFQLENGCSGVFAMVVSSRSPKIVW------RVVGLNGTLEVERGNKDGKHGYSVSLYMG  337
            +    NG  G+  +   S  P           V G +G LE+ R +  G    +V     
Sbjct  240  IVSTANGAHGIVELSWGSPVPSRAADAHNSISVTGKDGWLEITRAS--GIVRITVKTATR  297

Query  336  D-------GQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVL  178
            D        Q         GVQ E+ +FL  +   N K     G PR + V    D+A +
Sbjct  298  DEKGTVTGEQTAVIEEKEAGVQLEIASFLEAL---NGKDDGLDG-PRGTLV----DVAFI  349

Query  177  EAMLESGKREGALVQVKKF*AF  112
            EA L S   +G  V V K  A 
Sbjct  350  EAALNS---DGVAVDVGKLAAL  368



>gb|KIN06467.1| hypothetical protein OIDMADRAFT_155638 [Oidiodendron maius Zn]
Length=345

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 92/184 (50%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISA  499
            Y++++WR   ++ GGF LD GVH+VAG R+L+G E   T+VSA T+ + + LPP D I+A
Sbjct  169  YYNTAWRTKPDYQGGFTLDGGVHFVAGTRLLLGEEAKPTAVSAFTTLLQEHLPPVDTINA  228

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNK----DGKHGYSVSLYMGDG  331
            ++  ++G SG ++    +      + +    GT+ +  G+K    +G+        +G  
Sbjct  229  IWSTKSGISGTYSNSFGTTFSGSEYTIACEKGTVTI-VGSKVIITEGEQK------LGKS  281

Query  330  QIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  151
              K F     GV++E+  +   +        +    PR S      D+ +LE ML SG  
Sbjct  282  SEKEFPDEGNGVRQEVGAWAQALI-------DGVPNPRQSPEHALADLEILEKMLISGAE  334

Query  150  EGAL  139
             G +
Sbjct  335  HGKV  338



>ref|XP_773472.1| hypothetical protein CNBI0860 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL18825.1| hypothetical protein CNBI0860 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=358

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 87/184 (47%), Gaps = 16/184 (9%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T +SA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKRPQHQGGYLLDAGVHNAGVLRTVLPSPITHLSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMGD-GQI  325
            + + N   G   +   +R  + +W  R+ G +G +  E  N DG     V +  G  G+ 
Sbjct  239  RSKPNNIHGQILIDYGARGREPMWELRLTGSDGEIYSEDINDDGVDSIKVQVRSGKFGRT  298

Query  324  KS--FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  151
            K     +P  GV EE + F   I+    + G  +G           D+A+++A L S   
Sbjct  299  KREIKIFPKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQAALTSNGN  350

Query  150  EGAL  139
            E AL
Sbjct  351  EVAL  354



>gb|EGU88150.1| hypothetical protein FOXB_01288 [Fusarium oxysporum Fo5176]
Length=1063

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 93/196 (47%), Gaps = 19/196 (10%)
 Frame = -2

Query  675   QTXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
              + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++
Sbjct  854   DSQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVN  913

Query  501   ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  322
             A+ +L++G SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K
Sbjct  914   AVIRLKSGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVK  967

Query  321   SFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
              F     GV EE++ +   ++       E K + R S  E   D+  LE M ESG   G 
Sbjct  968   EFERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG-  1018

Query  141   LVQVKKF*AFCTIGTT  94
               Q KK+   C    T
Sbjct  1019  --QAKKYECRCPNNVT  1032



>gb|KFY35329.1| hypothetical protein V494_06008 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=350

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 72/139 (52%), Gaps = 7/139 (5%)
 Frame = -2

Query  678  AQTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPD  511
            A T YF + WR+  +  GGFILD GVH+ AG R+L+G +   TS++A T+ +   LPP D
Sbjct  169  AGTKYFETDWRKTPSHQGGFILDGGVHFTAGTRLLLGPQNRPTSLAAYTALLQPHLPPID  228

Query  510  NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  331
             +++++Q   G SG   +   +      + V   NG++ V R   D  H  +     G+ 
Sbjct  229  TVNSIWQTAKGISGTVQISFGTSLSGDDYTVACYNGSVTVSR---DTVHVRTGEEKDGNV  285

Query  330  QIKSFFYPFCGVQEELKTF  274
              K F     GV+ E+K +
Sbjct  286  STKVFVGGGSGVKAEVKAW  304



>gb|KGQ09050.1| hypothetical protein BBAD15_g5618 [Beauveria bassiana D1-5]
Length=198

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 88/197 (45%), Gaps = 37/197 (19%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLV---------------------GCEVTSV  556
            Y+ ++WR+  ++ GGF+LD GVH+ AG RML+                           V
Sbjct  8    YYKTAWRQAPSYQGGFLLDGGVHFAAGARMLLLLATNAGLGRTDTSSSSSVRADSRPARV  67

Query  555  SAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNK  376
            SA T+ V + LPP D+++AL     G +G +   V S      + V   +G++ V  G  
Sbjct  68   SARTALVREHLPPVDSVAALVTTRGGATGTYQHSVGSTISAYEFEVAYEHGSVRVREGT-  126

Query  375  DGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGT  196
                  +V L  G   +   F    GV EE+  + + +        + + +P  S  E  
Sbjct  127  -----VTVEL-SGRKPVSRTFDRASGVPEEVAAWAAGLR-------DGRPDPAQSPEEAL  173

Query  195  RDIAVLEAMLESGKREG  145
             D+  +E M++SG+++G
Sbjct  174  ADLEFIEKMIQSGEQDG  190



>ref|XP_007722030.1| hypothetical protein A1O1_02932 [Capronia coronata CBS 617.96]
 gb|EXJ94536.1| hypothetical protein A1O1_02932 [Capronia coronata CBS 617.96]
Length=340

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 97/184 (53%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH+ AGLRM++G +  + ++SA ++ + + LPP D + A
Sbjct  171  YFETSWRKTPTHQGGFLLDGGVHFTAGLRMMLGKDNPLVTLSAHSAQLQEHLPPVDTVEA  230

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + +NG  G  ++   + +    W + G  G + +   +KD      V++   DG+ + 
Sbjct  231  TGKTKNGAVGTISISFGTTAKGSEWTIGGDKGYVSL---SKD-----EVTV---DGKTEK  279

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ + +  +LA     E K  P  +      D+ ++EAML SG++ G  
Sbjct  280  VEDDGTGVGPEVRAWGN--ALATGIVNE-KQTPEQALA----DLELVEAMLRSGEQGGIP  332

Query  138  VQVK  127
            ++++
Sbjct  333  IKLE  336



>ref|XP_003715071.1| NAD-binding Rossmann fold oxidoreductase [Magnaporthe oryzae 
70-15]
 gb|EHA55264.1| NAD-binding Rossmann fold oxidoreductase [Magnaporthe oryzae 
70-15]
 gb|ELQ44237.1| NAD-binding Rossmann fold oxidoreductase family protein [Magnaporthe 
oryzae Y34]
 gb|ELQ66193.1| NAD-binding Rossmann fold oxidoreductase family protein [Magnaporthe 
oryzae P131]
Length=350

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 84/178 (47%), Gaps = 17/178 (10%)
 Frame = -2

Query  666  YFSSSWRRNFFG--GFILDMGVHYVAGLRMLVGCEVT-SVSAMTSHVDKTLPPPDNISAL  496
            Y+++ WR+N     GFILD GVH+ A LRML+G +V  +VS  +      LP PD +  +
Sbjct  176  YYNTEWRKNPTHDYGFILDGGVHWAASLRMLLGDDVAETVSGFSHTASAYLPSPDTLQGI  235

Query  495  FQLENGCSGVFAMVVSSRSP-KIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
             + ++G SG F +   S  P K  + V    G++ V R N       +VS   G     +
Sbjct  236  VRTKSGASGAFLVSCGSTLPAKSEFSVACERGSVTVSRDN------ITVSRTDGSEPQVT  289

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                  GV+ E++ + + +          K +PRL+  EG  D   L  ML+S    G
Sbjct  290  IKNSAEGVKYEVQAWAAALEAG-------KPDPRLAPEEGLADAEFLLGMLKSADAGG  340



>ref|XP_007911759.1| putative oxidoreductase nad-binding rossmann fold protein [Togninia 
minima UCRPA7]
 gb|EOO03539.1| putative oxidoreductase nad-binding rossmann fold protein [Togninia 
minima UCRPA7]
Length=358

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 88/179 (49%), Gaps = 19/179 (11%)
 Frame = -2

Query  666  YFSSSWRRNFFG--GFILDMGVHYVAGLRMLVGCEV-TSVSAMTSHVDKTLPPPDNISAL  496
            Y ++ WR++     GFILD GVH++A  R+L+G +   SV A +S     LPP D +S +
Sbjct  178  YLATEWRKSPTHPYGFILDGGVHWIASARLLLGDDTPQSVIAYSSLAQDYLPPVDTVSGV  237

Query  495  FQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF  316
             + ++G  G F     +      + V   NG++ +E     G  G+   +   DG+ +  
Sbjct  238  IKTKSGAIGTFNASCGTTLSSNEYSVACENGSVTIE-----GDKGW---IRYKDGRKEER  289

Query  315  FYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
               F  GV+EE+  +      A T G   K  P  +  E  +D+ +LEAML+SG   GA
Sbjct  290  ELEFVGGVKEEIAAWAE----ALTSG---KPNPLQTPEEALKDLELLEAMLKSGDANGA  341



>gb|KIR46389.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1280]
Length=358

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 88/186 (47%), Gaps = 20/186 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E +   G   +   +R  + VW  R++G +G +  E  N +G     V +  G     
Sbjct  239  RSEPSNIHGQMLIDYGARGREPVWELRLIGSDGEIYSEDVNDNGMDSIKVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + ++K F  P  GV EE + F   I+    + G  +G           D+A+++  L S 
Sbjct  299  NTEVKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSN  348

Query  156  KREGAL  139
              E AL
Sbjct  349  GNEVAL  354



>gb|EKV16143.1| Oxidoreductase family, NAD-binding Rossmann fold protein [Penicillium 
digitatum Pd1]
 gb|EKV18638.1| Oxidoreductase family, NAD-binding Rossmann fold protein [Penicillium 
digitatum PHI26]
Length=500

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 90/183 (49%), Gaps = 32/183 (17%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPDNISA  499
            YF ++WR+  N+ GGF+LD GVH +A LR+++G    ++++SA +      LPP D + A
Sbjct  172  YFHTAWRKTPNYQGGFLLDGGVHMIAALRLILGPTERLSTLSAQSQLQQSFLPPVDTVDA  231

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDG-KHGYSVSLYMGDGQ  328
            + + E+G +G+ ++   S     V+ V    G  TL  +    +G KH         DG+
Sbjct  232  VTKTESGATGIISLSWGSSFNDHVFEVACEKGLVTLNFDDVTINGEKHHVEF-----DGR  286

Query  327  IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGK  154
                     GV  E+  F + I           G+P  R S  E   D+ +LE ML SG+
Sbjct  287  ---------GVVPEVAEFANSI---------VSGKPDIRQSAEEALADLEILEQMLRSGE  328

Query  153  REG  145
            ++G
Sbjct  329  KDG  331



>gb|KIR59526.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1873]
Length=358

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 88/186 (47%), Gaps = 20/186 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E +   G   +   +R  + VW  R++G +G +  E  N +G     V +  G     
Sbjct  239  RSEPSNIHGQMLIDYGARGREPVWELRLIGSDGEIYSEDVNDNGMDSIKVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + ++K F  P  GV EE + F   I+    + G  +G           D+A+++  L S 
Sbjct  299  NTEVKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSN  348

Query  156  KREGAL  139
              E AL
Sbjct  349  GNEVAL  354



>gb|KIR85165.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
IND107]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 20/190 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E +   G   +   +R  + VW  R+ G +G +  E  N +G     V +  G     
Sbjct  239  RSEPSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVNDNGVDSIKVQIRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + ++K F  P  GV EE + F   I+      G  +G          +D+A+++  L S 
Sbjct  299  NTEVKIF--PKTGVYEEQRRFFEAIAGKPDGYGSVRG--------ALKDVALIQVALTSN  348

Query  156  KREGALVQVK  127
              E AL  +K
Sbjct  349  GNEVALNTLK  358



>gb|AFR94284.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus neoformans 
var. grubii H99]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 89/190 (47%), Gaps = 20/190 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T +SA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKRPQHQGGYLLDAGVHNAGVLRTVLPSPITHLSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E N   G   +   +R  + +W  R+ G  G +  E  + +G     V +  G     
Sbjct  239  RSEPNNIHGQILIDYGARGREPMWELRLTGSEGEIYSEDIDDNGVDSIRVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + +IK F  P  GV EE + F   I+    + G  +G           D+A+L+A L S 
Sbjct  299  NREIKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALLQAALTSN  348

Query  156  KREGALVQVK  127
              E AL  +K
Sbjct  349  GNEVALNTLK  358



>ref|XP_001554573.1| hypothetical protein BC1G_07162 [Botrytis cinerea B05.10]
 emb|CCD44433.1| similar to oxidoreductase family [Botrytis cinerea T4]
 gb|EMR88754.1| putative oxidoreductase nad-binding rossmann fold protein [Botrytis 
cinerea BcDW1]
Length=345

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 90/180 (50%), Gaps = 18/180 (10%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISA  499
            YF + WR+  ++ GGF+LD GVH+ A  R+L+G E   T+V A ++ + + LPP D I++
Sbjct  169  YFETEWRKKPDYQGGFLLDGGVHFTAAGRLLLGEEAKPTAVVAFSTLLREHLPPVDTINS  228

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            ++  ++G SG F++   +      + V   +G++ V R     + G        + +   
Sbjct  229  IWLTKSGISGTFSVSFGTTLSGPEYTVACEHGSVSVIRSKVIVRKGEESEKNFTEVE---  285

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  145
            F     GV++E+  +   I           G+P  R S  E   D+ +LE +L SG+ +G
Sbjct  286  FTEEGSGVKQEVAAWAQSI---------VDGKPNSRQSPQEALADLEILEKLLRSGEEQG  336



>gb|KIW64306.1| hypothetical protein PV04_09250 [Capronia semiimmersa]
Length=340

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 93/184 (51%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF + WR+     GGF+LD GVH+ A +RM++G +  + S+SA ++ + K LPP D +  
Sbjct  171  YFETDWRKVPTHQGGFLLDGGVHFTAAIRMMMGKDNPLVSLSAHSAQLQKHLPPVDTVEG  230

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + ++G  G  ++   +      W V   NG + +  GNK       V++   D +I+ 
Sbjct  231  TAKSKHGTVGTISISFGTTHRGSEWAVGCENGFVSIS-GNK-------VTI---DDKIEE  279

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +    +LA  K  E +     S  E   D+ ++EAML SG++ G  
Sbjct  280  IQDERTGVPTEVRAWGE--ALAAGKVNESQ-----SPEEALADLELIEAMLRSGEQGGVP  332

Query  138  VQVK  127
            ++++
Sbjct  333  IKLE  336



>ref|XP_009854174.1| hypothetical protein NEUTE1DRAFT_131795 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO54186.1| hypothetical protein NEUTE1DRAFT_131795 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ68383.1| NAD(P)-binding protein [Neurospora tetrasperma FGSC 2509]
Length=352

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 94/194 (48%), Gaps = 37/194 (19%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRML---VGCEVTSVSAMTSHVDKTLPPPDNIS  502
            YF + WR+  ++ GGF+LD GVH++AGLR+L   +  E+T V+  ++ +++ L P D + 
Sbjct  181  YFKTEWRKVPSYQGGFLLDGGVHFIAGLRLLLSELNQEITHVAGFSALLEERLLPVDTVH  240

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  322
            A+    +G SG  ++   ++              LEVE     G      S+Y    QIK
Sbjct  241  AVALTNDGKSGTISISFGTQ----------FKTGLEVEVVTTQG------SVYWNPTQIK  284

Query  321  SF---------FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAM  169
            +          F    GV+EE+  F   I     + G+ + E      E  +D+ V++ +
Sbjct  285  TKTKEGEKTEEFEKSTGVKEEMAAFAKAI-----EKGQIEKEQTPE--EALKDLEVVQRL  337

Query  168  LESGKREGALVQVK  127
            LESG+ +G +  V+
Sbjct  338  LESGEGKGIVKAVE  351



>gb|KIW42674.1| hypothetical protein PV06_06200 [Exophiala oligosperma]
Length=341

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 94/193 (49%), Gaps = 30/193 (16%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRML---VGCEVTSVSAMTSHVDKTLPPPDNIS  502
            ++ + WR+   + GGF+LD GVH+VAG+R L   VG +++S++A T+ ++  L P D + 
Sbjct  165  FYQTEWRKTPEYQGGFLLDGGVHFVAGVRHLLSAVGEDISSLAAYTALLEPKLAPVDTVH  224

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGK---HGYSVSLYMGDG  331
             + +  +G SG F +   +             G  E+      G       SV +   D 
Sbjct  225  GILRTTSGRSGSFNVSFGTE----------FKGGFEIFAATNKGSVTVTPVSVKVVRKDA  274

Query  330  QIKSF-----FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
              K       F    GV+ E++ F + I ++ T       +PR S  +   D+ VL+ +L
Sbjct  275  DGKKVEEEESFAFGAGVKSEVEAFAASI-VSGTP------DPRQSPQQALGDLIVLQGLL  327

Query  165  ESGKREGALVQVK  127
            ESG+++GA+  VK
Sbjct  328  ESGEQKGAVKAVK  340



>gb|EEH05857.1| NAD-binding Rossmann fold oxidoreductase [Histoplasma capsulatum 
G186AR]
Length=352

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 83/173 (48%), Gaps = 14/173 (8%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            +  ++WR    + GGF+LD GVH+VA +RM+ G E+   ++ T+     L P D ++A  
Sbjct  181  FCKTAWRATPGYQGGFVLDAGVHFVALMRMVAGQEIVETTSFTAQFAPHLSPVDTVNAAL  240

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ-IKSF  316
            +   G  G F+M  ++ +    +  +G  G L V+R      H  +V +   D + I   
Sbjct  241  KFSGGAQGTFSMSFAAATFVADFIFIGTAGMLTVKR----AVHETTVRVDGPDLKPISEE  296

Query  315  FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
             +   G+  E+  F+  ++    + G+    PR    E   D+AV+E++   G
Sbjct  297  AFKADGMMNEISAFVQAVA---ARKGDKAASPR----EALADVAVIESICSGG  342



>gb|KIR26739.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
LA55]
 gb|KIR36612.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
MMRL2647]
 gb|KIR39015.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
Ram5]
 gb|KIR95985.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CBS 10090]
 gb|KIY58928.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
99/473]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 20/190 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E +   G   +   +R  + VW  R+ G +G +  E  N +G     V +  G     
Sbjct  239  RSEPSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVNDNGVDSIKVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + ++K F  P  GV EE + F   I+    + G  +G           D+A+++  L S 
Sbjct  299  NTEVKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSN  348

Query  156  KREGALVQVK  127
              E AL  +K
Sbjct  349  GNEVALNTMK  358



>gb|KIS02481.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
2001/935-1]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 20/190 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E +   G   +   +R  + VW  R+ G +G +  E  N +G     V +  G     
Sbjct  239  RSEPSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVNDNGVDSIKVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + ++K F  P  GV EE + F   I+    + G  +G           D+A+++  L S 
Sbjct  299  NTEVKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSN  348

Query  156  KREGALVQVK  127
              E AL  +K
Sbjct  349  GNEVALNTMK  358



>ref|XP_008045096.1| oxidoreductase family protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW51984.1| oxidoreductase family protein [Trametes versicolor FP-101664 
SS1]
Length=368

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 90/199 (45%), Gaps = 25/199 (13%)
 Frame = -2

Query  675  QTXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  502
             + ++++ WR   ++ GGF+LD GVH +A LR+++   + +VSA  S     LPP D I+
Sbjct  179  NSKWYNTPWRTVPDYQGGFLLDGGVHTIASLRVVLPSALQTVSAFASLAKDILPPQDTIN  238

Query  501  ALFQLENGCSGVFAM------VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM  340
            A+ +  +G  G+  +      V  ++       V G  G LE+ R N  G    +V    
Sbjct  239  AIVRNVDGSHGLVELTWGAPTVTRAKQAGNNITVTGTEGWLEITRAN--GVMRIAVHTIT  296

Query  339  GDGQIKS-------FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAV  181
             D   KS             G+Q E+++FL     A     +   +PR + V    D+A 
Sbjct  297  RDKDGKSTGETEEVIEEKEVGIQREIESFLR----ATDGSDDGVDDPRSTLV----DVAF  348

Query  180  LEAMLESGKREGALVQVKK  124
            +EA L S      LV + K
Sbjct  349  IEAALNSNGAPVDLVALAK  367



>gb|KIW64066.1| hypothetical protein PV04_09025 [Capronia semiimmersa]
Length=345

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 89/192 (46%), Gaps = 33/192 (17%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNIS  502
            Y+ +SWR   ++ GGF+LD GVH+V   R L+   G +  S++A T+     LPP D + 
Sbjct  173  YYQTSWRSIPDYQGGFLLDGGVHFVGATRYLLAALGQKPVSLAAFTTLTQPMLPPVDTLH  232

Query  501  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDG-------KHGYSVSLY  343
            A+++  NG  G F +             V   G  E E     G       +   +V   
Sbjct  233  AVWKTGNGGQGTFNVSFG----------VEFQGAFEFEVVTDKGSVLVRPTEVVTTVKNE  282

Query  342  MGDGQIKSFFYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  166
             G+    +  +PF  GV+EE+  F   +        + K +PRL+  E   D+ +LE+ML
Sbjct  283  AGEKTPSTTEHPFSMGVKEEVAAFAKSLE-------DGKLDPRLAAPEAFEDLELLESML  335

Query  165  ESGKREGALVQV  130
            +S    G L+Q+
Sbjct  336  KSN---GNLIQL  344



>ref|XP_001538347.1| predicted protein [Histoplasma capsulatum NAm1]
 gb|EDN10149.1| predicted protein [Histoplasma capsulatum NAm1]
Length=340

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 83/173 (48%), Gaps = 14/173 (8%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            +  ++WR    + GGF+LD GVH+VA +RM+ G E+   ++ T+     L P D ++A  
Sbjct  169  FCKTAWRATPGYQGGFVLDAGVHFVALMRMVAGQEIVETTSFTAQFAPHLSPVDTVNAAL  228

Query  492  QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ-IKSF  316
            +   G  G F+M  ++ +    +  +G  G L V+R      H  +V +   D + +   
Sbjct  229  KFSGGAQGTFSMSFAAATFVADFIFIGTAGMLTVKR----AVHETTVRVDGPDLKPVSEE  284

Query  315  FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
             +   G+  E+  F+  ++    + G+    PR    E   D+AV+E++   G
Sbjct  285  VFKADGMMNEISAFVQAVA---ARTGDKAASPR----EALADVAVIESICSGG  330



>gb|EXL57961.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=345

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 86/174 (49%), Gaps = 16/174 (9%)
 Frame = -2

Query  672  TXYFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISA  499
            + ++ ++WR    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A
Sbjct  173  SQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNA  232

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
            + +L++G SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K 
Sbjct  233  VIRLKSGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKE  286

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            F     GV EE++ +   ++       E K + R S  E   D+  LE M ESG
Sbjct  287  FERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESG  332



>gb|KIW87520.1| hypothetical protein Z519_11843 [Cladophialophora bantiana CBS 
173.52]
Length=334

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 88/178 (49%), Gaps = 22/178 (12%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF + WR++    GGF+LD GVH+ AGLRM++G +  + ++SA ++ + + LPP D + A
Sbjct  165  YFETEWRKSPTHQGGFLLDGGVHFTAGLRMMMGKDNPLVTLSAHSAQLQEHLPPVDTVEA  224

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + + G  G  ++   +      W V    G++ +  GNK             D + + 
Sbjct  225  TAKSKKGAVGTISISFGTTHKGSEWAVGCEKGSVSLS-GNK----------VTYDDKTEE  273

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
                  GV  E++ +    +LA  K  E     R S  E   D+ ++EAML+SGK+ G
Sbjct  274  VKDEKTGVPGEVRAWGE--ALAAGKVNE-----RQSPEEALADLELIEAMLQSGKQGG  324



>ref|XP_007727310.1| hypothetical protein A1O1_08258 [Capronia coronata CBS 617.96]
 gb|EXJ80116.1| hypothetical protein A1O1_08258 [Capronia coronata CBS 617.96]
Length=348

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 90/187 (48%), Gaps = 40/187 (21%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNIS  502
            ++ +SWR    + GGF+LD GVH+VA  R L+     + T VSA+T+ V   L P D + 
Sbjct  176  FYQTSWRATPEYQGGFLLDGGVHFVAVTRYLLAALNQKPTGVSALTTLVQPMLAPVDTLH  235

Query  501  ALFQLENGCSGVFAM-------------VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHG  361
            AL+++ NG  G F +             +V+S+   +V R+  +  T + + G K     
Sbjct  236  ALWKVSNGRQGFFNVSFGVEFQSGFEFEIVTSKGSVLV-RMTEVITTTKDDAGEK-KPST  293

Query  360  YSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAV  181
              V + M             GV+EE+  F   +     KG   K +PRLS  E   D+ +
Sbjct  294  TEVPMSM-------------GVKEEVAAFAESLE----KG---KLDPRLSPEEAIADLQI  333

Query  180  LEAMLES  160
            LEAML+S
Sbjct  334  LEAMLKS  340



>ref|XP_003194017.1| hypothetical protein CGB_D1030C [Cryptococcus gattii WM276]
 gb|ADV22230.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
 gb|KIR81130.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
EJB2]
 gb|KIY34122.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
E566]
 gb|KJE03749.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
NT-10]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 20/190 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E +   G   +   +R  + VW  R+ G +G +  E  +  G     V +  G     
Sbjct  239  RSEPSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVSDHGVDSIKVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + ++K F  P  GV EE + F   I+    + G  +G           D+A+++A L S 
Sbjct  299  NAEVKIF--PKTGVYEEQRRFFEAIAGKPDEYGSAQG--------ALNDVALIQAALTSN  348

Query  156  KREGALVQVK  127
              E AL  +K
Sbjct  349  GNEVALNTLK  358



>gb|KIR53880.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
Ru294]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 20/190 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNQHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E +   G   +   +R  + VW  R+ G +G +  E  +  G     V +  G     
Sbjct  239  RSEPSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVSDHGVDSIKVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + ++K F  P  GV EE + F   I+    + G  +G           D+A+++A L S 
Sbjct  299  NAEVKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQAALTSN  348

Query  156  KREGALVQVK  127
              E AL  +K
Sbjct  349  GNEVALNTLK  358



>gb|KEZ38713.1| Oxidoreductase [Scedosporium apiospermum]
Length=355

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 88/185 (48%), Gaps = 21/185 (11%)
 Frame = -2

Query  657  SSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQ  490
            + WR+     GGF+LD G+H++A LR ++G E  + SVSA+T+ V   LPP D I A+ +
Sbjct  181  TDWRKKPVHQGGFVLDAGIHFIAYLRAVLGRENALESVSALTAQVQPHLPPIDTIHAILR  240

Query  489  LENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFY  310
             ++G  G   +   +        + G   +   E G    + G  +   + + ++++   
Sbjct  241  TKSGVVGSLCITAGT------LYLDGAETSFSFENGAIIAEAGKVIVKALDEDEVETEEE  294

Query  309  PF----CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  142
             F     GV EE+  + + +          K  P  S  E   D+ V+E M ESGK  GA
Sbjct  295  QFDLSTYGVSEEVNAWAAGLVAG-------KPNPAQSVEEALADLEVMEMMFESGKENGA  347

Query  141  LVQVK  127
            + ++K
Sbjct  348  VKKLK  352



>gb|EMS23348.1| NAD dependent oxidoreductase [Rhodosporidium toruloides NP11]
 emb|CDR37509.1| RHTO0S02e15764g1_1 [Rhodosporidium toruloides]
Length=376

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 90/197 (46%), Gaps = 20/197 (10%)
 Frame = -2

Query  660  SSSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQL  487
            +++WRR   + GGFILD GVH+ AGLR ++   + ++ A +      LPP D +  L  L
Sbjct  184  ATNWRREPEYQGGFILDGGVHFAAGLRHMLPSPIATIFARSYQFQPHLPPVDTLQGLVTL  243

Query  486  ENGCSG--VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK---  322
            E+G SG   F+  V   S K  +   G  G L V+  ++   H   +S  + + +     
Sbjct  244  ESGISGHFTFSFGVEQPSSKRQYTFRGSKGVLTVDFSDRR-THVVRLSTVVPNAEADEPP  302

Query  321  ---SFFYPFCGVQEELKTF----LSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLE  163
               +   P  GV  E   F    L+    A  +  E +  PR +     RD+A +E  L 
Sbjct  303  HELTIELPAEGVDAEFDAFGEALLAGPESAEMRSVEERSGPRATL----RDVAFIEGGLL  358

Query  162  SGKREGALVQVKKF*AF  112
            S K E   V++K+  A 
Sbjct  359  SAK-ERREVELKELVAL  374



>gb|KIV87570.1| hypothetical protein PV11_03107 [Exophiala sideris]
 gb|KIV87571.1| hypothetical protein, variant [Exophiala sideris]
Length=340

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 95/184 (52%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF +SWR+     GGF+LD GVH+ AGLR+++G +  + S+SA ++ + + LPP D + A
Sbjct  171  YFETSWRKVPTHQGGFLLDGGVHFTAGLRLMLGKDNPLVSLSAHSALLQEHLPPVDTVEA  230

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + ++G  G  ++   + S    W V    G + + R NK       V++   D + + 
Sbjct  231  TAKSKSGAVGTISISFGTTSKGSEWTVGCEKGFVSISR-NK-------VTV---DDKTEE  279

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +    +LA     E +     S  E   D+ ++EAML SG++ GA 
Sbjct  280  IEDERTGVPPEVRAWGE--ALAAGTVNEMQ-----SPEEALADLELIEAMLRSGEQGGAP  332

Query  138  VQVK  127
            ++++
Sbjct  333  IKLQ  336



>ref|XP_007740232.1| hypothetical protein A1O5_01425 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ74730.1| hypothetical protein A1O5_01425 [Cladophialophora psammophila 
CBS 110553]
Length=339

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 90/188 (48%), Gaps = 30/188 (16%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF + WR++    GGF+LD GVH+ AGLRM++G +  + ++SA ++ + + LPP D + A
Sbjct  170  YFETEWRKSPTHQGGFLLDGGVHFTAGLRMMMGRDNPLVTLSAHSAQLQEHLPPVDTVEA  229

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + + G  G  ++   +      W V    G++ +  GNK             D + + 
Sbjct  230  TAKSKKGTVGTISISFGTTHKGSEWAVGCEKGSVSLS-GNK----------VTYDDKTEE  278

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGEC----KGEPRLSFVEGTRDIAVLEAMLESGKR  151
                  GV  E++ +           GE     K   R S  E   D+ ++EAML+SGK+
Sbjct  279  VKDEKTGVPGEVRAW-----------GEALVAGKVNERQSPEEALADLELIEAMLQSGKQ  327

Query  150  EGALVQVK  127
             G  ++++
Sbjct  328  GGVPIKLE  335



>gb|KGB78824.1| hypothetical protein CNBG_4662 [Cryptococcus gattii R265]
 gb|KIR76041.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1014]
Length=358

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 89/190 (47%), Gaps = 20/190 (11%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  493
            YF + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + 
Sbjct  179  YFETEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVIT  238

Query  492  QLE-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----  337
            + E +   G   +   +R  + VW  R+ G +G +  E  N +G     V +  G     
Sbjct  239  RSEPSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVNDNGVDSIKVQVRSGKFGRT  298

Query  336  DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  157
            + ++K F  P  GV EE + F   I+    + G  +G           D+A+++  L S 
Sbjct  299  NTEVKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSN  348

Query  156  KREGALVQVK  127
              E A+  +K
Sbjct  349  GNEVAINTMK  358



>ref|XP_006445972.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59212.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=219

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  705  KLLLKGQ*IAQTXYFSSSWRRNFFGGFILDMGVHYVAGLRMLVGCEVT  562
            +++++G   +   YFSSSWRRNF GGFILDMGVH++AGLRM++   +T
Sbjct  162  QVIVEGSMNSSNPYFSSSWRRNFTGGFILDMGVHFIAGLRMVISYSLT  209


 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  757  FTECKKMIAEIGDMMNVQVIIEGTMNSSNPLF  662
            F ECKK+IAEIGDMM+VQVI+EG+MNSSNP F
Sbjct  145  FVECKKLIAEIGDMMSVQVIVEGSMNSSNPYF  176



>ref|XP_680622.1| hypothetical protein AN7353.2 [Aspergillus nidulans FGSC A4]
 gb|EAA61724.1| hypothetical protein AN7353.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF78561.1| TPA: oxidoreductase family, NAD-binding Rossmann fold protein 
(AFU_orthologue; AFUA_2G16380) [Aspergillus nidulans FGSC A4]
Length=344

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 86/185 (46%), Gaps = 33/185 (18%)
 Frame = -2

Query  666  YFS--SSWRR--NFFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDN  508
            YFS  + WR+   + GGF+LD G+H VAG+R+++G     + S++A TS + + LPP D 
Sbjct  174  YFSIDTPWRKIPEYQGGFLLDGGIHTVAGVRLILGRGKNSLKSLTAQTSQLQEHLPPIDT  233

Query  507  ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ  328
            + AL    +G +GVF++   S     V       G + +   ++   +G +  +      
Sbjct  234  VDALLTTASGAAGVFSLSFGSEFKSFVLEFTCEKGVVSL-VDDQLTVNGVATEI------  286

Query  327  IKSFFYPF--CGVQEELKTFLSDISLANTKGGECKGEPRLSFV--EGTRDIAVLEAMLES  160
                  PF   GV+EE+K F   I           GE     V  E   D+ VLE M  S
Sbjct  287  ------PFEGVGVKEEVKAFGESI---------VNGELNKKLVPDEALADLEVLEMMFRS  331

Query  159  GKREG  145
            G+  G
Sbjct  332  GEDGG  336



>ref|XP_008730183.1| hypothetical protein G647_07648 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI21302.1| hypothetical protein G647_07648 [Cladophialophora carrionii CBS 
160.54]
Length=340

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 92/184 (50%), Gaps = 22/184 (12%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF + WR+     GGF+LD GVH+ AG+RM++G +  + S+SA ++ + K LPP D +  
Sbjct  171  YFETDWRKVPTHQGGFLLDGGVHFTAGIRMMLGKDNPLVSLSAHSAQLQKHLPPVDTVEG  230

Query  498  LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  319
              + + G  G  ++   +      W V   +G + +  GNK       V++   D + + 
Sbjct  231  TAKSKQGTVGTISISFGTTHKGSEWAVGCEDGFVSIS-GNK-------VTI---DDKTEE  279

Query  318  FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  139
                  GV  E++ +    +LA  K  E +     S  E   D+ ++EAML SG++ G  
Sbjct  280  IQDERSGVPPEVRAWGE--ALAAGKVNEQQ-----SPEEALADLELIEAMLRSGEQGGVA  332

Query  138  VQVK  127
            ++++
Sbjct  333  IKLE  336



>ref|XP_008597824.1| oxidoreductase family protein [Beauveria bassiana ARSEF 2860]
 gb|EJP66565.1| oxidoreductase family protein [Beauveria bassiana ARSEF 2860]
Length=383

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 89/195 (46%), Gaps = 35/195 (18%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTS-------------------VSA  550
            Y+ ++WR+  ++ GGF+LD GVH+ AG RML+     +                   VSA
Sbjct  195  YYKTAWRQAPSYQGGFLLDGGVHFAAGARMLLLLATNAGLGRTDASSTVRADSRPARVSA  254

Query  549  MTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDG  370
             T+ V + LPP D+++AL     G +G +   V S      + V   +G++ V  G    
Sbjct  255  RTALVREHLPPVDSVAALVTTRGGATGTYQHSVGSTISAYEFEVAYEHGSVRVREGT---  311

Query  369  KHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRD  190
                +V L  G   +   F    GV EE+  + + +        + + +P  S  E   D
Sbjct  312  ---VTVEL-SGREPVSRTFERASGVPEEVAAWAAGLR-------DGRPDPAQSPEEALAD  360

Query  189  IAVLEAMLESGKREG  145
            +  +E M++SG+++G
Sbjct  361  LEFIEKMIQSGEQDG  375



>ref|XP_008716792.1| hypothetical protein HMPREF1541_04224 [Cyphellophora europaea 
CBS 101466]
 gb|ETN42283.1| hypothetical protein HMPREF1541_04224 [Cyphellophora europaea 
CBS 101466]
Length=340

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = -2

Query  666  YFSSSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  499
            YF + WR+N    GGF+LD GVH  AGLR+L+G E  + ++SA T+ +   LPP D I A
Sbjct  171  YFETEWRKNPTHQGGFLLDGGVHQTAGLRLLMGRENPLVTLSAHTAQLQPHLPPVDTIEA  230

Query  498  LFQLENGCSGVFAM  457
            + + +NG  G   +
Sbjct  231  VAKAKNGAVGTITI  244



>gb|ESZ98482.1| hypothetical protein SBOR_1144 [Sclerotinia borealis F-4157]
Length=345

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 94/188 (50%), Gaps = 19/188 (10%)
 Frame = -2

Query  666  YFSSSWRR--NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISA  499
            YF + WR+  ++ GGF+LD GVH+ A  R+++G     T+V A ++ + + LPP D I++
Sbjct  169  YFETEWRKKPSYQGGFLLDGGVHFTAAARLILGEATRPTTVVAFSTLLREHLPPVDTINS  228

Query  498  LFQLENGCSGVFAMV--VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQI  325
            ++  ++G SG F+    ++   P+  + +   NG++ V R     + G       G+   
Sbjct  229  VWLTKSGISGTFSASFGITLSGPE--YTIACENGSVTVIRSKVIVRKGEEKE---GNSTE  283

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
              F     GV++E+  +   I        + K + R S  E   D+ +LE +L SG+ EG
Sbjct  284  VEFTEEGSGVKQEVAAWAQSIK-------DGKPDSRQSPEEALADLEILEKLLRSGE-EG  335

Query  144  ALVQVKKF  121
               Q  +F
Sbjct  336  GKSQSLQF  343



>ref|XP_001593666.1| hypothetical protein SS1G_05094 [Sclerotinia sclerotiorum 1980]
 gb|EDO02617.1| hypothetical protein SS1G_05094 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=345

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 89/180 (49%), Gaps = 14/180 (8%)
 Frame = -2

Query  672  TXYFSSSWRR--NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNI  505
            + Y+ + WR+  ++ GGF+LD GVH+ A  R+L+G     TSV A ++ + + LPP D I
Sbjct  167  SKYYETEWRKKPDYQGGFLLDGGVHFTAAGRLLLGGAARPTSVVAFSTLLREHLPPVDTI  226

Query  504  SALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQI  325
            ++++   +G SG F++   +      + V   +G++ V R     + G        + + 
Sbjct  227  NSVWLTNSGVSGTFSVSFGTTLSGPEYTVACEDGSVTVIRSKVIVRKGEENEKNFTEVE-  285

Query  324  KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  145
              F     GV++E+  +   I        + K + R S  E   D+ +LE +L SG+ +G
Sbjct  286  --FTEEGSGVKQEVAAWAQSIV-------DKKPDTRQSPEEALADLEILEKLLRSGEEQG  336



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890