BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003I13

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629448.1|  PREDICTED: aspartic proteinase-like                364   5e-120   Nicotiana tomentosiformis
ref|XP_009797823.1|  PREDICTED: aspartic proteinase                     362   3e-119   Nicotiana sylvestris
ref|XP_004232695.1|  PREDICTED: aspartic proteinase                     361   1e-118   Solanum lycopersicum
ref|XP_009792514.1|  PREDICTED: aspartic proteinase-like                356   1e-118   Nicotiana sylvestris
ref|XP_006348142.1|  PREDICTED: aspartic proteinase-like                359   6e-118   Solanum tuberosum [potatoes]
emb|CDP04424.1|  unnamed protein product                                357   4e-117   Coffea canephora [robusta coffee]
ref|XP_009587050.1|  PREDICTED: aspartic proteinase-like                356   9e-117   Nicotiana tomentosiformis
ref|XP_007026133.1|  Saposin-like aspartyl protease family protein      355   3e-116   
ref|XP_004231616.1|  PREDICTED: aspartic proteinase                     355   3e-116   Solanum lycopersicum
gb|EYU27762.1|  hypothetical protein MIMGU_mgv1a004712mg                354   6e-116   Erythranthe guttata [common monkey flower]
emb|CAC86004.1|  aspartic proteinase                                    353   1e-115   Theobroma cacao [chocolate]
ref|XP_004145121.1|  PREDICTED: aspartic proteinase-like                351   9e-115   
ref|XP_008440898.1|  PREDICTED: aspartic proteinase                     350   1e-114   Cucumis melo [Oriental melon]
ref|XP_006350474.1|  PREDICTED: aspartic proteinase-like                350   2e-114   Solanum tuberosum [potatoes]
ref|XP_011096039.1|  PREDICTED: aspartic proteinase-like                350   3e-114   
ref|XP_010099183.1|  Aspartic proteinase                                349   3e-114   Morus notabilis
sp|O04057.1|ASPR_CUCPE  RecName: Full=Aspartic proteinase; Flags:...    348   7e-114   Cucurbita pepo
ref|XP_010252464.1|  PREDICTED: aspartic proteinase A1-like             347   4e-113   Nelumbo nucifera [Indian lotus]
gb|EYU33885.1|  hypothetical protein MIMGU_mgv1a004716mg                346   7e-113   Erythranthe guttata [common monkey flower]
emb|CBI23210.3|  unnamed protein product                                343   1e-112   Vitis vinifera
ref|XP_003632941.1|  PREDICTED: aspartic proteinase A1                  344   5e-112   Vitis vinifera
gb|KDP20718.1|  hypothetical protein JCGZ_21189                         342   4e-111   Jatropha curcas
gb|KJB67248.1|  hypothetical protein B456_010G182400                    341   6e-111   Gossypium raimondii
ref|XP_008224698.1|  PREDICTED: aspartic proteinase-like                341   8e-111   Prunus mume [ume]
gb|KHG11144.1|  Aspartic proteinase                                     340   1e-110   Gossypium arboreum [tree cotton]
gb|KJB67244.1|  hypothetical protein B456_010G182400                    340   1e-110   Gossypium raimondii
ref|XP_002518445.1|  Aspartic proteinase precursor, putative            340   2e-110   Ricinus communis
ref|XP_007211538.1|  hypothetical protein PRUPE_ppa003924mg             340   3e-110   Prunus persica
emb|CAA54478.1|  aspartic protease                                      332   4e-110   Brassica oleracea
gb|KJB69259.1|  hypothetical protein B456_011G012800                    338   9e-110   Gossypium raimondii
dbj|BAD93734.1|  putative aspartic proteinase                           327   1e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KJB69260.1|  hypothetical protein B456_011G012800                    338   1e-109   Gossypium raimondii
ref|XP_011086197.1|  PREDICTED: aspartic proteinase A1-like isofo...    337   2e-109   Sesamum indicum [beniseed]
ref|XP_002529926.1|  Aspartic proteinase precursor, putative            337   3e-109   Ricinus communis
ref|XP_010244477.1|  PREDICTED: aspartic proteinase A1-like isofo...    337   3e-109   Nelumbo nucifera [Indian lotus]
ref|XP_010096873.1|  Aspartic proteinase                                337   4e-109   Morus notabilis
ref|XP_010244475.1|  PREDICTED: aspartic proteinase A1-like isofo...    337   4e-109   Nelumbo nucifera [Indian lotus]
ref|XP_011086196.1|  PREDICTED: aspartic proteinase A1-like isofo...    338   4e-109   Sesamum indicum [beniseed]
gb|ACX55830.1|  aspartic proteinase 2                                   335   1e-108   Castanea mollissima
gb|ACX55829.1|  aspartic proteinase 1                                   335   2e-108   Castanea mollissima
ref|XP_010035554.1|  PREDICTED: aspartic proteinase A1-like             335   2e-108   Eucalyptus grandis [rose gum]
ref|XP_008349314.1|  PREDICTED: aspartic proteinase-like                335   2e-108   
ref|XP_007020768.1|  Aspartic proteinase A1                             335   2e-108   
ref|XP_007153977.1|  hypothetical protein PHAVU_003G0808001g            330   3e-108   Phaseolus vulgaris [French bean]
gb|KHG11143.1|  Aspartic proteinase                                     334   3e-108   Gossypium arboreum [tree cotton]
emb|CAC86003.1|  aspartic proteinase                                    334   3e-108   Theobroma cacao [chocolate]
gb|KCW66977.1|  hypothetical protein EUGRSUZ_F00741                     330   4e-108   Eucalyptus grandis [rose gum]
gb|KCW77002.1|  hypothetical protein EUGRSUZ_D01351                     334   4e-108   Eucalyptus grandis [rose gum]
ref|XP_009357472.1|  PREDICTED: aspartic proteinase-like                333   5e-108   Pyrus x bretschneideri [bai li]
ref|XP_002279049.1|  PREDICTED: aspartic proteinase A1                  333   5e-108   Vitis vinifera
ref|XP_010052871.1|  PREDICTED: aspartic proteinase                     334   5e-108   Eucalyptus grandis [rose gum]
ref|XP_003534602.1|  PREDICTED: aspartic proteinase                     333   6e-108   Glycine max [soybeans]
gb|KHN33009.1|  Aspartic proteinase                                     333   6e-108   Glycine soja [wild soybean]
ref|XP_006449766.1|  hypothetical protein CICLE_v10014941mg             333   7e-108   Citrus clementina [clementine]
ref|XP_009415269.1|  PREDICTED: aspartic proteinase oryzasin-1-like     333   8e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003546159.1|  PREDICTED: aspartic proteinase-like                333   9e-108   Glycine max [soybeans]
ref|XP_009110686.1|  PREDICTED: aspartic proteinase A1-like             332   1e-107   Brassica rapa
ref|XP_006452415.1|  hypothetical protein CICLE_v10008027mg             333   1e-107   Citrus clementina [clementine]
ref|XP_008385865.1|  PREDICTED: aspartic proteinase A1-like             323   1e-107   
dbj|BAH20208.1|  AT1G11910                                              328   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006475035.1|  PREDICTED: aspartic proteinase-like                333   1e-107   Citrus sinensis [apfelsine]
gb|KDO62068.1|  hypothetical protein CISIN_1g010230mg                   332   1e-107   Citrus sinensis [apfelsine]
dbj|BAB20970.1|  aspartic proteinase 2                                  333   1e-107   Nepenthes alata
ref|XP_011046729.1|  PREDICTED: aspartic proteinase A1-like             332   2e-107   Populus euphratica
ref|XP_006467405.1|  PREDICTED: aspartic proteinase-like isoform X2     332   2e-107   Citrus sinensis [apfelsine]
ref|XP_008348384.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    330   2e-107   
gb|ABO93618.1|  aspartic proteinase                                     321   2e-107   Vitis vinifera
emb|CDY21021.1|  BnaA08g25040D                                          332   2e-107   Brassica napus [oilseed rape]
ref|XP_007049085.1|  Aspartic protease isoform 2                        332   3e-107   
gb|AAB03108.1|  aspartic protease                                       331   4e-107   Brassica napus [oilseed rape]
emb|CDY31221.1|  BnaC08g15160D                                          333   6e-107   Brassica napus [oilseed rape]
ref|XP_007049084.1|  Aspartic proteinase A1 isoform 1                   332   9e-107   
ref|XP_006467404.1|  PREDICTED: aspartic proteinase-like isoform X1     333   1e-106   
ref|NP_172655.1|  aspartic proteinase A1                                330   2e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49730.1|  aspartic proteinase                                     329   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892661.1|  aspartyl protease family protein                   329   2e-106   
ref|XP_010546667.1|  PREDICTED: aspartic proteinase A1-like             329   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_011461056.1|  PREDICTED: aspartic proteinase A1-like             329   2e-106   Fragaria vesca subsp. vesca
ref|XP_009361022.1|  PREDICTED: aspartic proteinase A1-like             329   3e-106   Pyrus x bretschneideri [bai li]
ref|XP_010476135.1|  PREDICTED: aspartic proteinase A1-like             329   3e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010458606.1|  PREDICTED: aspartic proteinase A1                  329   3e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010060310.1|  PREDICTED: aspartic proteinase A1-like             329   3e-106   Eucalyptus grandis [rose gum]
ref|XP_002298827.2|  aspartic protease family protein                   329   3e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006417290.1|  hypothetical protein EUTSA_v10007418mg             328   5e-106   Eutrema salsugineum [saltwater cress]
gb|AGP76185.1|  aspartic proteinase                                     328   5e-106   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010493478.1|  PREDICTED: aspartic proteinase A1-like             328   5e-106   Camelina sativa [gold-of-pleasure]
ref|XP_006303952.1|  hypothetical protein CARUB_v10008798mg             329   7e-106   
ref|XP_009118162.1|  PREDICTED: aspartic proteinase A1                  328   9e-106   Brassica rapa
gb|KJB13720.1|  hypothetical protein B456_002G091100                    323   1e-105   Gossypium raimondii
emb|CDY34819.1|  BnaA09g47450D                                          330   2e-105   Brassica napus [oilseed rape]
ref|XP_008380299.1|  PREDICTED: aspartic proteinase A1-like             327   2e-105   
dbj|BAB20969.1|  aspartic proteinase 1                                  327   2e-105   Nepenthes alata
ref|XP_008357943.1|  PREDICTED: aspartic proteinase A1-like             323   3e-105   
gb|KJB67247.1|  hypothetical protein B456_010G182400                    327   3e-105   Gossypium raimondii
gb|KDP39159.1|  hypothetical protein JCGZ_00916                         326   4e-105   Jatropha curcas
gb|ACN24614.1|  aspartic acid protease                                  326   6e-105   Phaseolus vulgaris [French bean]
gb|KHN35722.1|  Aspartic proteinase                                     325   1e-104   Glycine soja [wild soybean]
gb|KHG05834.1|  Asparticase                                             325   1e-104   Gossypium arboreum [tree cotton]
gb|KEH36904.1|  fungal proteinase A, aspartic proteinase superfam...    325   2e-104   Medicago truncatula
ref|XP_007147707.1|  hypothetical protein PHAVU_006G147900g             326   2e-104   Phaseolus vulgaris [French bean]
gb|KJB13722.1|  hypothetical protein B456_002G091100                    323   2e-104   Gossypium raimondii
emb|CAM12780.1|  aspartic proteinase                                    324   3e-104   Fagopyrum esculentum
gb|AAV84085.2|  aspartic proteinase 9                                   324   3e-104   Fagopyrum esculentum
ref|XP_006389579.1|  aspartic endopeptidase family protein              324   3e-104   Populus trichocarpa [western balsam poplar]
gb|AFW81161.1|  hypothetical protein ZEAMMB73_941917                    315   3e-104   
gb|AAB03843.2|  aspartic proteinase                                     324   4e-104   Vigna unguiculata
ref|XP_003529645.1|  PREDICTED: aspartic proteinase-like isoform X1     323   6e-104   Glycine max [soybeans]
ref|XP_004486175.1|  PREDICTED: aspartic proteinase-like isoform X1     323   7e-104   Cicer arietinum [garbanzo]
ref|XP_007211824.1|  hypothetical protein PRUPE_ppa004375mg             323   7e-104   Prunus persica
gb|KJB13718.1|  hypothetical protein B456_002G091100                    323   7e-104   Gossypium raimondii
ref|XP_011008023.1|  PREDICTED: aspartic proteinase-like                323   7e-104   Populus euphratica
ref|XP_008226860.1|  PREDICTED: aspartic proteinase A1-like             323   8e-104   Prunus mume [ume]
ref|XP_006383885.1|  hypothetical protein POPTR_0004s00900g             324   9e-104   
ref|XP_006600236.1|  PREDICTED: aspartic proteinase 1 isoform X1        323   9e-104   
ref|XP_003567869.1|  PREDICTED: phytepsin                               322   9e-104   Brachypodium distachyon [annual false brome]
ref|XP_008797519.1|  PREDICTED: aspartic proteinase oryzasin-1-like     323   9e-104   Phoenix dactylifera
gb|KHN03495.1|  Aspartic proteinase                                     322   1e-103   Glycine soja [wild soybean]
ref|XP_008366439.1|  PREDICTED: aspartic proteinase A1-like isofo...    323   1e-103   
ref|XP_006447588.1|  hypothetical protein CICLE_v10017754mg             322   1e-103   
ref|NP_001237064.1|  aspartic proteinase 1 precursor                    322   1e-103   
ref|XP_008366438.1|  PREDICTED: aspartic proteinase A1-like isofo...    322   1e-103   
ref|XP_009358756.1|  PREDICTED: aspartic proteinase-like                322   2e-103   Pyrus x bretschneideri [bai li]
pdb|1QDM|A  Chain A, Crystal Structure Of Prophytepsin, A Zymogen...    321   2e-103   Hordeum vulgare [barley]
ref|XP_004507671.1|  PREDICTED: aspartic proteinase-like isoform X1     322   2e-103   Cicer arietinum [garbanzo]
gb|KDO54710.1|  hypothetical protein CISIN_1g009634mg                   321   2e-103   Citrus sinensis [apfelsine]
ref|XP_010926197.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    322   3e-103   Elaeis guineensis
gb|KDO54711.1|  hypothetical protein CISIN_1g009634mg                   322   3e-103   Citrus sinensis [apfelsine]
ref|XP_008800700.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    321   3e-103   Phoenix dactylifera
ref|XP_008229973.1|  PREDICTED: aspartic proteinase A1-like             321   3e-103   Prunus mume [ume]
ref|XP_006469663.1|  PREDICTED: aspartic proteinase-like                321   3e-103   Citrus sinensis [apfelsine]
sp|P42210.1|ASPR_HORVU  RecName: Full=Phytepsin; AltName: Full=As...    321   4e-103   Hordeum vulgare [barley]
ref|XP_008800699.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    322   7e-103   Phoenix dactylifera
ref|XP_008371074.1|  PREDICTED: aspartic proteinase                     320   8e-103   
ref|XP_008664893.1|  PREDICTED: aspartic proteinase oryzasin-1-like     313   1e-102   Zea mays [maize]
ref|XP_006654801.1|  PREDICTED: aspartic proteinase oryzasin-1-like     320   1e-102   
dbj|BAE20413.1|  aspartic proteinase                                    319   2e-102   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009347130.1|  PREDICTED: aspartic proteinase A1-like             319   2e-102   Pyrus x bretschneideri [bai li]
ref|XP_010046321.1|  PREDICTED: aspartic proteinase A1-like             319   2e-102   Eucalyptus grandis [rose gum]
emb|CAA57510.1|  cyprosin                                               319   2e-102   Cynara cardunculus [cardoon]
gb|AFK46704.1|  unknown                                                 319   3e-102   Medicago truncatula
ref|XP_011046961.1|  PREDICTED: aspartic proteinase-like                319   3e-102   Populus euphratica
ref|XP_010924299.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    320   3e-102   
gb|KJB22150.1|  hypothetical protein B456_004G031800                    318   4e-102   Gossypium raimondii
gb|AFW79207.1|  hypothetical protein ZEAMMB73_486493                    314   4e-102   
gb|AFW85769.1|  hypothetical protein ZEAMMB73_486102                    310   5e-102   
dbj|BAB20971.1|  aspartic proteinase 3                                  318   5e-102   Nepenthes alata
ref|XP_009353298.1|  PREDICTED: aspartic proteinase A1-like             318   5e-102   Pyrus x bretschneideri [bai li]
emb|CAA70340.1|  aspartic proteinase                                    318   7e-102   Centaurea calcitrapa
ref|XP_010553449.1|  PREDICTED: aspartic proteinase A1                  318   9e-102   Tarenaya hassleriana [spider flower]
ref|XP_007215237.1|  hypothetical protein PRUPE_ppa004349mg             317   1e-101   Prunus persica
ref|NP_001056348.1|  Os05g0567100                                       317   2e-101   
ref|XP_010473444.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    316   2e-101   
ref|XP_008660718.1|  PREDICTED: aspartic proteinase oryzasin-1-like     309   4e-101   
ref|XP_010430270.1|  PREDICTED: aspartic proteinase A2-like             316   5e-101   Camelina sativa [gold-of-pleasure]
gb|KHG04193.1|  Asparticase                                             316   5e-101   Gossypium arboreum [tree cotton]
ref|XP_003610462.1|  Aspartic proteinase                                316   6e-101   Medicago truncatula
dbj|BAA96446.1|  aspartic endopeptidase                                 307   7e-101   Pyrus pyrifolia [sha li]
gb|KJB13723.1|  hypothetical protein B456_002G091100                    315   9e-101   Gossypium raimondii
dbj|BAA06876.1|  aspartic protease                                      315   9e-101   Oryza sativa [red rice]
ref|XP_008647844.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    315   1e-100   Zea mays [maize]
ref|XP_002886481.1|  aspartyl protease family protein                   315   1e-100   
ref|XP_009395027.1|  PREDICTED: aspartic proteinase oryzasin-1-like     315   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006391910.1|  hypothetical protein EUTSA_v10023414mg             314   2e-100   Eutrema salsugineum [saltwater cress]
gb|AGE15494.1|  preprosilpepsin 1                                       314   2e-100   Silybum marianum [holy thistle]
ref|XP_004961190.1|  PREDICTED: aspartic proteinase oryzasin-1-like     314   2e-100   Setaria italica
ref|NP_176419.2|  aspartic proteinase A2                                314   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838131.1|  hypothetical protein AMTR_s00106p00075970          314   3e-100   Amborella trichopoda
ref|XP_009410967.1|  PREDICTED: aspartic proteinase oryzasin-1-like     313   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008342027.1|  PREDICTED: aspartic proteinase A1-like             314   3e-100   Malus domestica [apple tree]
ref|NP_001148782.1|  aspartic proteinase oryzasin-1 precursor           313   5e-100   Zea mays [maize]
ref|XP_006301275.1|  hypothetical protein CARUB_v10021675mg             313   5e-100   Capsella rubella
gb|KDO62069.1|  hypothetical protein CISIN_1g010230mg                   313   6e-100   Citrus sinensis [apfelsine]
ref|XP_010418214.1|  PREDICTED: aspartic proteinase A2 isoform X2       311   9e-100   Camelina sativa [gold-of-pleasure]
tpg|DAA63137.1|  TPA: hypothetical protein ZEAMMB73_794362              315   9e-100   
ref|XP_008650245.1|  PREDICTED: aspartic proteinase oryzasin-1-like     305   1e-99    
ref|XP_010686810.1|  PREDICTED: aspartic proteinase A1-like             312   1e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011100273.1|  PREDICTED: cyprosin-like                           311   2e-99    Sesamum indicum [beniseed]
ref|XP_010418210.1|  PREDICTED: aspartic proteinase A2 isoform X1       311   2e-99    Camelina sativa [gold-of-pleasure]
ref|NP_001150729.1|  aspartic proteinase oryzasin-1 precursor           311   3e-99    Zea mays [maize]
ref|XP_010667516.1|  PREDICTED: aspartic proteinase A1-like             310   6e-99    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY24888.1|  BnaA03g59920D                                          310   9e-99    Brassica napus [oilseed rape]
gb|AFB73927.2|  preprocirsin                                            308   2e-98    Cirsium vulgare
emb|CAA48939.1|  cyprosin                                               307   3e-98    Cynara cardunculus [cardoon]
emb|CDY08632.1|  BnaC04g19410D                                          308   6e-98    Brassica napus [oilseed rape]
ref|XP_009600571.1|  PREDICTED: cyprosin-like                           307   6e-98    Nicotiana tomentosiformis
gb|EYU34027.1|  hypothetical protein MIMGU_mgv1a024943mg                303   7e-98    Erythranthe guttata [common monkey flower]
ref|XP_004287958.1|  PREDICTED: aspartic proteinase A1-like             308   7e-98    Fragaria vesca subsp. vesca
ref|XP_004243484.1|  PREDICTED: cyprosin-like                           307   7e-98    Solanum lycopersicum
gb|AHB32105.1|  aspartic proteinase                                     307   8e-98    Camellia sinensis [black tea]
gb|AFH58568.1|  aspartic acid protease                                  307   9e-98    Ananas comosus
ref|XP_009123370.1|  PREDICTED: aspartic proteinase A2 isoform X2       307   1e-97    Brassica rapa
ref|XP_004293311.1|  PREDICTED: aspartic proteinase A1                  307   1e-97    Fragaria vesca subsp. vesca
ref|XP_009123365.1|  PREDICTED: aspartic proteinase A2 isoform X1       307   1e-97    Brassica rapa
gb|AFW74920.1|  hypothetical protein ZEAMMB73_522985                    305   1e-97    
ref|XP_009394234.1|  PREDICTED: aspartic proteinase oryzasin-1-like     306   4e-97    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABG37021.1|  aspartic protease                                       305   4e-97    Nicotiana tabacum [American tobacco]
ref|XP_006840365.1|  hypothetical protein AMTR_s00045p00122510          304   1e-96    Amborella trichopoda
dbj|BAA76870.1|  aspartic proteinase                                    304   2e-96    Helianthus annuus
ref|XP_009419881.1|  PREDICTED: aspartic proteinase oryzasin-1-like     304   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFX73039.1|  preprogaline A                                          302   7e-96    Galium verum
ref|XP_006364164.1|  PREDICTED: aspartic proteinase-like                301   2e-95    Solanum tuberosum [potatoes]
ref|XP_004151126.1|  PREDICTED: aspartic proteinase-like                301   2e-95    Cucumis sativus [cucumbers]
ref|XP_004161880.1|  PREDICTED: aspartic proteinase-like                301   2e-95    
ref|XP_007020767.1|  Aspartic proteinase A1                             300   2e-95    
ref|XP_006644474.1|  PREDICTED: aspartic proteinase oryzasin-1-like     301   3e-95    
ref|XP_004969436.1|  PREDICTED: aspartic proteinase oryzasin-1-like     300   3e-95    Setaria italica
emb|CDP10762.1|  unnamed protein product                                300   7e-95    Coffea canephora [robusta coffee]
gb|KGN64503.1|  Aspartic proteinase                                     299   1e-94    
gb|KDP24853.1|  hypothetical protein JCGZ_24447                         299   1e-94    Jatropha curcas
ref|XP_011006459.1|  PREDICTED: cyprosin-like isoform X2                296   1e-93    Populus euphratica
ref|NP_001043786.1|  Os01g0663400                                       296   2e-93    
ref|XP_011006458.1|  PREDICTED: cyprosin-like isoform X1                296   4e-93    Populus euphratica
dbj|BAC16370.1|  aspartic proteinase 4                                  282   1e-92    Glycine max [soybeans]
ref|XP_010455726.1|  PREDICTED: aspartic proteinase A3 isoform X1       294   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_009114573.1|  PREDICTED: aspartic proteinase A3 isoform X2       293   2e-92    Brassica rapa
ref|XP_010496363.1|  PREDICTED: aspartic proteinase A3-like             293   2e-92    
ref|XP_009114571.1|  PREDICTED: aspartic proteinase A3 isoform X1       293   2e-92    Brassica rapa
ref|XP_008784384.1|  PREDICTED: aspartic proteinase oryzasin-1-like     293   2e-92    Phoenix dactylifera
ref|XP_002302872.2|  aspartic endopeptidase family protein              293   2e-92    
emb|CDY16668.1|  BnaA09g20460D                                          293   2e-92    Brassica napus [oilseed rape]
ref|XP_002872693.1|  aspartyl protease family protein                   293   3e-92    
gb|AFX73042.1|  preprofigain C                                          289   4e-92    Ficus carica
emb|CDX94554.1|  BnaC09g22820D                                          293   4e-92    
ref|XP_010432791.1|  PREDICTED: aspartic proteinase A3-like isofo...    292   5e-92    Camelina sativa [gold-of-pleasure]
ref|NP_192355.1|  aspartic proteinase A3                                291   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396692.1|  hypothetical protein EUTSA_v10028587mg             290   3e-91    Eutrema salsugineum [saltwater cress]
ref|XP_006396693.1|  hypothetical protein EUTSA_v10028587mg             290   3e-91    Eutrema salsugineum [saltwater cress]
gb|KDO45252.1|  hypothetical protein CISIN_1g010486mg                   283   5e-91    Citrus sinensis [apfelsine]
sp|P40782.2|CYPR1_CYNCA  RecName: Full=Cyprosin; Flags: Precursor       288   1e-90    Cynara cardunculus [cardoon]
ref|XP_010233477.1|  PREDICTED: aspartic proteinase oryzasin-1-like     288   2e-90    
gb|EMS54428.1|  Aspartic proteinase oryzasin-1                          288   2e-90    Triticum urartu
ref|XP_006428329.1|  hypothetical protein CICLE_v10011525mg             288   3e-90    Citrus clementina [clementine]
gb|KDO45249.1|  hypothetical protein CISIN_1g010486mg                   284   6e-90    Citrus sinensis [apfelsine]
gb|KDO45250.1|  hypothetical protein CISIN_1g010486mg                   283   6e-90    Citrus sinensis [apfelsine]
gb|ABK26865.1|  unknown                                                 279   8e-90    Picea sitchensis
gb|AFX73041.1|  preprofigain B                                          282   1e-89    Ficus carica
ref|XP_010926196.1|  PREDICTED: aspartic proteinase oryzasin-1-like     285   4e-89    
ref|XP_010455729.1|  PREDICTED: aspartic proteinase A3 isoform X2       284   6e-89    Camelina sativa [gold-of-pleasure]
gb|KDO45247.1|  hypothetical protein CISIN_1g010486mg                   283   1e-88    Citrus sinensis [apfelsine]
gb|KDO62072.1|  hypothetical protein CISIN_1g010230mg                   283   2e-88    Citrus sinensis [apfelsine]
gb|AAK55849.1|AF266465_1  aspartic protease                             271   2e-88    Manihot esculenta [manioc]
gb|KDO45246.1|  hypothetical protein CISIN_1g010486mg                   283   2e-88    Citrus sinensis [apfelsine]
ref|XP_010432806.1|  PREDICTED: aspartic proteinase A3-like isofo...    283   3e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006286432.1|  hypothetical protein CARUB_v10003637mg             282   3e-88    
ref|NP_001190671.1|  aspartic proteinase A3                             282   5e-88    Arabidopsis thaliana [mouse-ear cress]
gb|EMT17680.1|  Phytepsin                                               280   6e-88    
ref|XP_008800325.1|  PREDICTED: aspartic proteinase-like isoform X1     281   1e-87    Phoenix dactylifera
ref|XP_008800328.1|  PREDICTED: aspartic proteinase-like isoform X2     281   1e-87    
gb|AGE15495.1|  preprosilpepsin 2                                       281   2e-87    Silybum marianum [holy thistle]
ref|XP_010916100.1|  PREDICTED: aspartic proteinase oryzasin-1-like     281   2e-87    Elaeis guineensis
ref|XP_009390744.1|  PREDICTED: aspartic proteinase oryzasin-1-like     280   4e-87    
gb|KDO78303.1|  hypothetical protein CISIN_1g010233mg                   279   6e-87    Citrus sinensis [apfelsine]
emb|CDX90864.1|  BnaA03g25440D                                          278   1e-86    
ref|XP_009134301.1|  PREDICTED: aspartic proteinase A3-like             278   1e-86    Brassica rapa
ref|XP_009421489.1|  PREDICTED: aspartic proteinase oryzasin-1-like     278   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAV84086.1|  aspartic proteinase 12                                  274   2e-86    Fagopyrum esculentum
ref|XP_011039044.1|  PREDICTED: aspartic proteinase-like                278   2e-86    Populus euphratica
gb|KHG16917.1|  Asparticase                                             278   4e-86    Gossypium arboreum [tree cotton]
ref|XP_002307027.2|  hypothetical protein POPTR_0005s00460g             275   5e-86    
gb|EEC78484.1|  hypothetical protein OsI_18377                          272   2e-85    Oryza sativa Indica Group [Indian rice]
gb|ABR16259.1|  unknown                                                 274   5e-85    Picea sitchensis
gb|AFW57535.1|  hypothetical protein ZEAMMB73_218341                    267   5e-85    
ref|XP_010529449.1|  PREDICTED: aspartic proteinase A3                  274   6e-85    Tarenaya hassleriana [spider flower]
gb|KJB13719.1|  hypothetical protein B456_002G091100                    273   8e-85    Gossypium raimondii
gb|AFX67029.1|  aspartic protease                                       269   1e-84    Solanum tuberosum [potatoes]
ref|XP_008370344.1|  PREDICTED: aspartic proteinase-like                273   1e-84    
ref|NP_001234702.1|  aspartic protease precursor                        273   1e-84    Solanum lycopersicum
ref|XP_009416572.1|  PREDICTED: aspartic proteinase-like isoform X2     273   2e-84    
ref|NP_001054586.1|  Os05g0137400                                       272   2e-84    
dbj|BAA02242.1|  aspartic proteinase                                    272   2e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009416564.1|  PREDICTED: aspartic proteinase-like isoform X1     273   3e-84    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP15176.1|  unnamed protein product                                272   4e-84    Coffea canephora [robusta coffee]
ref|XP_009366025.1|  PREDICTED: aspartic proteinase-like isoform X3     271   7e-84    Pyrus x bretschneideri [bai li]
ref|XP_009366023.1|  PREDICTED: aspartic proteinase-like isoform X1     271   9e-84    Pyrus x bretschneideri [bai li]
ref|XP_009366024.1|  PREDICTED: aspartic proteinase-like isoform X2     271   1e-83    Pyrus x bretschneideri [bai li]
emb|CBI39668.3|  unnamed protein product                                268   1e-83    Vitis vinifera
ref|XP_010042427.1|  PREDICTED: aspartic proteinase-like isoform X2     270   1e-83    Eucalyptus grandis [rose gum]
ref|XP_010232062.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    272   2e-83    
ref|NP_001275049.1|  Asp precursor                                      270   2e-83    Solanum tuberosum [potatoes]
ref|XP_008440022.1|  PREDICTED: aspartic proteinase-like isoform X2     270   2e-83    
gb|AFX73040.1|  preprofigain A                                          270   3e-83    
ref|XP_011023864.1|  PREDICTED: aspartic proteinase-like                270   3e-83    
ref|XP_003568979.1|  PREDICTED: aspartic proteinase                     269   4e-83    
ref|XP_008440021.1|  PREDICTED: aspartic proteinase-like isoform X1     270   6e-83    
gb|KDP23334.1|  hypothetical protein JCGZ_23167                         269   6e-83    
ref|XP_010042419.1|  PREDICTED: aspartic proteinase-like isoform X1     270   6e-83    
ref|XP_003633616.1|  PREDICTED: cyprosin-like isoform X2                269   8e-83    
ref|XP_009608676.1|  PREDICTED: cyprosin-like                           268   9e-83    
ref|XP_010659757.1|  PREDICTED: cyprosin-like isoform X1                269   9e-83    
ref|XP_003567538.1|  PREDICTED: aspartic proteinase-like                268   1e-82    
ref|XP_007031269.1|  Aspartic proteinase                                268   1e-82    
ref|XP_008246320.1|  PREDICTED: aspartic proteinase-like                268   1e-82    
dbj|BAG16519.1|  putative aspartic protease                             268   2e-82    
ref|XP_002512581.1|  Aspartic proteinase precursor, putative            267   2e-82    
ref|NP_001146573.1|  hypothetical protein                               267   2e-82    
gb|EMS45962.1|  Aspartic proteinase                                     267   3e-82    
dbj|BAE20414.1|  aspartic proteinase                                    267   3e-82    
ref|XP_008661830.1|  PREDICTED: hypothetical protein isoform X1         267   3e-82    
ref|XP_010232061.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    268   4e-82    
gb|EEC70447.1|  hypothetical protein OsI_01478                          266   4e-82    
ref|XP_004134774.1|  PREDICTED: aspartic proteinase-like                267   4e-82    
ref|XP_009771336.1|  PREDICTED: aspartic proteinase A1-like isofo...    266   5e-82    
dbj|BAJ85473.1|  predicted protein                                      266   7e-82    
ref|XP_009771335.1|  PREDICTED: aspartic proteinase A1-like isofo...    266   7e-82    
ref|XP_007207363.1|  hypothetical protein PRUPE_ppa004505mg             266   8e-82    
gb|ADE74632.1|  aspartic protease 1                                     266   8e-82    
ref|XP_009801963.1|  PREDICTED: cyprosin-like                           266   9e-82    
ref|XP_010909333.1|  PREDICTED: aspartic proteinase-like                266   1e-81    
ref|XP_008646647.1|  PREDICTED: aspartic proteinase oryzasin-1-like     259   2e-81    
gb|AAT77954.1|  Asp                                                     265   2e-81    
ref|NP_001042785.1|  Os01g0290000                                       264   2e-81    
ref|XP_002319454.2|  aspartic proteinase 2                              265   2e-81    
ref|XP_006654022.1|  PREDICTED: aspartic proteinase-like                263   6e-81    
ref|XP_004960420.1|  PREDICTED: aspartic proteinase-like                263   7e-81    
ref|XP_004967621.1|  PREDICTED: aspartic proteinase-like isoform X1     263   8e-81    
ref|NP_001152501.1|  retrotransposon protein SINE subclass precursor    263   2e-80    
gb|ACF87177.1|  unknown                                                 262   2e-80    
ref|XP_004302331.1|  PREDICTED: aspartic proteinase-like                263   2e-80    
gb|ACL54337.1|  unknown                                                 262   2e-80    
gb|KJB26285.1|  hypothetical protein B456_004G235200                    263   2e-80    
ref|XP_010324003.1|  PREDICTED: aspartic protease precursor isofo...    263   2e-80    
gb|ABI78942.1|  aspartic protease                                       262   2e-80    
ref|XP_008655134.1|  PREDICTED: retrotransposon protein SINE subc...    262   6e-80    
ref|XP_010539213.1|  PREDICTED: aspartic proteinase A3-like isofo...    261   7e-80    
ref|XP_001767404.1|  predicted protein                                  260   1e-79    
emb|CAL07969.1|  aspartic proteinase                                    260   1e-79    
ref|XP_010539208.1|  PREDICTED: aspartic proteinase A3-like isofo...    261   1e-79    
gb|KHG03187.1|  Asparticase                                             261   1e-79    
gb|EYU19381.1|  hypothetical protein MIMGU_mgv1a004925mg                259   2e-79    
ref|XP_011087561.1|  PREDICTED: aspartic proteinase-like isoform X2     259   3e-79    
ref|XP_011087560.1|  PREDICTED: aspartic proteinase-like isoform X1     259   3e-79    
gb|EEE62252.1|  hypothetical protein OsJ_17039                          258   8e-79    
emb|CAN65745.1|  hypothetical protein VITISV_037763                     257   2e-78    
emb|CAE52913.1|  putative vacuaolar aspartic proteinase                 257   2e-78    
dbj|BAB20972.1|  aspartic proteinase 4                                  256   4e-78    
gb|KGN56078.1|  hypothetical protein Csa_3G066750                       257   4e-78    
ref|XP_009619375.1|  PREDICTED: cyprosin-like isoform X2                256   5e-78    
dbj|BAA76427.1|  aspartic proteinase                                    246   5e-78    
ref|XP_009619374.1|  PREDICTED: cyprosin-like isoform X1                256   7e-78    
gb|EPS60672.1|  aspartic proteinase 1                                   243   1e-77    
ref|XP_004969250.1|  PREDICTED: aspartic proteinase oryzasin-1-like     256   1e-77    
ref|XP_004495808.1|  PREDICTED: aspartic proteinase-like                255   1e-77    
gb|AGT16815.1|  aspartic proteinase                                     256   2e-77    
sp|Q9XFX3.1|CARDA_CYNCA  RecName: Full=Procardosin-A; Contains: R...    254   2e-77    
gb|ABD33216.1|  Peptidase A1, pepsin                                    250   6e-77    
gb|EMT14628.1|  Aspartic proteinase oryzasin-1                          254   6e-77    
gb|EPS68187.1|  aspartic protease                                       253   7e-77    
gb|AGT16793.1|  aspartic protease                                       254   8e-77    
gb|KEH43130.1|  fungal proteinase A, aspartic proteinase superfam...    253   1e-76    
ref|XP_002992068.1|  hypothetical protein SELMODRAFT_186535             252   2e-76    
ref|XP_010659762.1|  PREDICTED: aspartic proteinase A1 isoform X2       251   3e-76    
ref|XP_003626143.1|  Aspartic proteinase                                250   4e-76    
ref|XP_002276363.3|  PREDICTED: aspartic proteinase A1 isoform X1       251   7e-76    
dbj|BAD94980.1|  putative aspartic proteinase                           239   7e-76    
ref|XP_002964101.1|  hypothetical protein SELMODRAFT_166719             250   7e-76    
ref|XP_003626142.1|  Aspartic proteinase                                250   8e-76    
ref|NP_001169605.1|  uncharacterized protein LOC100383486 precursor     251   1e-75    
gb|AES82362.2|  fungal proteinase A, aspartic proteinase superfam...    250   1e-75    
ref|XP_002456011.1|  hypothetical protein SORBIDRAFT_03g028820          251   1e-75    
emb|CDM83463.1|  unnamed protein product                                251   1e-75    
sp|Q9XFX4.1|CARDB_CYNCA  RecName: Full=Procardosin-B; Contains: R...    249   3e-75    
emb|CDY28542.1|  BnaC02g36180D                                          238   3e-75    
gb|KHN26195.1|  Aspartic proteinase                                     248   4e-75    
ref|XP_003555776.1|  PREDICTED: aspartic proteinase isoform X1          248   5e-75    
ref|XP_007145043.1|  hypothetical protein PHAVU_007G205100g             247   1e-74    
ref|XP_008673210.1|  PREDICTED: uncharacterized protein LOC100383...    248   2e-74    
ref|XP_003521645.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    247   2e-74    
ref|XP_001769293.1|  predicted protein                                  246   2e-74    
ref|XP_003536026.1|  PREDICTED: aspartic proteinase-like isoform X1     246   4e-74    
ref|XP_004494508.1|  PREDICTED: aspartic proteinase-like isoform X1     246   4e-74    
ref|XP_008673209.1|  PREDICTED: uncharacterized protein LOC100383...    247   6e-74    
ref|XP_010674482.1|  PREDICTED: aspartic proteinase-like                245   6e-74    
ref|XP_009780973.1|  PREDICTED: aspartic proteinase A1-like             234   6e-74    
ref|XP_002961603.1|  hypothetical protein SELMODRAFT_230037             243   6e-74    
gb|EMT27697.1|  Aspartic proteinase oryzasin-1                          246   7e-74    
ref|XP_006603753.1|  PREDICTED: aspartic proteinase 2 isoform X1        244   2e-73    
ref|NP_001237345.1|  aspartic proteinase 2                              244   2e-73    
gb|KHN43373.1|  Aspartic proteinase                                     244   2e-73    
gb|AAK48494.1|AF259982_1  putative aspartic protease                    244   3e-73    
ref|XP_002971198.1|  hypothetical protein SELMODRAFT_147484             241   3e-73    
ref|XP_007163289.1|  hypothetical protein PHAVU_001G222100g             244   3e-73    
ref|XP_010271040.1|  PREDICTED: aspartic proteinase-like isoform X1     243   5e-73    
ref|XP_004508063.1|  PREDICTED: aspartic proteinase oryzasin-1-like     242   1e-72    
ref|XP_008673208.1|  PREDICTED: uncharacterized protein LOC100383...    243   1e-72    
ref|XP_006644404.1|  PREDICTED: aspartic proteinase oryzasin-1-like     243   2e-72    
gb|AFX73038.1|  preprogaline A                                          241   3e-72    
ref|XP_010549203.1|  PREDICTED: aspartic proteinase A1-like isofo...    239   9e-72    
ref|XP_006419206.1|  hypothetical protein CICLE_v10004801mg             239   1e-71    
ref|XP_006488712.1|  PREDICTED: aspartic proteinase A2-like             239   1e-71    
ref|XP_010549201.1|  PREDICTED: aspartic proteinase A1-like isofo...    239   1e-71    
gb|KDO72241.1|  hypothetical protein CISIN_1g010195mg                   238   4e-71    
ref|XP_010511326.1|  PREDICTED: aspartic proteinase A1-like isofo...    238   4e-71    
gb|KDO72240.1|  hypothetical protein CISIN_1g010195mg                   238   5e-71    
ref|XP_010241437.1|  PREDICTED: cyprosin-like                           238   5e-71    
gb|KDO72239.1|  hypothetical protein CISIN_1g010195mg                   238   5e-71    
ref|XP_010094903.1|  Aspartic proteinase                                237   6e-71    
gb|KHN44864.1|  Cyprosin                                                232   1e-70    
ref|XP_002891994.1|  hypothetical protein ARALYDRAFT_314946             236   2e-70    
ref|XP_002519342.1|  Aspartic proteinase oryzasin-1 precursor, pu...    236   3e-70    
ref|XP_006302162.1|  hypothetical protein CARUB_v10020172mg             235   5e-70    
gb|AAC34854.1|  senescence-associated protein 4                         235   5e-70    
ref|XP_010271041.1|  PREDICTED: aspartic proteinase-like isoform X2     234   9e-70    
ref|XP_002964099.1|  hypothetical protein SELMODRAFT_142401             234   1e-69    
ref|XP_007036025.1|  Aspartic proteinase oryzasin-1, putative iso...    231   1e-69    
ref|XP_007036018.1|  Aspartic proteinase, putative isoform 1            234   1e-69    
ref|XP_008390340.1|  PREDICTED: aspartic proteinase-like                233   2e-69    
gb|AAT08741.1|  aspartic proteinase                                     222   2e-69    
ref|XP_010480290.1|  PREDICTED: aspartic proteinase A1-like             233   5e-69    
gb|KDP28021.1|  hypothetical protein JCGZ_19101                         233   5e-69    
ref|XP_002964100.1|  hypothetical protein SELMODRAFT_438819             232   8e-69    
ref|XP_007036023.1|  Aspartic proteinase oryzasin-1 isoform 1           232   1e-68    
gb|KEH32400.1|  fungal proteinase A, aspartic proteinase superfam...    231   1e-68    
ref|XP_008378421.1|  PREDICTED: aspartic proteinase-like isoform X2     231   2e-68    
ref|XP_009353444.1|  PREDICTED: aspartic proteinase oryzasin-1-like     231   2e-68    
ref|XP_008223613.1|  PREDICTED: aspartic proteinase-like                228   3e-67    
ref|XP_002314336.2|  aspartic proteinase 2                              227   5e-67    
ref|XP_004488186.1|  PREDICTED: aspartic proteinase-like isoform X3     221   6e-67    
gb|KCW46980.1|  hypothetical protein EUGRSUZ_K00787                     225   1e-66    
ref|XP_010999327.1|  PREDICTED: aspartic proteinase-like                226   2e-66    
gb|KDO62073.1|  hypothetical protein CISIN_1g010230mg                   224   3e-66    
ref|XP_007154514.1|  hypothetical protein PHAVU_003G125000g             225   3e-66    
gb|KHG02139.1|  hypothetical protein F383_24995                         225   3e-66    
ref|XP_003541325.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    225   4e-66    
gb|KHN45025.1|  Aspartic proteinase oryzasin-1                          225   4e-66    
dbj|BAC16371.1|  aspartic proteinase 5                                  215   4e-66    
ref|XP_006586643.1|  PREDICTED: uncharacterized protein LOC100500...    221   5e-66    
ref|XP_007138575.1|  hypothetical protein PHAVU_009G220600g             221   5e-66    
gb|KCW61404.1|  hypothetical protein EUGRSUZ_H04134                     220   6e-66    
gb|KJB28875.1|  hypothetical protein B456_005G073800                    224   6e-66    
gb|KJB67250.1|  hypothetical protein B456_010G182400                    223   7e-66    
ref|XP_004297063.1|  PREDICTED: cyprosin-like                           224   1e-65    
gb|KJB28874.1|  hypothetical protein B456_005G073800                    225   2e-65    
gb|EMS55205.1|  Aspartic proteinase oryzasin-1                          223   4e-65    
gb|KHN19190.1|  Aspartic proteinase oryzasin-1                          222   5e-65    
ref|XP_004488185.1|  PREDICTED: aspartic proteinase-like isoform X2     222   5e-65    
ref|XP_004488184.1|  PREDICTED: aspartic proteinase-like isoform X1     222   6e-65    
gb|KJB28876.1|  hypothetical protein B456_005G073900                    221   7e-65    
ref|XP_006586640.1|  PREDICTED: uncharacterized protein LOC100500...    222   7e-65    
ref|XP_007138576.1|  hypothetical protein PHAVU_009G220600g             221   9e-65    
ref|XP_010649704.1|  PREDICTED: aspartic proteinase                     221   1e-64    
gb|KHN04670.1|  Aspartic proteinase oryzasin-1                          221   1e-64    
ref|XP_003546541.1|  PREDICTED: aspartic proteinase A1-like isofo...    221   2e-64    
ref|XP_008378420.1|  PREDICTED: aspartic proteinase-like isoform X1     221   2e-64    
ref|XP_008378422.1|  PREDICTED: aspartic proteinase-like isoform X3     221   2e-64    
ref|XP_001768042.1|  predicted protein                                  219   2e-64    
ref|XP_009113359.1|  PREDICTED: aspartic proteinase oryzasin-1-like     220   3e-64    
ref|XP_006600421.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    220   3e-64    
gb|KDO78302.1|  hypothetical protein CISIN_1g010233mg                   219   3e-64    
emb|CDO98683.1|  unnamed protein product                                219   5e-64    
ref|XP_010024880.1|  PREDICTED: cyprosin-like                           220   8e-64    
ref|XP_010038033.1|  PREDICTED: cyprosin-like                           218   2e-63    
ref|XP_007036024.1|  Aspartic proteinase oryzasin-1 isoform 2           218   3e-63    
gb|EPS69682.1|  hypothetical protein M569_05082                         215   3e-62    
gb|KJB13726.1|  hypothetical protein B456_002G091100                    213   5e-62    
gb|KDO54714.1|  hypothetical protein CISIN_1g009634mg                   214   5e-62    
gb|ACU19920.1|  unknown                                                 204   6e-62    
emb|CDY21302.1|  BnaC03g29860D                                          215   2e-61    
ref|XP_004234022.1|  PREDICTED: aspartic proteinase A1                  212   4e-61    
dbj|BAD95255.1|  putative aspartic protease                             200   7e-61    
ref|XP_010694065.1|  PREDICTED: cyprosin-like                           210   1e-60    
ref|XP_010098748.1|  Aspartic proteinase                                209   2e-60    
ref|XP_003595434.1|  Aspartic proteinase                                208   1e-59    
gb|KEH37701.1|  fungal proteinase A, aspartic proteinase superfam...    208   1e-59    
gb|KEH37702.1|  fungal proteinase A, aspartic proteinase superfam...    208   2e-59    
ref|XP_008653243.1|  PREDICTED: aspartic proteinase oryzasin-1-like     199   3e-59    
gb|AGT17264.1|  aspartic proteinase                                     207   7e-59    
ref|XP_010511323.1|  PREDICTED: aspartic proteinase-like isoform X1     204   2e-58    
ref|XP_010415029.1|  PREDICTED: aspartic proteinase-like                204   3e-58    
ref|XP_010926216.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    203   4e-58    
ref|XP_009616098.1|  PREDICTED: cyprosin-like                           201   7e-57    
ref|XP_010480289.1|  PREDICTED: aspartic proteinase A1-like isofo...    199   1e-56    
gb|ABR25873.1|  retrotransposon protein, sine subclass, expressed       189   2e-56    
ref|XP_010480288.1|  PREDICTED: aspartic proteinase A1-like isofo...    199   5e-56    
ref|XP_009778402.1|  PREDICTED: cyprosin-like isoform X2                197   9e-56    
ref|XP_009778400.1|  PREDICTED: cyprosin-like isoform X1                198   9e-56    
ref|XP_009631812.1|  PREDICTED: cyprosin-like                           197   9e-56    
gb|ABQ41931.1|  aspartic proteinase 1                                   189   1e-55    
ref|XP_007223268.1|  hypothetical protein PRUPE_ppa004486mg             196   6e-55    
ref|XP_010271044.1|  PREDICTED: aspartic proteinase A1-like             195   1e-54    
gb|ABQ41932.1|  aspartic proteinase 1                                   186   2e-54    
gb|ABQ41930.1|  aspartic proteinase 1                                   186   2e-54    
gb|ABQ41933.1|  aspartic proteinase 1                                   186   2e-54    
gb|AAK82987.1|  aspartic protease                                       181   7e-54    
ref|XP_002524837.1|  Aspartic proteinase precursor, putative            191   1e-53    
ref|XP_010511324.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    192   1e-53    
gb|ACU22832.1|  unknown                                                 181   2e-53    
ref|XP_009769839.1|  PREDICTED: aspartic proteinase A1-like             187   5e-52    
ref|XP_006363462.1|  PREDICTED: aspartic proteinase oryzasin-1-like     186   2e-51    
ref|XP_004247609.1|  PREDICTED: cyprosin                                185   4e-51    
gb|ACS68654.1|  aspartic proteinase                                     170   1e-49    
ref|XP_010674517.1|  PREDICTED: aspartic proteinase-like isoform X2     179   4e-49    
ref|XP_010241434.1|  PREDICTED: aspartic proteinase-like isoform X4     179   2e-48    
ref|XP_010674515.1|  PREDICTED: aspartic proteinase-like isoform X1     178   2e-48    
ref|XP_010241432.1|  PREDICTED: aspartic proteinase-like isoform X2     179   2e-48    
emb|CAA61253.1|  aspartic protease                                      166   5e-48    
dbj|BAJ91748.1|  predicted protein                                      176   5e-48    
gb|KDO54713.1|  hypothetical protein CISIN_1g009634mg                   173   4e-47    
ref|XP_010241433.1|  PREDICTED: aspartic proteinase-like isoform X3     175   5e-47    
ref|XP_010241431.1|  PREDICTED: aspartic proteinase-like isoform X1     175   7e-47    
ref|XP_010241436.1|  PREDICTED: cardosin-F-like isoform X5              174   8e-47    



>ref|XP_009629448.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=512

 Score =   364 bits (935),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CKAVVE YGQ ++D+L+ EA PKKICSQ+GLCTF+G RG+SMGI
Sbjct  308  TMINHAIGASGVVSQQCKAVVEQYGQTIMDMLLAEAHPKKICSQVGLCTFDGTRGISMGI  367

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVDE  G S+ LHDAMCSACEM VVWMQNQL +NQTQE IL+YVNELC RLPSPMG+S
Sbjct  368  ESVVDENAGKSSGLHDAMCSACEMAVVWMQNQLRQNQTQERILNYVNELCERLPSPMGQS  427

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS MPSVSF+IGG+ FDLSP EYILKVGEG AAQCISGF ALDVPPPRGPLWIL
Sbjct  428  AVDCGKLSGMPSVSFTIGGRTFDLSPEEYILKVGEGPAAQCISGFIALDVPPPRGPLWIL  487

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  488  GDVFMGRYHTVFDFGKLRVGFAEAA  512



>ref|XP_009797823.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
 ref|XP_009797831.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
Length=512

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CKAVVE YGQ ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGI
Sbjct  308  TMINHAIGASGVVSQQCKAVVEQYGQTIMDMLLAEAHPKKICSQVGLCTFDGTRGVSMGI  367

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVDE  G S+ LHDAMCSACEM VVWMQNQL +NQTQE IL+YVNELC RLPSPMG+S
Sbjct  368  ESVVDENAGKSSGLHDAMCSACEMAVVWMQNQLRQNQTQERILNYVNELCERLPSPMGQS  427

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS MPSVSF+IGG+ FDLSP EYILKVGEG AAQCISGF ALDVPPPRGPLWIL
Sbjct  428  AVDCGKLSGMPSVSFTIGGRTFDLSPEEYILKVGEGPAAQCISGFIALDVPPPRGPLWIL  487

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  488  GDVFMGRYHTVFDSGKLRVGFAEAA  512



>ref|XP_004232695.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
 ref|XP_010316578.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=511

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGI
Sbjct  307  TMINHAIGASGVVSQQCKTVVQQYGQTIMDMLLTEANPKKICSQVGLCTFDGTRGVSMGI  366

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVDEK G SA LHDAMCSACEM VVWMQNQL +NQTQ+ IL+YVNELC RLPSPMG+S
Sbjct  367  ESVVDEKAGKSAGLHDAMCSACEMAVVWMQNQLRQNQTQDRILNYVNELCERLPSPMGQS  426

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS MPSVSF+IGGK FDL+P EYILKVGEG AAQCISGF ALD+PPPRGPLWIL
Sbjct  427  AVDCGKLSGMPSVSFTIGGKKFDLAPEEYILKVGEGRAAQCISGFIALDIPPPRGPLWIL  486

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  487  GDVFMGRYHTVFDSGKLRVGFAEAA  511



>ref|XP_009792514.1| PREDICTED: aspartic proteinase-like, partial [Nicotiana sylvestris]
Length=382

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S++CK+VVE YGQ ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGI
Sbjct  178  TMINQAIGASGVASQQCKSVVEQYGQTIMDLLLAEAHPKKICSQVGVCTFDGNRGVSMGI  237

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVDEK G S  L D MCSACEM V+WM+NQL +NQTQ+ IL+YVNELC RLPSP+GES
Sbjct  238  DSVVDEKAGRSTGLQDGMCSACEMAVIWMENQLRQNQTQDRILNYVNELCERLPSPLGES  297

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS+MP VSF+IGGKVFDLSPNEYILKVGEG+ AQCISGFT LD+PPPRGPLWIL
Sbjct  298  AVDCGKLSSMPKVSFTIGGKVFDLSPNEYILKVGEGAKAQCISGFTGLDIPPPRGPLWIL  357

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  358  GDIFMGRYHTVFDYGKLRVGFAEAA  382



>ref|XP_006348142.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=511

 Score =   359 bits (922),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGI
Sbjct  307  TMINHAIGASGVVSQQCKTVVQQYGQTIMDMLLTEANPKKICSQVGLCTFDGTRGVSMGI  366

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVDEK G SA LHDAMCSACEM VVWMQNQL +NQTQ+ IL+YVNELC RLPSPMG+S
Sbjct  367  ESVVDEKAGKSAGLHDAMCSACEMAVVWMQNQLRQNQTQDRILNYVNELCERLPSPMGQS  426

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS MPSVSF+IG K FDL+P EYILKVGEG AAQCISGF ALD+PPPRGPLWIL
Sbjct  427  AVDCGKLSGMPSVSFTIGSKKFDLAPEEYILKVGEGRAAQCISGFVALDIPPPRGPLWIL  486

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  487  GDVFMGRYHTVFDSGKLRVGFAEAA  511



>emb|CDP04424.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   357 bits (916),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YGQ+++DLL+ EA+PK ICSQIGLCTF+G +GVSMGI
Sbjct  309  TMINHAIGASGIVSQECKAVVQQYGQKIVDLLLGEAQPKTICSQIGLCTFDGTQGVSMGI  368

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESV DE  G S+ L DAMCSACEM VVWMQNQLS+NQTQE IL+Y NELC+RLPSPMGES
Sbjct  369  ESVADEHAGRSSGLRDAMCSACEMAVVWMQNQLSQNQTQERILNYANELCDRLPSPMGES  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             V+CG +S+MP VSF+IGGKVFDL+P EYILKVGEG+AAQCISGFT LD+PPPRGPLWIL
Sbjct  429  SVECGSISSMPKVSFTIGGKVFDLAPEEYILKVGEGAAAQCISGFTGLDMPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTV DYGKMRVGFAEAA
Sbjct  489  GDVFMGRYHTVLDYGKMRVGFAEAA  513



>ref|XP_009587050.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=510

 Score =   356 bits (913),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S++CK+VVE YGQ ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGI
Sbjct  306  TMINQAIGASGVASQQCKSVVEQYGQTIMDLLLAEAHPKKICSQVGVCTFDGNRGVSMGI  365

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVDEK G S  L D MCSACEM V+WM+NQL +NQTQ+ IL+YVNELC RLPSP+GES
Sbjct  366  ESVVDEKAGRSTGLQDGMCSACEMAVIWMENQLRQNQTQDRILNYVNELCERLPSPLGES  425

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS+MP+VSF+IGGKVFDL P EYILKVGEG+ AQCISGFT LD+PPPRGPLWIL
Sbjct  426  AVDCGKLSSMPTVSFTIGGKVFDLVPKEYILKVGEGAKAQCISGFTGLDIPPPRGPLWIL  485

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYGK+RVGFAEAA
Sbjct  486  GDVFMGRYHTVFDYGKLRVGFAEAA  510



>ref|XP_007026133.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
 gb|EOY28755.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
Length=514

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS+ECKAVV+ YGQ +IDLL+ EA+P+KICSQIGLCTFNG  GVS GI
Sbjct  309  TMINHAIGATGVVSQECKAVVQQYGQTIIDLLIAEAQPQKICSQIGLCTFNGAHGVSTGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE NG S+  L DAMC ACEM VVWMQNQ+ +NQTQ+ ILSYVNELC+R+P+PMGE
Sbjct  369  ESVVDESNGKSSGVLRDAMCPACEMAVVWMQNQVRQNQTQDRILSYVNELCDRVPNPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP++SF+IGGKVFDL+P EYILKVGEGS AQCISGFTALD+PPPRGPLWI
Sbjct  429  SAVDCGSLSSMPTISFTIGGKVFDLTPEEYILKVGEGSDAQCISGFTALDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFD+GK+RVGFAEAA
Sbjct  489  LGDIFMGRYHTVFDFGKLRVGFAEAA  514



>ref|XP_004231616.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=510

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S++CKAV++ YGQ ++DLL+ EA PKK+CSQ+G+CTF+G  GVSMGI
Sbjct  306  TMINQAIGASGVASQQCKAVIQQYGQTIMDLLLAEAHPKKVCSQVGVCTFDGTHGVSMGI  365

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVV+EK G SA LHD MCSACEM VVWM+NQL +NQTQ+ IL Y+NELC RLPSPMGES
Sbjct  366  ESVVNEKAGRSAGLHDGMCSACEMAVVWMENQLRQNQTQDRILDYLNELCERLPSPMGES  425

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS+MP+VSF+IGGKVFDLSPNEYILKVGEG  AQCISGF  LDVPPPRGPLWIL
Sbjct  426  AVDCGKLSSMPTVSFTIGGKVFDLSPNEYILKVGEGDQAQCISGFIGLDVPPPRGPLWIL  485

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  486  GDIFMGRYHTVFDYGKLRVGFAEAA  510



>gb|EYU27762.1| hypothetical protein MIMGU_mgv1a004712mg [Erythranthe guttata]
Length=513

 Score =   354 bits (908),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS+ECKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVS GI
Sbjct  309  TMINHAIGAVGVVSQECKAVVEQYGQTIMDLLLTEAHPKKICSQVGLCTFDGTRGVSAGI  368

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVDEK+G S+ L DAMCSACEM VVWMQNQL  NQTQ+ IL+YVNELC RLPSPMG+S
Sbjct  369  ESVVDEKDGRSSGLGDAMCSACEMAVVWMQNQLRRNQTQDRILNYVNELCERLPSPMGQS  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             V+CG +S+MPSVSF+IGGK+FDLSP+EYILKVGEG+AAQCISGF  LD+PPPRGPLWIL
Sbjct  429  AVECGSISSMPSVSFTIGGKIFDLSPHEYILKVGEGAAAQCISGFMGLDIPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMGRYHTVFD GK+RVGFAEAA
Sbjct  489  GDMFMGRYHTVFDSGKLRVGFAEAA  513



>emb|CAC86004.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS+ECKAVV+ YG+ +IDLL+ EA+P+KICSQIGLCTFNG  GVS GI
Sbjct  309  TMINHAIGATGVVSQECKAVVQQYGRTIIDLLIAEAQPQKICSQIGLCTFNGAHGVSTGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE NG S+  L DAMC ACEM VVWMQNQ+ +NQTQ+ ILSYVNELC+R+P+PMGE
Sbjct  369  ESVVDESNGKSSGVLRDAMCPACEMAVVWMQNQVRQNQTQDRILSYVNELCDRVPNPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP++SF+IGGKVFDL+P EYILKVGEGS AQCISGFTALD+PPPRGPLWI
Sbjct  429  SAVDCGSLSSMPTISFTIGGKVFDLTPEEYILKVGEGSEAQCISGFTALDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFD+GK+RVGFAEAA
Sbjct  489  LGDIFMGRYHTVFDFGKLRVGFAEAA  514



>ref|XP_004145121.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 ref|XP_004153558.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=514

 Score =   351 bits (900),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV+S+ECKAVV+ YGQ ++DLL+ EA PKKICSQI LCTF+G RGVSMGI
Sbjct  309  TMINHAIGAKGVMSQECKAVVQQYGQTIMDLLLSEADPKKICSQIKLCTFDGTRGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE  G S+D L D MCS CEMTVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+
Sbjct  369  ESVVDENAGKSSDGLRDGMCSVCEMTVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQ  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MPSVSF+IG KVFDL+P EYILKVGEG+AAQCISGFTA D+PPPRGPLWI
Sbjct  429  SAVDCGTLSSMPSVSFTIGDKVFDLAPEEYILKVGEGAAAQCISGFTAFDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  489  LGDVFMGRYHTVFDFGKLRVGFAEAA  514



>ref|XP_008440898.1| PREDICTED: aspartic proteinase [Cucumis melo]
Length=514

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS+ECKAVV+ YGQ ++DLL+ EA PKKICSQI LCTF+G +GVSMGI
Sbjct  309  TMINHAIGAKGVVSQECKAVVQQYGQTIMDLLLSEADPKKICSQIKLCTFDGTQGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESV+DE  G S+D L D MCS CEMTVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+
Sbjct  369  ESVLDENAGKSSDGLRDGMCSVCEMTVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQ  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MPSVSF+IG KVFDL+P EYILKVGEG AAQCISGFTA D+PPPRGPLWI
Sbjct  429  SAVDCGKLSSMPSVSFTIGDKVFDLAPEEYILKVGEGVAAQCISGFTAFDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  489  LGDVFMGRYHTVFDFGKLRVGFAEAA  514



>ref|XP_006350474.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=510

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S++CKAV++ YGQ ++DLL+ EA PKK+CSQ+G+CTF+G  GVSMGI
Sbjct  306  TMINQAIGASGVASQQCKAVIQQYGQTIMDLLLAEAHPKKVCSQVGVCTFDGTHGVSMGI  365

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVV+EK G SA  HD +CSACEM V+WM+NQL +NQTQ+ IL YVNELC RLPSPMGES
Sbjct  366  ESVVNEKAGRSAGPHDGVCSACEMAVIWMENQLRQNQTQDRILDYVNELCERLPSPMGES  425

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS+MP+VSF+IGGKVFDLSPNEYILKVGEG  AQCISGF  LD+PPPRGPLWIL
Sbjct  426  AVDCGKLSSMPTVSFTIGGKVFDLSPNEYILKVGEGDKAQCISGFIGLDIPPPRGPLWIL  485

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  486  GDIFMGRYHTVFDYGKLRVGFAEAA  510



>ref|XP_011096039.1| PREDICTED: aspartic proteinase-like [Sesamum indicum]
Length=511

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MINHAIGA GVVS++CKAVVE YGQ ++DLL+ EA+PKKICSQ+GLCTF+G  GVS GI+
Sbjct  308  MINHAIGASGVVSQQCKAVVEQYGQTIMDLLLAEAQPKKICSQVGLCTFDGTHGVSAGIQ  367

Query  594  SVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            SVVDEK+G S+ L D MCSACEM VVWMQNQL +NQTQE IL+YVNELC RLPSPMGES 
Sbjct  368  SVVDEKDGRSSGLGDGMCSACEMAVVWMQNQLRQNQTQERILNYVNELCERLPSPMGESA  427

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  +S+MP++SF+IGGK FDLSP +YILKVGEG+AAQCISGFT LD+PPPRGPLWILG
Sbjct  428  VDCASISSMPTISFTIGGKPFDLSPEQYILKVGEGAAAQCISGFTGLDIPPPRGPLWILG  487

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            D+FMGRYHTVFD+GK+RVGFAEAA
Sbjct  488  DMFMGRYHTVFDFGKLRVGFAEAA  511



>ref|XP_010099183.1| Aspartic proteinase [Morus notabilis]
 gb|EXB77055.1| Aspartic proteinase [Morus notabilis]
Length=513

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVSKECK+VV+ YGQ ++DLL+ +  PKK+CSQIGLCTF+G R VS+GIE
Sbjct  310  MINSAIGASGVVSKECKSVVQQYGQNILDLLMAQVHPKKVCSQIGLCTFDGTRVVSIGIE  369

Query  594  SVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            SVVD+ NG S  LHDAMCSACEMTVVWMQNQL++NQT+E+IL YVNELC+R+P+PMGES 
Sbjct  370  SVVDKNNGKSGVLHDAMCSACEMTVVWMQNQLTQNQTREHILDYVNELCDRVPNPMGESS  429

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG+LS MP V+F+IGGK+F+LSP EYILKVGEG  AQCISGFT LDVPPPRGPLWILG
Sbjct  430  VDCGRLSLMPKVAFTIGGKIFELSPQEYILKVGEGPQAQCISGFTGLDVPPPRGPLWILG  489

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMGRYHTVFDYGK+RVGFAEAA
Sbjct  490  DVFMGRYHTVFDYGKLRVGFAEAA  513



>sp|O04057.1|ASPR_CUCPE RecName: Full=Aspartic proteinase; Flags: Precursor [Cucurbita 
pepo]
 dbj|BAA19607.1| aspartic endopeptidase [Cucurbita pepo]
Length=513

 Score =   348 bits (894),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CKAVV  YGQ ++DLL+ EA PKKICSQI LCTF+G RGVSMGI
Sbjct  308  TMINHAIGAKGVVSQQCKAVVAQYGQTIMDLLLSEADPKKICSQINLCTFDGTRGVSMGI  367

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE  G S+D LHD MCS CEMTVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+
Sbjct  368  ESVVDENAGKSSDSLHDGMCSVCEMTVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQ  427

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG+LS+MP+VSF+IGGK+FDL+P EYILKVGEG  AQCISGFTA D+PPPRGPLWI
Sbjct  428  SAVDCGQLSSMPTVSFTIGGKIFDLAPEEYILKVGEGPVAQCISGFTAFDIPPPRGPLWI  487

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVG AEAA
Sbjct  488  LGDVFMGRYHTVFDFGKLRVGSAEAA  513



>ref|XP_010252464.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
 ref|XP_010252465.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
Length=514

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INH IGA GVVS+ECKAVV  YG+ +++LL+ E +P K+CSQIGLCTF+G RGVS GI
Sbjct  309  TQINHGIGATGVVSQECKAVVAQYGETILELLLAETQPMKVCSQIGLCTFDGTRGVSTGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDEKNG S+  LHDAMCSACEM VVWMQNQL +NQTQ+ ILSY NELC+RLPSPMGE
Sbjct  369  ESVVDEKNGKSSGFLHDAMCSACEMAVVWMQNQLRQNQTQDRILSYANELCDRLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC KLS+MP VS +IGGKVFDL+P EYILKVGEG   QCISGFTALDVPPPRGPLWI
Sbjct  429  SAVDCDKLSSMPVVSITIGGKVFDLTPEEYILKVGEGPVTQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG MRVGFAEAA
Sbjct  489  LGDVFMGRYHTVFDYGNMRVGFAEAA  514



>gb|EYU33885.1| hypothetical protein MIMGU_mgv1a004716mg [Erythranthe guttata]
Length=513

 Score =   346 bits (888),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVSKECK+VV+ YGQ ++DLL+ EA+PKKICSQIGLCTF+G RGVS  I
Sbjct  309  TMINHAIGASGVVSKECKSVVDKYGQTIMDLLLAEAKPKKICSQIGLCTFDGTRGVSGAI  368

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVDEK G S+ + +AMC ACEM VVWMQNQL +N+TQ++IL+YVNELC +LPSPMG+S
Sbjct  369  ESVVDEKEGRSSGMSEAMCPACEMAVVWMQNQLKQNKTQDHILNYVNELCEKLPSPMGQS  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  +S+MPSVS +IGGK FDL+P EYILKVGEG+ AQCISGFT LD+PPPRGPLWIL
Sbjct  429  AVDCASISSMPSVSLTIGGKKFDLAPKEYILKVGEGAQAQCISGFTGLDIPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  489  GDIFMGRYHTVFDYGKLRVGFAEAA  513



>emb|CBI23210.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MINHAIGA GVVS+ECK VV  YG+ ++DLL+ EA P+KICSQIGLCTF+G RGV MGIE
Sbjct  225  MINHAIGATGVVSQECKTVVAQYGETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIE  284

Query  594  SVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVDEKNG  S+ +HDA CSACEM VVWMQ+QL +NQT+E IL YVNELC+RLPSPMGES
Sbjct  285  SVVDEKNGDKSSGVHDAGCSACEMAVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGES  344

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LS+MP+VS +IGGKVFDLS NEY+LKVGEG+AAQCISGF A+DVPPPRGPLWIL
Sbjct  345  AVDCLQLSSMPNVSLTIGGKVFDLSANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWIL  404

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG MRVGFAEAA
Sbjct  405  GDVFMGRYHTVFDYGNMRVGFAEAA  429



>ref|XP_003632941.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_002262915.2| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_010655376.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
Length=514

 Score =   344 bits (882),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MINHAIGA GVVS+ECK VV  YG+ ++DLL+ EA P+KICSQIGLCTF+G RGV MGIE
Sbjct  310  MINHAIGATGVVSQECKTVVAQYGETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIE  369

Query  594  SVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVDEKNG  S+ +HDA CSACEM VVWMQ+QL +NQT+E IL YVNELC+RLPSPMGES
Sbjct  370  SVVDEKNGDKSSGVHDAGCSACEMAVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGES  429

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LS+MP+VS +IGGKVFDLS NEY+LKVGEG+AAQCISGF A+DVPPPRGPLWIL
Sbjct  430  AVDCLQLSSMPNVSLTIGGKVFDLSANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWIL  489

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG MRVGFAEAA
Sbjct  490  GDVFMGRYHTVFDYGNMRVGFAEAA  514



>gb|KDP20718.1| hypothetical protein JCGZ_21189 [Jatropha curcas]
Length=512

 Score =   342 bits (876),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 183/206 (89%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GVVS+ECKAVV  YGQ ++DLL+ME +PKKICSQ+GLCTF+G  GVSMGI
Sbjct  307  TMINQAIGATGVVSQECKAVVAQYGQTIMDLLLMEVQPKKICSQVGLCTFDGTHGVSMGI  366

Query  597  ESVVDEKNGVSADL-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE+N  S+ +  DAMCSACEMTVVWMQNQL +NQTQ+ IL+YVNELC+R+PSP+G+
Sbjct  367  QSVVDERNDKSSGIARDAMCSACEMTVVWMQNQLRQNQTQDRILNYVNELCDRIPSPLGQ  426

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP +SF+I GK+F+L+P EYILKVGEGSAAQCISGFT LDVPPPRGPLWI
Sbjct  427  SAVDCGSLSSMPIISFTIAGKLFELTPEEYILKVGEGSAAQCISGFTGLDVPPPRGPLWI  486

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFD+G  RVGFAEAA
Sbjct  487  LGDIFMGRYHTVFDFGNNRVGFAEAA  512



>gb|KJB67248.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=506

 Score =   341 bits (874),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S+ECKAVV+ YGQ +IDLLV +A P KICSQIGLC F+G+ GVSMGI
Sbjct  301  TMINQAIGASGVASQECKAVVQQYGQTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGI  360

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            E+VVDE NG S+  LH AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGE
Sbjct  361  ENVVDESNGKSSGILHSAMCPACEMAVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP++SF+IGGK F+L+P EYILKVGEG+ AQCISGFTALDVPPPRGPLWI
Sbjct  421  STVDCGSLSSMPTISFTIGGKAFELTPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  481  LGDVFMGRYHTVFDFGKLRVGFAEAA  506



>ref|XP_008224698.1| PREDICTED: aspartic proteinase-like [Prunus mume]
Length=514

 Score =   341 bits (874),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA+GVVS+ECKAV + YGQ +++LL+ EARP K+CSQIGLCTF+G R VS+GI
Sbjct  309  TMINQAIGAEGVVSQECKAVAQQYGQTIMNLLLAEARPDKVCSQIGLCTFDGTRSVSVGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ NG S+  LHDA CSACEM VVWM+NQL +NQTQ+ IL+YVNELC R+PSPMG+
Sbjct  369  ESVVDKSNGKSSGILHDASCSACEMAVVWMKNQLGQNQTQDRILNYVNELCERMPSPMGQ  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MPSVSF+IGGKVF+L+PNEYILKVGEG  AQCISGFT +D+PPPRGPLWI
Sbjct  429  SAVDCGKLSSMPSVSFTIGGKVFELTPNEYILKVGEGPQAQCISGFTNIDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGD+FMGRYHTVFD G+MRVGFAEA
Sbjct  489  LGDIFMGRYHTVFDSGRMRVGFAEA  513



>gb|KHG11144.1| Aspartic proteinase [Gossypium arboreum]
Length=514

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S+ECKAVV+ YGQ +IDLLV +A P KICS+IGLC F+G+ GVSMGI
Sbjct  309  TMINQAIGASGVASQECKAVVQQYGQTIIDLLVSQAEPMKICSRIGLCAFDGSHGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            E+VVDE NG S+  LH AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGE
Sbjct  369  ENVVDESNGKSSGILHSAMCPACEMAVVWMQNQLIENQTQDRILDYANQLCDRVPNPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP++SF+IGGK FDL+P EYILKVGEG+ AQCISGFTALDVPPPRGPLWI
Sbjct  429  STVDCGSLSSMPTISFTIGGKAFDLTPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  489  LGDVFMGRYHTVFDFGKLRVGFAEAA  514



>gb|KJB67244.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
 gb|KJB67245.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
 gb|KJB67246.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=514

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S+ECKAVV+ YGQ +IDLLV +A P KICSQIGLC F+G+ GVSMGI
Sbjct  309  TMINQAIGASGVASQECKAVVQQYGQTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            E+VVDE NG S+  LH AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGE
Sbjct  369  ENVVDESNGKSSGILHSAMCPACEMAVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP++SF+IGGK F+L+P EYILKVGEG+ AQCISGFTALDVPPPRGPLWI
Sbjct  429  STVDCGSLSSMPTISFTIGGKAFELTPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  489  LGDVFMGRYHTVFDFGKLRVGFAEAA  514



>ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF43832.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=511

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T+IN AIGA GV S+ECK V+  YG+ ++DLL+ EA+PKKICSQIGLCTF+G RGVSMGI
Sbjct  306  TLINEAIGATGVASQECKTVIAQYGETIMDLLIAEAQPKKICSQIGLCTFDGTRGVSMGI  365

Query  597  ESVVDEKNGVSADL-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVD+ N  S+ +  DAMCSACEMTVVWMQNQL ENQTQ+ IL+YVNELC+R+P+P+GE
Sbjct  366  QSVVDDNNDKSSGIVRDAMCSACEMTVVWMQNQLRENQTQDRILNYVNELCDRIPNPLGE  425

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG +S+MP VSF+IGGKVFDLSP EYILKVGEG+ AQCISGF ALDVPPPRGPLWI
Sbjct  426  SIVDCGSISSMPVVSFTIGGKVFDLSPQEYILKVGEGAQAQCISGFMALDVPPPRGPLWI  485

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFDYG +RVGFAEAA
Sbjct  486  LGDIFMGRYHTVFDYGNLRVGFAEAA  511



>ref|XP_007211538.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica]
 gb|EMJ12737.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica]
Length=539

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA+GVVS+ECKAV + YGQ +++LL+ EARP K+CSQIGLCTF+G R VSMGI
Sbjct  334  TMINQAIGAEGVVSQECKAVAQQYGQTIMNLLLAEARPDKVCSQIGLCTFDGTRSVSMGI  393

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ NG S+  LHDA CSACEM VVWM+NQL +NQTQ+ IL+YVNELC R+PSPMG+
Sbjct  394  ESVVDKSNGKSSGILHDASCSACEMAVVWMKNQLGQNQTQDRILNYVNELCERMPSPMGQ  453

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG+LS+MPSVSF+IGGKVF+L+PNEYILKVGEG  AQCISGF  +D+PPPRGPLWI
Sbjct  454  SAVDCGRLSSMPSVSFTIGGKVFELTPNEYILKVGEGPQAQCISGFINIDIPPPRGPLWI  513

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFD G MRVGFAEAA
Sbjct  514  LGDIFMGRYHTVFDSGNMRVGFAEAA  539



>emb|CAA54478.1| aspartic protease [Brassica oleracea]
Length=292

 Score =   332 bits (850),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV S++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  87   TMINHAIGASGVASQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGI  146

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL YVNELC R+PSPMGE
Sbjct  147  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILDYVNELCRRIPSPMGE  206

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P+EY+LKVGEG+AAQCISGF ALDV PPRGPLWI
Sbjct  207  SAVDCAQLSTMPTVSLTIGGKVFDLAPHEYVLKVGEGAAAQCISGFIALDVAPPRGPLWI  266

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+GK +VGFAEAA
Sbjct  267  LGDVFMGKYHTVFDFGKAQVGFAEAA  292



>gb|KJB69259.1| hypothetical protein B456_011G012800 [Gossypium raimondii]
Length=514

 Score =   338 bits (867),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS+ECKAVV+ YGQ +IDLL+ E +P+KICSQIGLCTF+G  GVSMGI
Sbjct  309  TMINHAIGATGVVSQECKAVVQQYGQTIIDLLLAETQPQKICSQIGLCTFDGAHGVSMGI  368

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV+E NG S+ +  +AMC ACEM VVWMQNQL +NQT + IL+YVN+LC+R+PSPMGE
Sbjct  369  ESVVEEGNGKSSGVQFNAMCPACEMAVVWMQNQLKQNQTLDVILNYVNQLCDRMPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V+CG LS+MP+VSF+IG KVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  429  SAVECGSLSSMPTVSFTIGDKVFDLSPEEYILKVGEGPQAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK RVGFAEAA
Sbjct  489  LGDVFMGRYHTVFDFGKERVGFAEAA  514



>dbj|BAD93734.1| putative aspartic proteinase [Arabidopsis thaliana]
Length=205

 Score =   327 bits (838),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIE
Sbjct  1    MINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIE  60

Query  594  SVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES
Sbjct  61   SVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGES  120

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGPLWIL
Sbjct  121  AVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWIL  180

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG+YHTVFD+G  +VGFAEAA
Sbjct  181  GDVFMGKYHTVFDFGNEQVGFAEAA  205



>gb|KJB69260.1| hypothetical protein B456_011G012800 [Gossypium raimondii]
Length=521

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS+ECKAVV+ YGQ +IDLL+ E +P+KICSQIGLCTF+G  GVSMGI
Sbjct  316  TMINHAIGATGVVSQECKAVVQQYGQTIIDLLLAETQPQKICSQIGLCTFDGAHGVSMGI  375

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV+E NG S+ +  +AMC ACEM VVWMQNQL +NQT + IL+YVN+LC+R+PSPMGE
Sbjct  376  ESVVEEGNGKSSGVQFNAMCPACEMAVVWMQNQLKQNQTLDVILNYVNQLCDRMPSPMGE  435

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V+CG LS+MP+VSF+IG KVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  436  SAVECGSLSSMPTVSFTIGDKVFDLSPEEYILKVGEGPQAQCISGFTALDVPPPRGPLWI  495

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK RVGFAEAA
Sbjct  496  LGDVFMGRYHTVFDFGKERVGFAEAA  521



>ref|XP_011086197.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Sesamum indicum]
Length=510

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS+ECK+VVE YGQ ++DLL+ EA+P+KICSQ+GLCTF+G RGVS GIE
Sbjct  307  MINRAIGASGVVSQECKSVVEQYGQTILDLLLAEAKPEKICSQVGLCTFDGTRGVSGGIE  366

Query  594  SVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            SVVDE+ G S+ LHDAMC ACEM +VWM+NQL +N+TQ+ ILSY NELC RLPSP+GES 
Sbjct  367  SVVDEQGGRSSSLHDAMCPACEMAIVWMKNQLEQNKTQDRILSYANELCERLPSPLGESA  426

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG++ +MPSVSF+IGGK F LS  +YILKVGEG+ AQCISGF+ LD+PPPRGPLWILG
Sbjct  427  VDCGRIPSMPSVSFTIGGKEFKLSAEQYILKVGEGAEAQCISGFSGLDIPPPRGPLWILG  486

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            D+FMG YHTVFDYGK+RVGFAEAA
Sbjct  487  DIFMGPYHTVFDYGKLRVGFAEAA  510



>ref|XP_002529926.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF32480.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=514

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKAVV  YG+ +I +L+ + +P+KICSQIGLCTF+G+RGVSMGI
Sbjct  309  TEVNHAIGATGVVSQECKAVVAQYGETIIAMLLAKDQPQKICSQIGLCTFDGSRGVSMGI  368

Query  597  ESVVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV+EK   V+  LHDAMCS CEM VVWMQNQL +NQTQE+IL+YVNELC RLPSPMGE
Sbjct  369  ESVVNEKIQEVAGGLHDAMCSTCEMAVVWMQNQLKQNQTQEHILNYVNELCERLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LSTMP+VSF+IGG+VFDL+P +Y+LKVG+G AAQCISGFTALDVPPPRGPLWI
Sbjct  429  SAVDCGSLSTMPNVSFTIGGRVFDLAPEQYVLKVGDGEAAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG +HTVFDYG  RVGFAE A
Sbjct  489  LGDVFMGPFHTVFDYGNKRVGFAEVA  514



>ref|XP_010244477.1| PREDICTED: aspartic proteinase A1-like isoform X3 [Nelumbo nucifera]
Length=514

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INH IGA GVVS+ECK VV  YGQ ++++L+ EA PKKICSQIGLCTF+G RGVS GI
Sbjct  309  TEINHEIGASGVVSQECKTVVAQYGQVILEMLLAEAPPKKICSQIGLCTFDGTRGVSTGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE N  S+  LHD MCSACEMTVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMG+
Sbjct  369  KSVVDESNDKSSGGLHDTMCSACEMTVVWMQNQLRQNQTQDRILNYVNELCDRLPSPMGQ  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC KLS+MP VSF+IGGKVFDL+P EYILKVGEG  AQCISGFTALD+PPPRGPLWI
Sbjct  429  SSVDCDKLSSMPIVSFTIGGKVFDLTPQEYILKVGEGPEAQCISGFTALDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYG +RVGFA AA
Sbjct  489  LGDVFMGSYHTVFDYGNLRVGFAAAA  514



>ref|XP_010096873.1| Aspartic proteinase [Morus notabilis]
 gb|EXB66327.1| Aspartic proteinase [Morus notabilis]
Length=514

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKA+VE YGQ +I+ L+ + +PKKIC+QIGLC+F+G RGVSMGI
Sbjct  309  TELNHAIGATGVVSEECKAIVEQYGQTIIESLLAKDQPKKICAQIGLCSFDGTRGVSMGI  368

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE  G  S DL D MCSACEM VVWMQNQ+ +NQTQ+ IL+YVN+LC RLPSPMGE
Sbjct  369  KSVVDENVGKASGDLRDGMCSACEMAVVWMQNQIKQNQTQDQILNYVNQLCERLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS++P VSF+IGGK F+L P EYILKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  429  SAVDCGSLSSLPDVSFTIGGKKFELKPEEYILKVGEGDVAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG MR+GFAEAA
Sbjct  489  LGDVFMGRYHTVFDYGNMRIGFAEAA  514



>ref|XP_010244475.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010244476.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Nelumbo nucifera]
Length=517

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INH IGA GVVS+ECK VV  YGQ ++++L+ EA PKKICSQIGLCTF+G RGVS GI
Sbjct  312  TEINHEIGASGVVSQECKTVVAQYGQVILEMLLAEAPPKKICSQIGLCTFDGTRGVSTGI  371

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE N  S+  LHD MCSACEMTVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMG+
Sbjct  372  KSVVDESNDKSSGGLHDTMCSACEMTVVWMQNQLRQNQTQDRILNYVNELCDRLPSPMGQ  431

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC KLS+MP VSF+IGGKVFDL+P EYILKVGEG  AQCISGFTALD+PPPRGPLWI
Sbjct  432  SSVDCDKLSSMPIVSFTIGGKVFDLTPQEYILKVGEGPEAQCISGFTALDIPPPRGPLWI  491

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYG +RVGFA AA
Sbjct  492  LGDVFMGSYHTVFDYGNLRVGFAAAA  517



>ref|XP_011086196.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Sesamum indicum]
Length=561

 Score =   338 bits (867),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS+ECK+VVE YGQ ++DLL+ EA+P+KICSQ+GLCTF+G RGVS GIE
Sbjct  358  MINRAIGASGVVSQECKSVVEQYGQTILDLLLAEAKPEKICSQVGLCTFDGTRGVSGGIE  417

Query  594  SVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            SVVDE+ G S+ LHDAMC ACEM +VWM+NQL +N+TQ+ ILSY NELC RLPSP+GES 
Sbjct  418  SVVDEQGGRSSSLHDAMCPACEMAIVWMKNQLEQNKTQDRILSYANELCERLPSPLGESA  477

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG++ +MPSVSF+IGGK F LS  +YILKVGEG+ AQCISGF+ LD+PPPRGPLWILG
Sbjct  478  VDCGRIPSMPSVSFTIGGKEFKLSAEQYILKVGEGAEAQCISGFSGLDIPPPRGPLWILG  537

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            D+FMG YHTVFDYGK+RVGFAEAA
Sbjct  538  DIFMGPYHTVFDYGKLRVGFAEAA  561



>gb|ACX55830.1| aspartic proteinase 2 [Castanea mollissima]
Length=513

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKAVV  YG+ +I +L+ + +P KICSQIGLCTF+G +GVSM I
Sbjct  309  TEVNHAIGATGVVSQECKAVVAEYGETIIKMLLEKDQPMKICSQIGLCTFDGTQGVSMDI  368

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD  +  S  L DAMCS CEMTVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMGES
Sbjct  369  ESVVDNTHKASNGLRDAMCSTCEMTVVWMQNQLKQNQTQDRILTYVNELCDRLPSPMGES  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCG LS++P+VS +IGG+VFDLSP +Y+LKVGEG AAQCISGFTALDVPPPRGPLWIL
Sbjct  429  AVDCGSLSSLPNVSLTIGGRVFDLSPEQYVLKVGEGEAAQCISGFTALDVPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG  RVGFAEAA
Sbjct  489  GDVFMGRYHTVFDYGNQRVGFAEAA  513



>gb|ACX55829.1| aspartic proteinase 1 [Castanea mollissima]
Length=513

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKAVV  YG+ +I +L+ + +P KICSQIGLCTF+G RGVSM I
Sbjct  309  TEVNHAIGATGVVSQECKAVVAEYGETIIKMLLEKDQPMKICSQIGLCTFDGVRGVSMDI  368

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD     S  L DAMCS CEMTVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMGES
Sbjct  369  ESVVDNTRKASNGLRDAMCSTCEMTVVWMQNQLKQNQTQDRILTYVNELCDRLPSPMGES  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCG LS++P+VS +IGG+VFDLSP +Y+LKVGEG AAQCISGFTALDVPPPRGPLWIL
Sbjct  429  AVDCGSLSSLPNVSLTIGGRVFDLSPEQYVLKVGEGEAAQCISGFTALDVPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG  RVGFAEAA
Sbjct  489  GDVFMGRYHTVFDYGNQRVGFAEAA  513



>ref|XP_010035554.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010035555.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW46979.1| hypothetical protein EUGRSUZ_K00787 [Eucalyptus grandis]
Length=514

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK +V  YG+ ++++L+ EA+P+KICSQIG CTF+G  GV MGI
Sbjct  309  TQINHAIGASGVVSQECKTIVGQYGKTILEMLMTEAKPQKICSQIGFCTFDGTHGVRMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE  G S+  LHDAMCSACEM VVWMQNQL+ NQT++ IL+YVNELC+R+PSPMGE
Sbjct  369  ESVVDETKGKSSGGLHDAMCSACEMAVVWMQNQLTRNQTEDQILNYVNELCDRIPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP VSF+IGGKVFDL+P +Y+LKVGEG A+QCISGFTALDV PPRGPLWI
Sbjct  429  SAVDCNSLSSMPRVSFTIGGKVFDLAPEQYVLKVGEGGASQCISGFTALDVAPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMG+YHTVFDYG  RVGFAEAA
Sbjct  489  LGDIFMGKYHTVFDYGNQRVGFAEAA  514



>ref|XP_008349314.1| PREDICTED: aspartic proteinase-like [Malus domestica]
Length=507

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 180/205 (88%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            +IN AIGA GVVS+ECKAVV  YGQ ++DLL+ EA+PK++CSQIGLCTF+G R VSMGIE
Sbjct  303  LINQAIGASGVVSQECKAVVNQYGQTILDLLLAEAQPKQVCSQIGLCTFDGTRSVSMGIE  362

Query  594  SVVDEKNGVSADL-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVDE  G S+ + HDA CSACEM VVWMQ QL +N TQ+ IL+YVNELC ++P+P+G+S
Sbjct  363  SVVDENGGKSSGITHDASCSACEMAVVWMQTQLKQNLTQDRILNYVNELCEKMPNPLGQS  422

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS+MPSVSF+IGGKVF+L+P EYILKVGEGS AQCISGFT +D+PPPRGPLWIL
Sbjct  423  AVDCGKLSSMPSVSFTIGGKVFELTPEEYILKVGEGSQAQCISGFTNMDIPPPRGPLWIL  482

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMGRYHTVFD GKMRVGFAEAA
Sbjct  483  GDIFMGRYHTVFDAGKMRVGFAEAA  507



>ref|XP_007020768.1| Aspartic proteinase A1 [Theobroma cacao]
 gb|EOY12293.1| Aspartic proteinase A1 [Theobroma cacao]
Length=514

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            +NHAIGA GVVS+ECK VV  YG+ +ID+L+ + +P KICSQIGLCTF+G RGVS GIES
Sbjct  311  VNHAIGASGVVSQECKTVVSQYGETIIDMLLSKDQPLKICSQIGLCTFDGTRGVSTGIES  370

Query  591  VVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV E  G  + DLHDAMCS CEMTV+WMQNQL +NQTQE IL Y+NELC+RLPSPMGES 
Sbjct  371  VVHENAGKATGDLHDAMCSTCEMTVIWMQNQLKQNQTQERILEYINELCDRLPSPMGESA  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  LSTMP+VSF+IGGK+F+LSP +Y+LKVGEG  AQC+SGFTALDVPPPRGPLWILG
Sbjct  431  VDCSSLSTMPNVSFTIGGKIFELSPEQYVLKVGEGDVAQCLSGFTALDVPPPRGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG++HTVFDYG ++VGFAEAA
Sbjct  491  DVFMGQFHTVFDYGNLQVGFAEAA  514



>ref|XP_007153977.1| hypothetical protein PHAVU_003G0808001g, partial [Phaseolus vulgaris]
 gb|ESW25971.1| hypothetical protein PHAVU_003G0808001g, partial [Phaseolus vulgaris]
Length=369

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G++S+ECK VV  YGQ +++LL+ E +PKKICSQIGLCTF+G RG+ MGI
Sbjct  164  TMINHAIGAAGIMSQECKTVVAEYGQTILNLLLAETQPKKICSQIGLCTFDGTRGIDMGI  223

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
             SVVDE     S  LHDA CSACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGE
Sbjct  224  ASVVDEIARKSSGGLHDAACSACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGE  283

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +DCG +S++P VSF+IGG+ FDL P EYILKVGEG  AQCISGFTA+D+PPPRGPLWI
Sbjct  284  SSIDCGNISSLPVVSFTIGGRTFDLLPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWI  343

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+G +RVGFA+AA
Sbjct  344  LGDVFMGRYHTVFDFGNLRVGFADAA  369



>gb|KHG11143.1| Aspartic proteinase [Gossypium arboreum]
Length=520

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 180/212 (85%), Gaps = 7/212 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S+ECKAVV+ YGQ +IDLLV +A P KICS+IGLC F+G+ GVSMGI
Sbjct  309  TMINQAIGASGVASQECKAVVQQYGQTIIDLLVSQAEPMKICSRIGLCAFDGSHGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            E+VVDE NG S+  LH AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGE
Sbjct  369  ENVVDESNGKSSGILHSAMCPACEMAVVWMQNQLIENQTQDRILDYANQLCDRVPNPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW-  244
            S VDCG LS+MP++SF+IGGK FDL+P EYILKVGEG+ AQCISGFTALDVPPPRGPLW 
Sbjct  429  STVDCGSLSSMPTISFTIGGKAFDLTPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWY  488

Query  243  -----ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
                 ILGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  489  FIFALILGDVFMGRYHTVFDFGKLRVGFAEAA  520



>emb|CAC86003.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            +NHAIGA GVVS+ECK VV  YG+ +ID+L+ + +P KICSQIGLCTF+G RGVS GIES
Sbjct  311  VNHAIGASGVVSQECKTVVSQYGETIIDMLLSKDQPLKICSQIGLCTFDGTRGVSTGIES  370

Query  591  VVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV E  G  + DLHDAMCS CEMTV+WMQNQL +NQTQE IL Y+NELC+RLPSPMGES 
Sbjct  371  VVHENVGKATGDLHDAMCSTCEMTVIWMQNQLKQNQTQERILEYINELCDRLPSPMGESA  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  LSTMP+VSF+IGGK+F+LSP +Y+LKVGEG  AQC+SGFTALDVPPPRGPLWILG
Sbjct  431  VDCSSLSTMPNVSFTIGGKIFELSPEQYVLKVGEGDVAQCLSGFTALDVPPPRGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG++HTVFDYG ++VGFAEAA
Sbjct  491  DVFMGQFHTVFDYGNLQVGFAEAA  514



>gb|KCW66977.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
Length=386

 Score =   330 bits (845),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKAVV  YG+ +I  L+ +  P KICS+IGLCTF+G RGVSMGI
Sbjct  181  TEVNHAIGAAGVVSEECKAVVAQYGETIIQKLLAKEEPHKICSEIGLCTFDGTRGVSMGI  240

Query  597  ESVVDEKN-GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            E+VVD KN  VS  L+DAMCS CEMTVVWMQNQL  N+TQ+ ILSYVNELC+RLPSPMGE
Sbjct  241  ETVVDGKNEKVSGRLNDAMCSTCEMTVVWMQNQLRLNETQDRILSYVNELCSRLPSPMGE  300

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+VSF+IGG+VFDLSP +YILKVG+G +AQCISGFTALDVPPPRGPLWI
Sbjct  301  SAVDCAGLSSMPNVSFTIGGRVFDLSPEQYILKVGDGDSAQCISGFTALDVPPPRGPLWI  360

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFDYG +RVGFA+AA
Sbjct  361  LGDVFMGQYHTVFDYGNLRVGFAKAA  386



>gb|KCW77002.1| hypothetical protein EUGRSUZ_D01351 [Eucalyptus grandis]
Length=514

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN+AIGA GV S+ECKAVV  YGQ ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGI
Sbjct  309  TMINNAIGASGVASQECKAVVAQYGQTIMDLLLAEASPKKICSQVGVCTFDGNRGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+  G S+  +HDAMCSACEM VVWMQ+QL +NQTQ+ +L+YVNELC+R+PSP GE
Sbjct  369  ESVVDKTKGRSSGFMHDAMCSACEMAVVWMQSQLEQNQTQKRVLNYVNELCDRVPSPNGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC KLS+MP VSF++GGKVFDLSPNEY+LKVG+    QCISGFT LDVPPPRGPLWI
Sbjct  429  SSVDCEKLSSMPVVSFTLGGKVFDLSPNEYVLKVGQEPNTQCISGFTGLDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFM RYHTVFDYG +RVGFAEAA
Sbjct  489  LGDVFMRRYHTVFDYGNIRVGFAEAA  514



>ref|XP_009357472.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
 ref|XP_009357473.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   333 bits (855),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            +IN AIGA GVVS+ECKAVV  YGQ ++DLL  EA+PKK+CSQIGLCTF+G R VSMGIE
Sbjct  303  LINRAIGASGVVSQECKAVVNQYGQTILDLLFAEAQPKKVCSQIGLCTFDGTRSVSMGIE  362

Query  594  SVVDEKNGVSADL-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVDE  G S+ + HDA CSACEM VVWMQ QL  N T++ IL+YVNELC ++P+P+G+S
Sbjct  363  SVVDENGGKSSGITHDASCSACEMAVVWMQTQLKHNLTEDRILNYVNELCEKMPNPLGQS  422

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCGKLS+MPSVSF+IGGKVF+L+P+EYILKVGEGS AQCISGFT +D+PPPRGPLWIL
Sbjct  423  AVDCGKLSSMPSVSFTIGGKVFELTPDEYILKVGEGSQAQCISGFTNMDIPPPRGPLWIL  482

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMGRYHTVFD GKMRVGFAEAA
Sbjct  483  GDIFMGRYHTVFDAGKMRVGFAEAA  507



>ref|XP_002279049.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 emb|CBI26663.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   333 bits (855),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G VS+EC+AVV+ YGQ +ID+L+ + +P+KICSQIGLC FNG RGVSMGI
Sbjct  309  TEVNHAIGASGFVSQECRAVVQQYGQIIIDMLLTKEQPQKICSQIGLCAFNGIRGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE N  ++D LHD MCSAC M VVW+QN+L +N+T + IL YVNELC+RLPSPMGE
Sbjct  369  ESVVDENNSKASDGLHDTMCSACSMAVVWIQNKLGQNETIDRILKYVNELCDRLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP+VS +IGGKVFDLSP +YILKVGEG  AQCISGFTALDVPPP GPLWI
Sbjct  429  SAVDCGSLSSMPNVSLTIGGKVFDLSPKQYILKVGEGEIAQCISGFTALDVPPPHGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFDYG M+VGFAEAA
Sbjct  489  LGDVFMGQYHTVFDYGNMKVGFAEAA  514



>ref|XP_010052871.1| PREDICTED: aspartic proteinase [Eucalyptus grandis]
Length=522

 Score =   334 bits (856),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN+AIGA GV S+ECKAVV  YGQ ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGI
Sbjct  317  TMINNAIGASGVASQECKAVVAQYGQTIMDLLLAEASPKKICSQVGVCTFDGNRGVSMGI  376

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+  G S+  +HDAMCSACEM VVWMQ+QL +NQTQ+ +L+YVNELC+R+PSP GE
Sbjct  377  ESVVDKTKGRSSGFMHDAMCSACEMAVVWMQSQLEQNQTQKRVLNYVNELCDRVPSPNGE  436

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC KLS+MP VSF++GGKVFDLSPNEY+LKVG+    QCISGFT LDVPPPRGPLWI
Sbjct  437  SSVDCEKLSSMPVVSFTLGGKVFDLSPNEYVLKVGQEPNTQCISGFTGLDVPPPRGPLWI  496

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFM RYHTVFDYG +RVGFAEAA
Sbjct  497  LGDVFMRRYHTVFDYGNIRVGFAEAA  522



>ref|XP_003534602.1| PREDICTED: aspartic proteinase [Glycine max]
 gb|KHN40871.1| Aspartic proteinase [Glycine soja]
Length=507

 Score =   333 bits (854),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GVVSKEC++VV  YGQ +++LL+ EA+PKKICSQIGLCTF+G  GVSMGI
Sbjct  302  TMINQAIGASGVVSKECRSVVNQYGQTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGI  361

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ +   S  + DA CSACEM V+WMQNQL +NQT++ I+ Y NELC++LP+PMG+
Sbjct  362  ESVVDKNERKSSGSIRDAGCSACEMAVIWMQNQLRQNQTEDRIIDYANELCDKLPNPMGQ  421

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC KLS+MP VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  422  SSVDCEKLSSMPIVSFTIGGKVFDLSPQEYILKVGEGPEAQCISGFTALDVPPPRGPLWI  481

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHT+FDYGK+RVGFAEAA
Sbjct  482  LGDVFMGRYHTIFDYGKLRVGFAEAA  507



>gb|KHN33009.1| Aspartic proteinase [Glycine soja]
Length=504

 Score =   333 bits (854),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GVVSKEC++VV  YGQ +++LL+ EA+PKKICSQIGLCTF+G  GVSMGI
Sbjct  299  TMINQAIGAAGVVSKECRSVVNQYGQTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGI  358

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ +   S  + DA CSACEM V+WMQNQL +NQT++ I+ Y NELC +LP+PMG 
Sbjct  359  ESVVDKNEKKSSGGIRDAGCSACEMAVIWMQNQLRQNQTEDRIIDYANELCEKLPNPMGP  418

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MP VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  419  SSVDCGKLSSMPIVSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTALDVPPPRGPLWI  478

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHT+FDYGK+RVGFAEAA
Sbjct  479  LGDVFMGRYHTIFDYGKLRVGFAEAA  504



>ref|XP_006449766.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
 gb|ESR63006.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
Length=514

 Score =   333 bits (854),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVS GI
Sbjct  309  TMINHAIGASGVVSQQCKAVVEQYGQTILDLLLSEAHPKKICSQMGLCTFDGKRGVSTGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE NG S+  L++AMCSACEM VVWMQNQL +NQTQENIL YVNELC+R+PSPMGE
Sbjct  369  ESVVDESNGKSSGVLNNAMCSACEMAVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MP VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTA+DVPPPRGPLWI
Sbjct  429  SAVDCGKLSSMPIVSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  489  LGDVFMGRYHTVFDFGKLRVGFAEAA  514



>ref|XP_009415269.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   333 bits (854),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 179/204 (88%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INH IGA GVVS+ECKAVV  YGQ+++DLL+ E +P KIC+QIGLCTF+G RG+S+G+ES
Sbjct  311  INHKIGASGVVSQECKAVVAEYGQQILDLLLAETQPAKICAQIGLCTFDGTRGISIGLES  370

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV++   +SA L  DAMCSACEM VVWMQNQL +NQT+E+IL+Y+NELC+RLPSPMGES 
Sbjct  371  VVNDNGDISAGLQSDAMCSACEMAVVWMQNQLRQNQTKEHILNYINELCDRLPSPMGESA  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG L++MP VSF+IGGKVF+L P +YILKVGEGS AQCISGFTA D+PPPRGPLWILG
Sbjct  431  VDCGALASMPGVSFTIGGKVFELKPEQYILKVGEGSVAQCISGFTAFDIPPPRGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG +R+GFAEAA
Sbjct  491  DVFMGAYHTVFDYGNLRIGFAEAA  514



>ref|XP_003546159.1| PREDICTED: aspartic proteinase-like [Glycine max]
Length=507

 Score =   333 bits (853),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GVVSKEC++VV  YGQ +++LL+ EA+PKKICSQIGLCTF+G  GVSMGI
Sbjct  302  TMINQAIGAAGVVSKECRSVVNQYGQTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGI  361

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ +   S  + DA CSACEM V+WMQNQL +NQT++ I+ Y NELC +LP+PMG 
Sbjct  362  ESVVDKNEKKSSGGIRDAGCSACEMAVIWMQNQLRQNQTEDRIIDYANELCEKLPNPMGP  421

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MP VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  422  SSVDCGKLSSMPIVSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTALDVPPPRGPLWI  481

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHT+FDYGK+RVGFAEAA
Sbjct  482  LGDVFMGRYHTIFDYGKLRVGFAEAA  507



>ref|XP_009110686.1| PREDICTED: aspartic proteinase A1-like [Brassica rapa]
Length=507

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV S++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  302  TMINHAIGASGVASQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGI  361

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL YVNELC R+PSPMGE
Sbjct  362  ESVVDKENAKLSNGVGDAGCSACEMAVVWIQSQLRQNMTQERILDYVNELCERIPSPMGE  421

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P+EYILKVGEG+AAQCISGF ALDV PPRGPLWI
Sbjct  422  SAVDCAQLSTMPTVSLTIGGKVFDLAPHEYILKVGEGAAAQCISGFIALDVAPPRGPLWI  481

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+GK +VGFAEAA
Sbjct  482  LGDVFMGKYHTVFDFGKAQVGFAEAA  507



>ref|XP_006452415.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
 gb|ESR65655.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
Length=514

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGI
Sbjct  309  TQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGI  368

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV E N   S   HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGE
Sbjct  369  ESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LS++P VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLWI
Sbjct  429  SAVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDY  MRVGFAEAA
Sbjct  489  LGDVFMGPYHTVFDYSNMRVGFAEAA  514



>ref|XP_008385865.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=228

 Score =   323 bits (827),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG+ +I+ ++ + +P KICS IGLC+F+G RGVS+GI
Sbjct  23   TELNHAIGASGIVSQECKTVVAQYGETIIERILAKDQPAKICSXIGLCSFDGTRGVSIGI  82

Query  597  ESVVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVV+E  + VS  L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGE
Sbjct  83   KSVVEENAHKVSGGLSDATCSACEMTVVWMQNQLKQNQTQERILDYVNQLCERLPSPMGE  142

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP+VSF+IGG+ FDL+P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  143  SAVDCGGLSSMPNVSFTIGGRTFDLTPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWI  202

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  203  LGDVFMGRYHTVFDYGNERIGFAEAA  228



>dbj|BAH20208.1| AT1G11910 [Arabidopsis thaliana]
Length=389

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  184  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI  243

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSPMGE
Sbjct  244  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGE  303

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGPLWI
Sbjct  304  SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWI  363

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+G  +VGFAEAA
Sbjct  364  LGDVFMGKYHTVFDFGNEQVGFAEAA  389



>ref|XP_006475035.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO62070.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
 gb|KDO62071.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=514

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGI
Sbjct  309  TQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGI  368

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV E N   S   HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGE
Sbjct  369  ESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LS++P VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLWI
Sbjct  429  SAVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDY  MRVGFAEAA
Sbjct  489  LGDVFMGPYHTVFDYSNMRVGFAEAA  514



>gb|KDO62068.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=510

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGI
Sbjct  305  TQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGI  364

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV E N   S   HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGE
Sbjct  365  ESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGE  424

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LS++P VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLWI
Sbjct  425  SAVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWI  484

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDY  MRVGFAEAA
Sbjct  485  LGDVFMGPYHTVFDYSNMRVGFAEAA  510



>dbj|BAB20970.1| aspartic proteinase 2 [Nepenthes alata]
Length=514

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INHAIGA G+VS+ECKAVV  YG+ ++D LV EA+P+KICSQIGLCTF+G RGVSMGIES
Sbjct  311  INHAIGASGLVSQECKAVVSQYGKAILDALVAEAQPQKICSQIGLCTFDGKRGVSMGIES  370

Query  591  VVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV++  G S+D L DAMC+ACEM VVWMQNQL +N+T+E IL+YVNELCNRLPSPMGES 
Sbjct  371  VVEKNPGNSSDGLQDAMCTACEMAVVWMQNQLRQNRTEEQILNYVNELCNRLPSPMGESS  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG LS+MP+VS +IGGKVFDLSP +Y+LKVGEG AAQCISGF ALD+ PPRGPLWILG
Sbjct  431  VDCGSLSSMPNVSLTIGGKVFDLSPEKYVLKVGEGVAAQCISGFIALDIAPPRGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            D+FMG+YHTVFDYG + VGFAEAA
Sbjct  491  DIFMGQYHTVFDYGNLSVGFAEAA  514



>ref|XP_011046729.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
 ref|XP_011046731.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
Length=515

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECK VV  YG  +I++L+ + +P+KICSQIGLCTF+G RGVS+GI
Sbjct  310  TEVNHAIGATGVVSQECKEVVAQYGDTIIEMLLAKDQPQKICSQIGLCTFDGTRGVSVGI  369

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV+E    ++D  HDAMCS CEM VVWMQNQL +NQTQE IL YVNELC RLPSPMGE
Sbjct  370  ESVVNEHAQKASDGFHDAMCSTCEMAVVWMQNQLKQNQTQERILDYVNELCERLPSPMGE  429

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+VSF+IGG+VFDLSP +Y+LKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  430  SAVDCDGLSSMPNVSFTIGGRVFDLSPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWI  489

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGR+HTVFDYG MRVGFAEA+
Sbjct  490  LGDVFMGRFHTVFDYGNMRVGFAEAS  515



>ref|XP_006467405.1| PREDICTED: aspartic proteinase-like isoform X2 [Citrus sinensis]
 ref|XP_006467406.1| PREDICTED: aspartic proteinase-like isoform X3 [Citrus sinensis]
 gb|KDO78299.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78300.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78301.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=514

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVSMGI
Sbjct  309  TMINHAIGASGVVSQQCKAVVEQYGQTILDLLLFEAHPKKICSQMGLCTFDGKRGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE N  S+  L++AMCSACEM VVWMQNQL +NQTQENIL YVNELC+R+PSPMGE
Sbjct  369  ESVVDESNDKSSGVLNNAMCSACEMAVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MP VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTA+DVPPPRGPLWI
Sbjct  429  SAVDCGKLSSMPIVSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+G++RVGFAEAA
Sbjct  489  LGDVFMGRYHTVFDFGELRVGFAEAA  514



>ref|XP_008348384.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase A1-like [Malus 
domestica]
Length=469

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG+ +I+ ++ + +P KICSQIGLC+F+G  GVS+GI
Sbjct  265  TELNHAIGASGIVSQECKTVVAEYGETIIERILAKDQPAKICSQIGLCSFDGTHGVSIGI  324

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVV+  + VS DL DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC+RLPSPMGES
Sbjct  325  KSVVENTHKVSGDLSDATCSACEMTVVWMQNQLKQNQTQERILDYVNQLCDRLPSPMGES  384

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  LS+MPSVSF+IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWIL
Sbjct  385  AVDCAGLSSMPSVSFTIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWIL  444

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  445  GDVFMGRYHTVFDYGNERIGFAEAA  469



>gb|ABO93618.1| aspartic proteinase [Vitis vinifera]
Length=194

 Score =   321 bits (822),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 171/194 (88%), Gaps = 1/194 (1%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INHAIGA GVVS+ECK VV  YG+ ++DLL+ EA P+KICSQIGLCTF+G RGV MGIES
Sbjct  1    INHAIGATGVVSQECKTVVAQYGETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIES  60

Query  591  VVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VVDEKNG  S+ +HDA CSACEM VVWMQ+QL +NQT+E IL YVNELC+RLPSPMGES 
Sbjct  61   VVDEKNGDKSSGVHDAGCSACEMAVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGESA  120

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC +LS+MP+VS +I GKVFDLS NEY+LKVGEG+AAQCISGF A+DVPPPRGPLWILG
Sbjct  121  VDCLQLSSMPNVSLTISGKVFDLSANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWILG  180

Query  234  DVFMGRYHTVFDYG  193
            DVFMGRYHTVFDYG
Sbjct  181  DVFMGRYHTVFDYG  194



>emb|CDY21021.1| BnaA08g25040D [Brassica napus]
Length=526

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV S++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  321  TMINHAIGASGVASQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGI  380

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL YVNELC R+PSPMGE
Sbjct  381  ESVVDKENAKLSNGVGDAGCSACEMAVVWIQSQLRQNMTQERILDYVNELCERIPSPMGE  440

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P+EYILKVGEG+AAQCISGF ALDV PPRGPLWI
Sbjct  441  SAVDCAQLSTMPTVSLTIGGKVFDLAPHEYILKVGEGAAAQCISGFIALDVAPPRGPLWI  500

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+GK +VGFAEAA
Sbjct  501  LGDVFMGKYHTVFDFGKAQVGFAEAA  526



>ref|XP_007049085.1| Aspartic protease isoform 2 [Theobroma cacao]
 gb|EOX93242.1| Aspartic protease isoform 2 [Theobroma cacao]
Length=514

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECKA+V  YG+ +++LLV E +P+KICSQIG CTF+G RGVS  I
Sbjct  309  TQINHAIGASGVVSQECKAIVSQYGKMILELLVSETQPQKICSQIGFCTFDGTRGVSTRI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESV DE  G S+D +HDAMC+ACEM VVWMQN+L  N+T+E IL YVNELC RLPSP GE
Sbjct  369  ESVADEIVGKSSDGVHDAMCTACEMAVVWMQNKLRRNETEEQILDYVNELCERLPSPNGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP VSF+IGGKVFDL+P EY+LKVGEG+ AQCISGFTALDVPPPRGPLWI
Sbjct  429  SVVDCSSLSSMPGVSFTIGGKVFDLAPEEYVLKVGEGAVAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG M VGFAEAA
Sbjct  489  LGDVFMGRYHTVFDYGNMTVGFAEAA  514



>gb|AAB03108.1| aspartic protease [Brassica napus]
 emb|CDY34613.1| BnaC08g41720D [Brassica napus]
Length=506

 Score =   331 bits (849),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  301  TMINHAIGAAGVVSQQCKIVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGI  360

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  S+  + DA CSACEM VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGE
Sbjct  361  ESVVDKENAKSSSGVGDAACSACEMAVVWIQSQLRQNMTQERILDYINDLCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+GK +VGFAEAA
Sbjct  481  LGDVFMGKYHTVFDFGKEQVGFAEAA  506



>emb|CDY31221.1| BnaC08g15160D [Brassica napus]
Length=595

 Score =   333 bits (855),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV S++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  390  TMINHAIGASGVASQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGI  449

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL YVNELC R+PSPMGE
Sbjct  450  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILDYVNELCERIPSPMGE  509

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P+EY+LKVGEG+AAQCISGF ALDV PPRGPLWI
Sbjct  510  SAVDCAQLSTMPTVSLTIGGKVFDLAPHEYVLKVGEGAAAQCISGFIALDVAPPRGPLWI  569

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+GK +VGFAEAA
Sbjct  570  LGDVFMGKYHTVFDFGKAQVGFAEAA  595



>ref|XP_007049084.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
 gb|EOX93241.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
Length=550

 Score =   332 bits (850),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECKA+V  YG+ +++LLV E +P+KICSQIG CTF+G RGVS  I
Sbjct  345  TQINHAIGASGVVSQECKAIVSQYGKMILELLVSETQPQKICSQIGFCTFDGTRGVSTRI  404

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESV DE  G S+D +HDAMC+ACEM VVWMQN+L  N+T+E IL YVNELC RLPSP GE
Sbjct  405  ESVADEIVGKSSDGVHDAMCTACEMAVVWMQNKLRRNETEEQILDYVNELCERLPSPNGE  464

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP VSF+IGGKVFDL+P EY+LKVGEG+ AQCISGFTALDVPPPRGPLWI
Sbjct  465  SVVDCSSLSSMPGVSFTIGGKVFDLAPEEYVLKVGEGAVAQCISGFTALDVPPPRGPLWI  524

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG M VGFAEAA
Sbjct  525  LGDVFMGRYHTVFDYGNMTVGFAEAA  550



>ref|XP_006467404.1| PREDICTED: aspartic proteinase-like isoform X1 [Citrus sinensis]
Length=598

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVSMGI
Sbjct  393  TMINHAIGASGVVSQQCKAVVEQYGQTILDLLLFEAHPKKICSQMGLCTFDGKRGVSMGI  452

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE N  S+  L++AMCSACEM VVWMQNQL +NQTQENIL YVNELC+R+PSPMGE
Sbjct  453  ESVVDESNDKSSGVLNNAMCSACEMAVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGE  512

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MP VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTA+DVPPPRGPLWI
Sbjct  513  SAVDCGKLSSMPIVSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWI  572

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+G++RVGFAEAA
Sbjct  573  LGDVFMGRYHTVFDFGELRVGFAEAA  598



>ref|NP_172655.1| aspartic proteinase A1 [Arabidopsis thaliana]
 sp|O65390.1|APA1_ARATH RecName: Full=Aspartic proteinase A1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC17620.1| Identical to aspartic proteinase cDNA gb|U51036 from A. thaliana. 
ESTs gb|N96313, gb|T21893, gb|R30158, gb|T21482, gb|T43650, 
gb|R64749, gb|R65157, gb|T88269, gb|T44552, gb|T22542, 
gb|T76533, gb|T44350, gb|Z34591, gb|AA728734, gb|T46003, gb|R65157, 
gb|N38290, gb|AA395468, gb|T20815 and gb|Z34173 come 
from this gene [Arabidopsis thaliana]
 gb|AAL08243.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL08259.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL36330.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAM66979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAN71979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AEE28813.1| aspartic proteinase A1 [Arabidopsis thaliana]
Length=506

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  301  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI  360

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSPMGE
Sbjct  361  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+G  +VGFAEAA
Sbjct  481  LGDVFMGKYHTVFDFGNEQVGFAEAA  506



>gb|AAC49730.1| aspartic proteinase [Arabidopsis thaliana]
Length=486

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  281  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI  340

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSPMGE
Sbjct  341  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGE  400

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGPLWI
Sbjct  401  SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWI  460

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+G  +VGFAEAA
Sbjct  461  LGDVFMGKYHTVFDFGNEQVGFAEAA  486



>ref|XP_002892661.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68920.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  301  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI  360

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSPMGE
Sbjct  361  ESVVDKENSKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+G  +VGFAEAA
Sbjct  481  LGDVFMGKYHTVFDFGNEQVGFAEAA  506



>ref|XP_010546667.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
 ref|XP_010546675.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
Length=508

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 178/204 (87%), Gaps = 4/204 (2%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CKAVV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G  GVSMGI+
Sbjct  309  MINKAIGASGVVSQQCKAVVDQYGQTILDLLLAETQPKKICSQIGLCTFDGAHGVSMGIK  368

Query  594  SVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            SVV+ +NGV    +D  CSACEM VVW+QNQL +N TQ+ IL+Y+NELC R+PSPMGES 
Sbjct  369  SVVERENGV----NDGACSACEMAVVWIQNQLRQNMTQDRILNYINELCERMPSPMGESA  424

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG+LS+MP+VSFSIGGKVF+L+P EY+LKVGEG  AQCISGF ALDVPPPRGPLWILG
Sbjct  425  VDCGQLSSMPTVSFSIGGKVFELAPEEYVLKVGEGPVAQCISGFIALDVPPPRGPLWILG  484

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG+YHTVFD+G MRVGFAEAA
Sbjct  485  DVFMGKYHTVFDFGNMRVGFAEAA  508



>ref|XP_011461056.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG  +I +++ + +P+KICSQIGLCTF+G RGVS+GI
Sbjct  309  TELNHAIGATGIVSQECKTVVAEYGDTIIKMILAKDQPQKICSQIGLCTFDGTRGVSVGI  368

Query  597  ESVVDEKN-GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE N   SA L DAMCSACEMTVVWMQNQL +NQTQ+ IL YVN+LC+RLPSPMGE
Sbjct  369  KSVVDENNHKSSAGLSDAMCSACEMTVVWMQNQLKQNQTQDRILDYVNQLCDRLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MPSVSF+IGGK FDL+P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  429  SAVDCAGLSSMPSVSFTIGGKQFDLAPEQYVLKVGEGEVAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+GK R+GFAEAA
Sbjct  489  LGDVFMGQYHTVFDFGKERIGFAEAA  514



>ref|XP_009361022.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=513

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG+ +I+ ++ + +P KICSQIGLC+F+G  GVS+GI
Sbjct  309  TELNHAIGASGIVSQECKTVVAEYGETIIERILAKDQPAKICSQIGLCSFDGTHGVSIGI  368

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVV+  + VS DL DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC+RLPSPMGES
Sbjct  369  KSVVENTHKVSGDLSDATCSACEMTVVWMQNQLKQNQTQERILDYVNQLCDRLPSPMGES  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  LS+MP+VSF+IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWIL
Sbjct  429  AVDCAGLSSMPNVSFTIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  489  GDVFMGRYHTVFDYGNERIGFAEAA  513



>ref|XP_010476135.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   329 bits (843),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  301  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI  360

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGE
Sbjct  361  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYINELCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LST+P+VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCTQLSTLPTVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+G  +VGFAEAA
Sbjct  481  LGDVFMGKYHTVFDFGNEQVGFAEAA  506



>ref|XP_010458606.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
 ref|XP_010458607.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
Length=506

 Score =   329 bits (843),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  301  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI  360

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGE
Sbjct  361  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYINELCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LST+P+VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCTQLSTLPTVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFD+G  +VGFAEAA
Sbjct  481  LGDVFMGKYHTVFDFGNEQVGFAEAA  506



>ref|XP_010060310.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010060311.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW66975.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
 gb|KCW66976.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
Length=515

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKAVV  YG+ +I  L+ +  P KICS+IGLCTF+G RGVSMGI
Sbjct  310  TEVNHAIGAAGVVSEECKAVVAQYGETIIQKLLAKEEPHKICSEIGLCTFDGTRGVSMGI  369

Query  597  ESVVDEKN-GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            E+VVD KN  VS  L+DAMCS CEMTVVWMQNQL  N+TQ+ ILSYVNELC+RLPSPMGE
Sbjct  370  ETVVDGKNEKVSGRLNDAMCSTCEMTVVWMQNQLRLNETQDRILSYVNELCSRLPSPMGE  429

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+VSF+IGG+VFDLSP +YILKVG+G +AQCISGFTALDVPPPRGPLWI
Sbjct  430  SAVDCAGLSSMPNVSFTIGGRVFDLSPEQYILKVGDGDSAQCISGFTALDVPPPRGPLWI  489

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFDYG +RVGFA+AA
Sbjct  490  LGDVFMGQYHTVFDYGNLRVGFAKAA  515



>ref|XP_002298827.2| aspartic protease family protein [Populus trichocarpa]
 gb|EEE83632.2| aspartic protease family protein [Populus trichocarpa]
Length=515

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKAVV  YG  ++++L+ + +P+KIC+QIGLCTF+G RGVSMGI
Sbjct  310  TEVNHAIGATGVVSQECKAVVAQYGDTIMEMLLAKDQPQKICAQIGLCTFDGTRGVSMGI  369

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV+E    ++D  HDAMCS CEM VVWMQNQL +NQTQE IL YVNELC RLPSPMGE
Sbjct  370  ESVVNEHAQKASDGFHDAMCSTCEMAVVWMQNQLKQNQTQERILDYVNELCERLPSPMGE  429

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+VSF+IGG+VF+LSP +Y+LKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  430  SAVDCDGLSSMPNVSFTIGGRVFELSPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWI  489

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG +HTVFDYG MRVGFAEA 
Sbjct  490  LGDVFMGSFHTVFDYGNMRVGFAEAT  515



>ref|XP_006417290.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
 dbj|BAJ34217.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35643.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
Length=506

 Score =   328 bits (841),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YG+ +++LL+ E +PKKICSQIGLCTFNG RGVSMGI
Sbjct  301  TMINHAIGAAGVVSQQCKTVVDQYGRTILELLLSETQPKKICSQIGLCTFNGKRGVSMGI  360

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL Y NELC RLPSPMGE
Sbjct  361  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILDYANELCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  481  LGDVFMGKYHTVFDFGKEQVGFAEA  505



>gb|AGP76185.1| aspartic proteinase [Brassica rapa subsp. chinensis]
Length=506

 Score =   328 bits (841),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVS+GI
Sbjct  301  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSVGI  360

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  S++ + DA CSACEM VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGE
Sbjct  361  ESVVDQENVKSSNGVGDAACSACEMAVVWIQSQLRQNMTQERILDYINDLCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMPSVS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCAQLSTMPSVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  481  LGDVFMGKYHTVFDFGKEQVGFAEA  505



>ref|XP_010493478.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
 ref|XP_010493486.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   328 bits (841),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  301  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI  360

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGE
Sbjct  361  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYINELCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LST+PSVS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCTQLSTLPSVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  481  LGDVFMGKYHTVFDFGNEQVGFAEA  505



>ref|XP_006303952.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
 gb|EOA36850.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
Length=538

 Score =   329 bits (843),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YG+ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGI
Sbjct  333  TMINHAIGAAGVVSQQCKTVVDQYGETILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI  392

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGE
Sbjct  393  ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYINELCERLPSPMGE  452

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDLSP EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  453  SAVDCAQLSTMPTVSLTIGGKVFDLSPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  512

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  513  LGDVFMGKYHTVFDFGNEQVGFAEA  537



>ref|XP_009118162.1| PREDICTED: aspartic proteinase A1 [Brassica rapa]
Length=506

 Score =   328 bits (840),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G R VSMGI
Sbjct  301  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRDVSMGI  360

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  S++ + DA CSACEM VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGE
Sbjct  361  ESVVDKENAKSSNGVGDAACSACEMAVVWIQSQLRQNMTQERILDYINDLCERLPSPMGE  420

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  421  SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  480

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  481  LGDVFMGKYHTVFDFGKEQVGFAEA  505



>gb|KJB13720.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=375

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSM I
Sbjct  170  TQINHAIGASGVVSQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEI  229

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+V+E  G  S  L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGE
Sbjct  230  ESIVNENAGKASGSLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGE  289

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +DC  LS+MPSVSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  290  SSIDCKSLSSMPSVSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWI  349

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG++HTVFDYG M++GFAEAA
Sbjct  350  LGDVFMGQFHTVFDYGNMQIGFAEAA  375



>emb|CDY34819.1| BnaA09g47450D [Brassica napus]
Length=615

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 180/205 (88%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CK VV+ YGQ ++DLL+ EA+PKKICSQIGLCTF+G RGVS+GI
Sbjct  410  TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSEAQPKKICSQIGLCTFDGKRGVSVGI  469

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD++N  S++ + DA CSACEM VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGE
Sbjct  470  ESVVDQENVKSSNGVGDAACSACEMAVVWIQSQLRQNMTQERILDYINDLCERLPSPMGE  529

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  530  SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWI  589

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  590  LGDVFMGKYHTVFDFGKEQVGFAEA  614



>ref|XP_008380299.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=513

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG+ +I+ ++ + +P KICSQIGLC+F+G  GVS+GI
Sbjct  309  TELNHAIGASGIVSQECKTVVAEYGETIIERILAKDQPAKICSQIGLCSFDGTHGVSIGI  368

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVV   + VS DL DA CSACEMTVVWMQNQL + QTQE IL YVN+LC+RLPSPMGES
Sbjct  369  KSVVXNTHKVSGDLSDATCSACEMTVVWMQNQLKQXQTQERILDYVNQLCDRLPSPMGES  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  LS+MPSVSF+IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWIL
Sbjct  429  AVDCAGLSSMPSVSFTIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  489  GDVFMGRYHTVFDYGNERIGFAEAA  513



>dbj|BAB20969.1| aspartic proteinase 1 [Nepenthes alata]
Length=514

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 175/203 (86%), Gaps = 1/203 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INHAIGA GVVS+ECKAVV  YG  ++D+L+ E +PKKICSQIGLCTF+G RGVS+GI+S
Sbjct  311  INHAIGASGVVSQECKAVVAQYGTAILDMLISETQPKKICSQIGLCTFDGKRGVSVGIKS  370

Query  591  VVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VVD   +G S+ L DA C+ACEMTVVWMQNQL +NQT+E IL+YVNELCNRLPSPMGES 
Sbjct  371  VVDMNVDGSSSGLQDATCTACEMTVVWMQNQLKQNQTEERILNYVNELCNRLPSPMGESA  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  LS+MP VSF++GGKVFDL P +YIL+VGEG A QCISGFTALDV PP GPLWILG
Sbjct  431  VDCSSLSSMPGVSFTVGGKVFDLLPEQYILQVGEGVATQCISGFTALDVAPPLGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEA  166
            D+FMG+YHTVFDYG MRVGFAEA
Sbjct  491  DIFMGQYHTVFDYGNMRVGFAEA  513



>ref|XP_008357943.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=406

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK VVE YG+ +I++LV +A+P+KICSQIG CTF+G RGVS GI
Sbjct  200  TQINHAIGASGVVSQECKIVVEQYGKTIIEMLVAKAQPQKICSQIGFCTFDGTRGVSTGI  259

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+VD+K    +D +HDA C ACEM VVWMQN+L +NQT+E IL YVN+LC RLPSP GE
Sbjct  260  ESMVDQKQEKKSDGVHDATCVACEMAVVWMQNKLRKNQTEEQILDYVNQLCERLPSPSGE  319

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V+C  LS++PSVSF+IGGKVFDL+P +Y+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  320  SVVECDALSSLPSVSFTIGGKVFDLAPEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWI  379

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG + VGFAEAA
Sbjct  380  LGDVFMGRYHTVFDYGNLSVGFAEAA  405



>gb|KJB67247.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=510

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 176/206 (85%), Gaps = 5/206 (2%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S+ECKAVV+ YGQ +IDLLV +A P KICSQIGLC F+G+ GVSMGI
Sbjct  309  TMINQAIGASGVASQECKAVVQQYGQTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            E+VVDE NG S+  LH AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGE
Sbjct  369  ENVVDESNGKSSGILHSAMCPACEMAVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP++SF+IGGK F+L+P E    VGEG+ AQCISGFTALDVPPPRGPLWI
Sbjct  429  STVDCGSLSSMPTISFTIGGKAFELTPEE----VGEGAEAQCISGFTALDVPPPRGPLWI  484

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  485  LGDVFMGRYHTVFDFGKLRVGFAEAA  510



>gb|KDP39159.1| hypothetical protein JCGZ_00916 [Jatropha curcas]
Length=514

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 181/204 (89%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            +NHAIGA GVVS+ECKAVV  YG+ +I++L+ + +P+KICSQIGLCTF+G+RGVSMGIES
Sbjct  311  VNHAIGATGVVSQECKAVVAQYGETIIEMLLAKDQPEKICSQIGLCTFDGSRGVSMGIES  370

Query  591  VVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV+E +  +A  L D MCSACEM VVWMQN+L +N TQE+IL+YVN+LC +LPSPMGES 
Sbjct  371  VVNENDHEAAGGLRDTMCSACEMAVVWMQNKLKQNITQESILNYVNDLCEKLPSPMGESA  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG +ST+P+VSF+IGGKVFDL+P +Y+LKVGEG AAQCISGFTA+DVPPPRGPLWILG
Sbjct  431  VDCGSVSTLPNVSFTIGGKVFDLAPEQYVLKVGEGEAAQCISGFTAIDVPPPRGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG +HTVFDYG MRVGFAEAA
Sbjct  491  DVFMGPFHTVFDYGNMRVGFAEAA  514



>gb|ACN24614.1| aspartic acid protease [Phaseolus vulgaris]
Length=513

 Score =   326 bits (835),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G++S+ECK VV  YGQ +++LL+ E +PKKICSQIGLCTF+G RG+ MGI
Sbjct  308  TMINHAIGAAGIMSQECKTVVAEYGQTILNLLLAETQPKKICSQIGLCTFDGTRGIDMGI  367

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
             SVVDE     S  LHDA CSACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGE
Sbjct  368  ASVVDEIARKSSGGLHDAACSACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGE  427

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +D G +S++P VSF+IGG+ FDL P EYILKVGEG  AQCISGFTA+D+PPPRGPLWI
Sbjct  428  SSIDRGNISSLPVVSFTIGGRTFDLLPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWI  487

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+G +RVGFA+AA
Sbjct  488  LGDVFMGRYHTVFDFGNLRVGFADAA  513



>gb|KHN35722.1| Aspartic proteinase [Glycine soja]
Length=514

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV+S+ECK VV  YGQ ++DLL+ E +PKKICS+IGLC F+G RGV +GI
Sbjct  309  TMINHAIGASGVMSQECKTVVAEYGQTILDLLLSETQPKKICSRIGLCAFDGTRGVDVGI  368

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE +   S   H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGE
Sbjct  369  KSVVDENERKSSGGHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG +S++P VSF+IGG+ FDLSP EYILKVGEG  AQCISGFTA+D+PPPRGPLWI
Sbjct  429  SAVDCGNISSLPVVSFTIGGRTFDLSPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK RVGFA+AA
Sbjct  489  LGDVFMGRYHTVFDFGKQRVGFADAA  514



>gb|KHG05834.1| Asparticase [Gossypium arboreum]
Length=511

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSMGI
Sbjct  306  TQINHAIGASGVVSQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMGI  365

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+V+E  G  S  L DAMCS CEM V+WMQNQL +NQT+++I+ YVNELC+RLPSPMGE
Sbjct  366  ESIVNENAGKASGSLRDAMCSTCEMAVIWMQNQLKQNQTEDHIIDYVNELCDRLPSPMGE  425

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +DC  LS+MPSVSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  426  SSIDCKSLSSMPSVSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWI  485

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG++HTVFDYG M++GFAEAA
Sbjct  486  LGDVFMGQFHTVFDYGNMQIGFAEAA  511



>gb|KEH36904.1| fungal proteinase A, aspartic proteinase superfamily protein 
[Medicago truncatula]
Length=510

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S+EC+ VV+ YG  ++ LLV EA+PKK+CSQIGLCTF+G +G+SMGI
Sbjct  305  TMINQAIGASGVYSQECRTVVDQYGHSILQLLVAEAQPKKVCSQIGLCTFDGTQGISMGI  364

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVV++ + +S+  H DA CS CEM VVWMQNQL +NQT+E I++Y + LC+++P+P+G+
Sbjct  365  QSVVEQTDRISSGGHQDATCSVCEMAVVWMQNQLKQNQTEERIINYADSLCDKMPNPLGQ  424

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC K+S+MP VSF+IGGK FDL+P EYILKVGEG+AAQCISGFTALDVPPPRGPLWI
Sbjct  425  SSVDCAKISSMPKVSFTIGGKKFDLAPEEYILKVGEGAAAQCISGFTALDVPPPRGPLWI  484

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  485  LGDIFMGRYHTVFDYGKLRVGFAEAA  510



>ref|XP_007147707.1| hypothetical protein PHAVU_006G147900g [Phaseolus vulgaris]
 gb|ESW19701.1| hypothetical protein PHAVU_006G147900g [Phaseolus vulgaris]
Length=554

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN AIGA GVVSKECK+VVE YGQ +++LL+ EA+P KICSQIGLC+F+G RGVS GI
Sbjct  349  TEINQAIGASGVVSKECKSVVEQYGQTIMELLLAEAKPNKICSQIGLCSFDGTRGVSTGI  408

Query  597  ESVVDEKN-GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ N   S  + DA+CS CEM V+WMQNQL +NQT++ I+ YVN LC++LPSPMG+
Sbjct  409  ESVVDKNNRNSSGAIRDAVCSTCEMAVIWMQNQLRQNQTEDRIIDYVNGLCDKLPSPMGQ  468

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MP VSF++GGKVFDLSP EYILKVGEG  AQCISGF ALDVPPPRGPLWI
Sbjct  469  SSVDCGKLSSMPIVSFTVGGKVFDLSPKEYILKVGEGPQAQCISGFIALDVPPPRGPLWI  528

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHT+FDYG+ RVGFA AA
Sbjct  529  LGDVFMGRYHTIFDYGQQRVGFAVAA  554



>gb|KJB13722.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=492

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSM I
Sbjct  287  TQINHAIGASGVVSQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEI  346

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+V+E  G  S  L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGE
Sbjct  347  ESIVNENAGKASGSLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGE  406

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +DC  LS+MPSVSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  407  SSIDCKSLSSMPSVSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWI  466

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG++HTVFDYG M++GFAEAA
Sbjct  467  LGDVFMGQFHTVFDYGNMQIGFAEAA  492



>emb|CAM12780.1| aspartic proteinase [Fagopyrum esculentum]
Length=506

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INHAIGA GVVS+ECK VV  YG++++DLLV + +P+KICSQIGLCTF+G RGVSMGIES
Sbjct  303  INHAIGASGVVSQECKTVVSQYGKQILDLLVSQTQPRKICSQIGLCTFDGTRGVSMGIES  362

Query  591  VVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VVD+  +  S +L DA CSACEM VVWMQNQL +NQT++ IL Y N+LC RLPSPMGES 
Sbjct  363  VVDKNVDKSSGNLKDATCSACEMAVVWMQNQLKQNQTEDRILDYANQLCERLPSPMGESA  422

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG LST+P+VSF++GGK F L+P +YIL+VGEG A QCISGF ALDVPPPRGPLWILG
Sbjct  423  VDCGSLSTLPTVSFTLGGKTFALAPEQYILQVGEGPATQCISGFIALDVPPPRGPLWILG  482

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            D+FMG+YHTVFD+G M+VGFAEAA
Sbjct  483  DIFMGQYHTVFDHGNMQVGFAEAA  506



>gb|AAV84085.2| aspartic proteinase 9 [Fagopyrum esculentum]
Length=506

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INHAIGA GVVS+ECK VV  YG++++DLLV + +P+KICSQIGLCTF+G RGVSMGIES
Sbjct  303  INHAIGASGVVSQECKTVVSQYGKQILDLLVSQTQPRKICSQIGLCTFDGTRGVSMGIES  362

Query  591  VVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VVD+  +  S +L DA CSACEM VVWMQNQL +NQT++ IL Y N+LC RLPSPMGES 
Sbjct  363  VVDKNVDKSSGNLKDATCSACEMAVVWMQNQLKQNQTEDRILDYANQLCERLPSPMGESA  422

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDCG LST+P+VSF++GGK F L+P +YIL+VGEG A QCISGF ALDVPPPRGPLWILG
Sbjct  423  VDCGSLSTLPTVSFTLGGKTFALAPEQYILQVGEGPATQCISGFIALDVPPPRGPLWILG  482

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            D+FMG+YHTVFD+G M+VGFAEAA
Sbjct  483  DIFMGQYHTVFDHGNMQVGFAEAA  506



>ref|XP_006389579.1| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|ERP48493.1| aspartic endopeptidase family protein [Populus trichocarpa]
Length=512

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CKAVV  YG+ ++DLL+ E +PKKICSQIGLCTF+G RG+SMGI
Sbjct  307  TMINHAIGASGVVSQQCKAVVSQYGEVIMDLLLSEVQPKKICSQIGLCTFDGTRGISMGI  366

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE N  S+  L DAMCSACEM V WM++QL +NQTQ+ +L Y N+LC R+P+P G+
Sbjct  367  QSVVDEGNDKSSGVLGDAMCSACEMAVFWMRSQLQQNQTQDRVLDYANQLCERVPNPTGQ  426

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG + +MP ++F+IGGK F+L+P EYILKVG+GSAAQCISGFTALD+PPPRGPLWI
Sbjct  427  STVDCGSVLSMPRIAFTIGGKEFELAPEEYILKVGQGSAAQCISGFTALDIPPPRGPLWI  486

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  487  LGDVFMGRYHTVFDSGKLRVGFAEAA  512



>gb|AFW81161.1| hypothetical protein ZEAMMB73_941917 [Zea mays]
Length=243

 Score =   315 bits (806),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 170/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  37   TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSTGI  96

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD+K G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  97   RSVVDDKAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILTYINQLCERLPSPMG  156

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC  L +MP ++F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLW
Sbjct  157  ESAVDCASLGSMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLW  216

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  217  ILGDVFMGVYHTVFDYGKLRVGFAESA  243



>gb|AAB03843.2| aspartic proteinase [Vigna unguiculata]
 gb|AAQ14346.1| aspartic proteinase [Vigna unguiculata]
Length=513

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV+S+ECK VV  YGQ +++LL+ E +PKKICSQIGLCTF+G RGV MGI
Sbjct  308  TMINHAIGASGVMSQECKTVVAEYGQTILNLLLAETQPKKICSQIGLCTFDGTRGVDMGI  367

Query  597  ESVVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE     S  LHDA CSACEM VVW+QNQLS NQTQ+ ILSYVN+LC+++PSPMGE
Sbjct  368  ESVVDENARKSSGGLHDAGCSACEMAVVWVQNQLSRNQTQDQILSYVNQLCDKMPSPMGE  427

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V CG +S++P VSF+IGG+ FDL P EYILKVGEG  AQCISGFTA+D+ PPRGPLWI
Sbjct  428  SSVGCGDISSLPVVSFTIGGRTFDLRPEEYILKVGEGPVAQCISGFTAIDIAPPRGPLWI  487

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFD+G  RVGFAEAA
Sbjct  488  LGDVFMGPYHTVFDFGNQRVGFAEAA  513



>ref|XP_003529645.1| PREDICTED: aspartic proteinase-like isoform X1 [Glycine max]
 ref|XP_006584085.1| PREDICTED: aspartic proteinase-like isoform X2 [Glycine max]
Length=514

 Score =   323 bits (828),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV+S+ECK VV  YGQ ++DLL+ E +PKKICS+IGLC F+G RGV +GI
Sbjct  309  TMINHAIGASGVMSQECKTVVAEYGQTILDLLLSETQPKKICSRIGLCAFDGTRGVDVGI  368

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE +   S   H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGE
Sbjct  369  KSVVDENERKSSGGHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG +S++P VSF+IGG+ F+LSP EYILKVGEG  AQCISGFTA+D+PPPRGPLWI
Sbjct  429  SAVDCGNISSLPVVSFTIGGRTFELSPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK RVGFA+AA
Sbjct  489  LGDVFMGRYHTVFDFGKQRVGFADAA  514



>ref|XP_004486175.1| PREDICTED: aspartic proteinase-like isoform X1 [Cicer arietinum]
 ref|XP_004486176.1| PREDICTED: aspartic proteinase-like isoform X2 [Cicer arietinum]
 gb|AIA58652.1| aspartic proteinase [Cicer arietinum]
Length=508

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S+EC++ V+ YGQ ++ LL+ E +PKKICSQIGLCTF+G  GVSMGI
Sbjct  303  TMINQAIGASGVASQECRSFVDQYGQTILQLLLTETQPKKICSQIGLCTFDGTHGVSMGI  362

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVV++ + +S+  L DA CS CEM VVWMQNQL +NQT+E IL+YV+ LC+++P+PMG+
Sbjct  363  QSVVEQTDRISSGGLQDASCSVCEMAVVWMQNQLRQNQTEERILNYVHSLCDKMPNPMGQ  422

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC K+S+MP VSF+IGGK FDLS  EYILKVGEGSAAQCISGFTALDVPPPRGPLWI
Sbjct  423  SSVDCAKISSMPVVSFTIGGKKFDLSSQEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  482

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFDYGK+RVGFA+AA
Sbjct  483  LGDIFMGRYHTVFDYGKLRVGFAQAA  508



>ref|XP_007211824.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
 gb|EMJ13023.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
Length=514

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG+ +I+ ++ + +P+KICSQIGLCTF+G  GVS  I
Sbjct  309  TELNHAIGASGIVSQECKTVVAQYGETIIERILAKDQPQKICSQIGLCTFDGTHGVSTEI  368

Query  597  ESVVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVV+E  + VS  L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGE
Sbjct  369  KSVVEENTHKVSGGLSDASCSACEMTVVWMQNQLKQNQTQERILEYVNQLCERLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MPSVSF+IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWI
Sbjct  429  SAVDCSGLSSMPSVSFTIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  489  LGDVFMGRYHTVFDYGNERIGFAEAA  514



>gb|KJB13718.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
 gb|KJB13721.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
 gb|KJB13724.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=512

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSM I
Sbjct  307  TQINHAIGASGVVSQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEI  366

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+V+E  G  S  L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGE
Sbjct  367  ESIVNENAGKASGSLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGE  426

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +DC  LS+MPSVSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  427  SSIDCKSLSSMPSVSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWI  486

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG++HTVFDYG M++GFAEAA
Sbjct  487  LGDVFMGQFHTVFDYGNMQIGFAEAA  512



>ref|XP_011008023.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011008024.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS++CKAVV  YG+ ++DLL+ E +PKKICSQIGLCTF+G RG+SMGI
Sbjct  307  TMINHAIGASGVVSQQCKAVVSQYGEVIMDLLLSEVQPKKICSQIGLCTFDGTRGISMGI  366

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE N  S+  L +AMCSACEM V WM++QL +NQTQ+++L Y N+LC R+P+P G+
Sbjct  367  QSVVDEGNDKSSGVLGNAMCSACEMAVFWMRSQLQQNQTQDHVLDYANQLCERVPNPTGQ  426

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG + +MP+++F+IGGK F+L+P EYILKVG+GSAAQCISGFTA+D+PPPRGPLWI
Sbjct  427  SAVDCGSVFSMPTIAFTIGGKEFELAPEEYILKVGQGSAAQCISGFTAMDIPPPRGPLWI  486

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  487  LGDVFMGRYHTVFDSGKLRVGFAEAA  512



>ref|XP_008226860.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
 ref|XP_008226861.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=514

 Score =   323 bits (827),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG+ +I+ ++ + +P+KICSQIGLCTF+G  GVS  I
Sbjct  309  TELNHAIGASGIVSQECKTVVAQYGETIIERILAKDQPQKICSQIGLCTFDGTHGVSTEI  368

Query  597  ESVVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVV+E  + VS  L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGE
Sbjct  369  KSVVEENTHKVSGGLSDASCSACEMTVVWMQNQLKQNQTQERILEYVNQLCERLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MPSVSF+IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWI
Sbjct  429  SAVDCSGLSSMPSVSFTIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  489  LGDVFMGRYHTVFDYGNERIGFAEAA  514



>ref|XP_006383885.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
 gb|ERP61682.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
Length=552

 Score =   324 bits (830),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GVVS++CKAVV  YG+ ++DLL+ +A+PK+ICSQIGLCTF+G RG+S+GI
Sbjct  347  TMINQAIGASGVVSQQCKAVVSQYGEAIMDLLLSQAQPKRICSQIGLCTFDGTRGISIGI  406

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE N  S+  L DAMC ACEM VVWM++QL +NQTQ+ IL YVN+LC R+P+PMGE
Sbjct  407  QSVVDEGNDKSSGVLGDAMCPACEMAVVWMRSQLKQNQTQDRILDYVNQLCERMPNPMGE  466

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  + +MP+V+F+IGGK F+L+P EYILKVG+GSAAQCISGFTALD+PPPRGPLWI
Sbjct  467  SAVDCESVPSMPTVAFTIGGKEFELAPEEYILKVGQGSAAQCISGFTALDIPPPRGPLWI  526

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFD GK+RVGFAEAA
Sbjct  527  LGDIFMGRYHTVFDSGKLRVGFAEAA  552



>ref|XP_006600236.1| PREDICTED: aspartic proteinase 1 isoform X1 [Glycine max]
Length=514

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV+S+ECK +V  YGQ ++DLL+ E +PKKICS+IGLC F+G  GV +GI
Sbjct  309  TMINHAIGASGVMSQECKTIVAEYGQTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGI  368

Query  597  ESVVDEKNGVS-ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE    S    H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGE
Sbjct  369  KSVVDENERKSLGGHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG +S++P VSF+IGG+ FDLSP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWI
Sbjct  429  SAVDCGNISSLPVVSFTIGGRTFDLSPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFA+AA
Sbjct  489  LGDVFMGRYHTVFDFGKLRVGFADAA  514



>ref|XP_003567869.1| PREDICTED: phytepsin [Brachypodium distachyon]
Length=505

 Score =   322 bits (826),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI
Sbjct  300  TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGI  359

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
             SVVD++   S  LH D MC+ACEM VVWMQNQLS+N+TQ+ IL+Y+N+LC+RLPSPMGE
Sbjct  360  RSVVDDEAEKSNGLHSDPMCNACEMAVVWMQNQLSQNKTQDVILNYINQLCDRLPSPMGE  419

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG L++MP + F+IGGK F L P EYILKVGEG AAQCISGFTA+D+PPPRGPLWI
Sbjct  420  SSVDCGSLASMPEIEFTIGGKKFALKPEEYILKVGEGPAAQCISGFTAMDIPPPRGPLWI  479

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYGK+RVGFA+AA
Sbjct  480  LGDVFMGPYHTVFDYGKLRVGFAKAA  505



>ref|XP_008797519.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797520.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797521.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797522.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797523.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=512

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN  IGA GVVS+ECKAVV  YGQ+++DLL+ E  P KICSQIGLC F+G  GV +GIES
Sbjct  309  INQKIGASGVVSQECKAVVAQYGQQILDLLLSETEPAKICSQIGLCAFDGTHGVGIGIES  368

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV++   +SA L  DAMC++CEM V+WMQNQL +N+TQ+ IL+Y+NELC RLPSPMGES 
Sbjct  369  VVNDNGDLSAGLQSDAMCTSCEMAVIWMQNQLKQNETQDRILNYINELCERLPSPMGESS  428

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  L +MPSVSF+IGGK F+L+P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILG
Sbjct  429  VDCASLDSMPSVSFTIGGKSFELTPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILG  488

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG MRVGFAEAA
Sbjct  489  DVFMGVYHTVFDYGNMRVGFAEAA  512



>gb|KHN03495.1| Aspartic proteinase [Glycine soja]
Length=510

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV+S+ECK +V  YGQ ++DLL+ E +PKKICS+IGLC F+G  GV +GI
Sbjct  305  TMINHAIGASGVMSQECKTIVAEYGQTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGI  364

Query  597  ESVVDEKNGVS-ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE    S    H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGE
Sbjct  365  KSVVDENERKSLGGHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGE  424

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG +S++P VSF+IGG+ FDLSP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWI
Sbjct  425  SAVDCGDISSLPVVSFTIGGRTFDLSPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWI  484

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFA+AA
Sbjct  485  LGDVFMGRYHTVFDFGKLRVGFADAA  510



>ref|XP_008366439.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Malus domestica]
Length=514

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG+ +I+ ++ + +P KICS IGLC+F+G RGVS+GI
Sbjct  309  TELNHAIGASGIVSQECKTVVAQYGETIIERILAKDQPAKICSXIGLCSFDGTRGVSIGI  368

Query  597  ESVVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVV+E  + VS  L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGE
Sbjct  369  KSVVEENAHKVSGGLSDATCSACEMTVVWMQNQLKQNQTQERILDYVNQLCERLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP+VSF+IGG+ FDL+P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  429  SAVDCGGLSSMPNVSFTIGGRTFDLTPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  489  LGDVFMGRYHTVFDYGNERIGFAEAA  514



>ref|XP_006447588.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
 gb|ESR60828.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
Length=486

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S+ECK +V+ YG+ ++++L+ E +P+KICSQ+GLCTF+G RG SMGI
Sbjct  280  TQINHAIGASGVISQECKTLVDQYGKTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGI  339

Query  597  ESVVDEKNGVSAD-LHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
            ESV+D+ +  S+D +HD AMCSACEM V+WMQN+L  N+T + IL+YVN+LC+RLPSP G
Sbjct  340  ESVIDKSSDKSSDGVHDSAMCSACEMAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNG  399

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC  LS+MP+VSF+IGGKVFDL+PNEY+L+VGEG AAQCISGFTA DV PPRGPLW
Sbjct  400  ESAVDCDNLSSMPNVSFTIGGKVFDLAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLW  459

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMGRYHTVFDYG + +GFAEAA
Sbjct  460  ILGDVFMGRYHTVFDYGNLSIGFAEAA  486



>ref|NP_001237064.1| aspartic proteinase 1 precursor [Glycine max]
 dbj|BAB62890.1| aspartic proteinase 1 [Glycine max]
Length=514

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV+S+ECK +V  YGQ ++DLL+ E +PKKICS+IGLC F+G  GV +GI
Sbjct  309  TMINHAIGASGVMSQECKTIVAEYGQTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGI  368

Query  597  ESVVDEKNGVS-ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE    S    H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGE
Sbjct  369  KSVVDENERKSLGGHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG +S++P VSF+IGG+ FDLSP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWI
Sbjct  429  SAVDCGNISSLPVVSFTIGGRTFDLSPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFD+GK+RVGFA+AA
Sbjct  489  LGDVFMGRYHTVFDFGKLRVGFADAA  514



>ref|XP_008366438.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Malus domestica]
Length=518

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECK VV  YG+ +I+ ++ + +P KICS IGLC+F+G RGVS+GI
Sbjct  313  TELNHAIGASGIVSQECKTVVAQYGETIIERILAKDQPAKICSXIGLCSFDGTRGVSIGI  372

Query  597  ESVVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVV+E  + VS  L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGE
Sbjct  373  KSVVEENAHKVSGGLSDATCSACEMTVVWMQNQLKQNQTQERILDYVNQLCERLPSPMGE  432

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS+MP+VSF+IGG+ FDL+P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  433  SAVDCGGLSSMPNVSFTIGGRTFDLTPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWI  492

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  493  LGDVFMGRYHTVFDYGNERIGFAEAA  518



>ref|XP_009358756.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN AIGA GVVS+ECKAVV  YG+ ++DLLV E  PKK+CSQIG+C F+G R VSMGI
Sbjct  302  TKINQAIGASGVVSQECKAVVNQYGRTILDLLVAEVHPKKVCSQIGVCNFDGTRSVSMGI  361

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE NG S+  LHDA CSACEM VVWMQN+L +N TQ  IL+YVNELC ++P   G+
Sbjct  362  ESVVDENNGKSSGILHDASCSACEMAVVWMQNELKQNMTQGRILNYVNELCEKMPDASGQ  421

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCGKLS+MP VSF+IGGKVF L+ NEYILKVGEG+ AQCISGFT++D+P PRGPLWI
Sbjct  422  STVDCGKLSSMPPVSFTIGGKVFRLTSNEYILKVGEGAQAQCISGFTSMDIPRPRGPLWI  481

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFDYG MRVGFAEAA
Sbjct  482  LGDIFMGRYHTVFDYGNMRVGFAEAA  507



>pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
 pdb|1QDM|B Chain B, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
 pdb|1QDM|C Chain C, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
Length=478

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 175/209 (84%), Gaps = 7/209 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK +V  YGQ+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI
Sbjct  273  TEINEKIGAAGVVSQECKTIVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGI  332

Query  597  ESVVDEK----NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSP  430
             SVVD++    NG+ AD    MCSACEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSP
Sbjct  333  RSVVDDEPVKSNGLRAD---PMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSP  389

Query  429  MGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGP  250
            MGES VDCG L +MP + F+IGGK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGP
Sbjct  390  MGESAVDCGSLGSMPDIEFTIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGP  449

Query  249  LWILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LWILGDVFMG YHTVFDYGK+R+GFA+AA
Sbjct  450  LWILGDVFMGPYHTVFDYGKLRIGFAKAA  478



>ref|XP_004507671.1| PREDICTED: aspartic proteinase-like isoform X1 [Cicer arietinum]
 ref|XP_004507672.1| PREDICTED: aspartic proteinase-like isoform X2 [Cicer arietinum]
 ref|XP_004507673.1| PREDICTED: aspartic proteinase-like isoform X3 [Cicer arietinum]
Length=498

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GVVSKECK +V  YGQ +++LL+ EA+PKKICS+IGLCTF+G  GV++ I
Sbjct  293  TMINQAIGASGVVSKECKTIVAEYGQTIMNLLLAEAQPKKICSEIGLCTFDGTHGVNLAI  352

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE +   S  LH A CSACEM VVWMQNQLS+N+TQ+ IL+Y+N LC+++PSPMGE
Sbjct  353  ESVVDESERKSSGGLHGASCSACEMAVVWMQNQLSQNKTQDQILTYINNLCDKMPSPMGE  412

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  +S++P VSF+IGG+ FDL+P EYILKVGEG AAQCISGFTA+D+ PPRGP+WI
Sbjct  413  SSVDCEDISSLPVVSFTIGGRTFDLAPEEYILKVGEGPAAQCISGFTAIDIAPPRGPIWI  472

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFD+GK RVGFAEAA
Sbjct  473  LGDIFMGRYHTVFDFGKSRVGFAEAA  498



>gb|KDO54710.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=490

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S+ECK +V+ YG+ ++++L+ E +P+KICSQ+GLCTF+G RG SMGI
Sbjct  284  TQINHAIGASGVISQECKTLVDQYGKTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGI  343

Query  597  ESVVDEKNGVSAD-LHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
            ESV+D+ +  S+D +HD AMCSACEM V+WMQN+L  N+T + IL+YVN+LC+RLPSP G
Sbjct  344  ESVIDKSSDKSSDGVHDSAMCSACEMAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNG  403

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC  LS+MP+VSF+IGGKVFDL+PNEY+L+VGEG AAQCISGFTA DV PPRGPLW
Sbjct  404  ESAVDCDNLSSMPNVSFTIGGKVFDLAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLW  463

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMGRYHTVFDYG + +GFAEAA
Sbjct  464  ILGDVFMGRYHTVFDYGNLSIGFAEAA  490



>ref|XP_010926197.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926203.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926209.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
Length=512

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN  IGA GVVS+ECKAVV  YGQ+++D+L+ E +P KICS+IGLC F+G  GV +GIES
Sbjct  309  INQKIGASGVVSQECKAVVSQYGQQILDMLLSETQPAKICSRIGLCAFDGTHGVGIGIES  368

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV++   +SA L  DAMC++CEM VVWMQNQL +N+TQ+ IL+Y+N+LC RLPSPMGES 
Sbjct  369  VVNDNGDLSAGLQSDAMCTSCEMAVVWMQNQLKQNETQDRILNYINDLCERLPSPMGESS  428

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  L +MPS+SF+IGGK F+L+P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILG
Sbjct  429  VDCASLDSMPSISFTIGGKSFELTPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILG  488

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYGKMRVGFAEAA
Sbjct  489  DVFMGVYHTVFDYGKMRVGFAEAA  512



>gb|KDO54711.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=530

 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S+ECK +V+ YG+ ++++L+ E +P+KICSQ+GLCTF+G RG SMGI
Sbjct  324  TQINHAIGASGVISQECKTLVDQYGKTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGI  383

Query  597  ESVVDEKNGVSAD-LHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
            ESV+D+ +  S+D +HD AMCSACEM V+WMQN+L  N+T + IL+YVN+LC+RLPSP G
Sbjct  384  ESVIDKSSDKSSDGVHDSAMCSACEMAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNG  443

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC  LS+MP+VSF+IGGKVFDL+PNEY+L+VGEG AAQCISGFTA DV PPRGPLW
Sbjct  444  ESAVDCDNLSSMPNVSFTIGGKVFDLAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLW  503

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMGRYHTVFDYG + +GFAEAA
Sbjct  504  ILGDVFMGRYHTVFDYGNLSIGFAEAA  530



>ref|XP_008800700.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X2 [Phoenix 
dactylifera]
Length=512

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN  IGA GVVS+ECKAVV  YGQ ++D+L+ E +P KICS IGLCTF+G  GVS+GIES
Sbjct  309  INQKIGASGVVSQECKAVVAQYGQEILDMLLSETQPAKICSHIGLCTFDGTHGVSVGIES  368

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV++   +SA L  DAMC+ACEM VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES 
Sbjct  369  VVNDNGDLSAGLQSDAMCTACEMAVVWMQNQLKQNETQELILNYINELCERLPSPMGESS  428

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  L++MPSVSF+IGGK F+L+P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILG
Sbjct  429  VDCASLASMPSVSFTIGGKSFELTPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILG  488

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDY  +RVGFAEAA
Sbjct  489  DVFMGVYHTVFDYENLRVGFAEAA  512



>ref|XP_008229973.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=515

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK VVE YG+ +I++L+ +A+PKKICSQIG CTF+G  GVSMGI
Sbjct  310  TQINHAIGASGVVSQECKTVVEQYGKTIIEMLLAQAQPKKICSQIGFCTFDGTHGVSMGI  369

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+V+EK  +++D +HDA C+ACEM VVWMQN+L  N+T++ IL+YVNELC RLPSP GE
Sbjct  370  ESMVNEKLEMTSDGVHDAACAACEMAVVWMQNRLRLNETEDQILNYVNELCERLPSPSGE  429

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V CG LS++PSVSF+IGGKVFDL+P +Y+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  430  SVVQCGALSSLPSVSFTIGGKVFDLAPEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWI  489

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFDYG   VGFAEAA
Sbjct  490  LGDIFMGRYHTVFDYGNSSVGFAEAA  515



>ref|XP_006469663.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO54712.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=514

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S+ECK +V+ YG+ ++++L+ E +P+KICSQ+GLCTF+G RG SMGI
Sbjct  308  TQINHAIGASGVISQECKTLVDQYGKTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGI  367

Query  597  ESVVDEKNGVSAD-LHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
            ESV+D+ +  S+D +HD AMCSACEM V+WMQN+L  N+T + IL+YVN+LC+RLPSP G
Sbjct  368  ESVIDKSSDKSSDGVHDSAMCSACEMAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNG  427

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC  LS+MP+VSF+IGGKVFDL+PNEY+L+VGEG AAQCISGFTA DV PPRGPLW
Sbjct  428  ESAVDCDNLSSMPNVSFTIGGKVFDLAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLW  487

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMGRYHTVFDYG + +GFAEAA
Sbjct  488  ILGDVFMGRYHTVFDYGNLSIGFAEAA  514



>sp|P42210.1|ASPR_HORVU RecName: Full=Phytepsin; AltName: Full=Aspartic proteinase; Contains: 
RecName: Full=Phytepsin 32 kDa subunit; Contains: RecName: 
Full=Phytepsin 29 kDa subunit; Contains: RecName: Full=Phytepsin 
16 kDa subunit; Contains: RecName: Full=Phytepsin 
11 kDa subunit; Flags: Precursor [Hordeum vulgare]
 emb|CAA39602.1| aspartic proteinase [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   321 bits (822),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 175/209 (84%), Gaps = 7/209 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK +V  YGQ+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI
Sbjct  303  TEINEKIGAAGVVSQECKTIVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGI  362

Query  597  ESVVDEK----NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSP  430
             SVVD++    NG+ AD    MCSACEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSP
Sbjct  363  RSVVDDEPVKSNGLRAD---PMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSP  419

Query  429  MGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGP  250
            MGES VDCG L +MP + F+IGGK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGP
Sbjct  420  MGESAVDCGSLGSMPDIEFTIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGP  479

Query  249  LWILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LWILGDVFMG YHTVFDYGK+R+GFA+AA
Sbjct  480  LWILGDVFMGPYHTVFDYGKLRIGFAKAA  508



>ref|XP_008800699.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Phoenix 
dactylifera]
Length=547

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN  IGA GVVS+ECKAVV  YGQ ++D+L+ E +P KICS IGLCTF+G  GVS+GIES
Sbjct  344  INQKIGASGVVSQECKAVVAQYGQEILDMLLSETQPAKICSHIGLCTFDGTHGVSVGIES  403

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV++   +SA L  DAMC+ACEM VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES 
Sbjct  404  VVNDNGDLSAGLQSDAMCTACEMAVVWMQNQLKQNETQELILNYINELCERLPSPMGESS  463

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  L++MPSVSF+IGGK F+L+P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILG
Sbjct  464  VDCASLASMPSVSFTIGGKSFELTPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILG  523

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDY  +RVGFAEAA
Sbjct  524  DVFMGVYHTVFDYENLRVGFAEAA  547



>ref|XP_008371074.1| PREDICTED: aspartic proteinase [Malus domestica]
Length=508

 Score =   320 bits (820),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 177/207 (86%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVM-EARPKKICSQIGLCTFNGNRGVSMG  601
            T IN AIGA GVVS+ECKAVV  YG+ ++DLLV  E +PKK+CSQIG+CTF+G R VSMG
Sbjct  302  TKINQAIGASGVVSQECKAVVNQYGRTILDLLVAHEVQPKKVCSQIGVCTFDGTRSVSMG  361

Query  600  IESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
            IESVVDEKNG S+  LHDA CSACEM VVWMQN+L  N TQ+ IL+YVNELC ++P  +G
Sbjct  362  IESVVDEKNGKSSGILHDASCSACEMAVVWMQNELKXNITQDRILNYVNELCEKMPDTLG  421

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            +S VDCGKLS+MP VSF+IGG+ F L+ +EYILKVGEG+ AQCISGFT+LD+P PRGPLW
Sbjct  422  QSTVDCGKLSSMPPVSFTIGGRAFKLTSDEYILKVGEGAQAQCISGFTSLDIPRPRGPLW  481

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGD+FMGRYHTVFDYGKMRVGFA+AA
Sbjct  482  ILGDIFMGRYHTVFDYGKMRVGFADAA  508



>ref|XP_008664893.1| PREDICTED: aspartic proteinase oryzasin-1-like [Zea mays]
 tpg|DAA49681.1| TPA: hypothetical protein ZEAMMB73_239621 [Zea mays]
Length=299

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  93   TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  152

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++ G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  153  RSVVDDEAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  212

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L++MP ++F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLW
Sbjct  213  ESAVDCGSLASMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLW  272

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  273  ILGDVFMGVYHTVFDYGKLRVGFAESA  299



>ref|XP_006654801.1| PREDICTED: aspartic proteinase oryzasin-1-like [Oryza brachyantha]
Length=509

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS  I
Sbjct  304  TEINEKIGATGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAEI  363

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVD++ G S  LH DAMC+ACEM VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGE
Sbjct  364  KSVVDDEAGKSNGLHSDAMCNACEMAVVWMQNQLAQNKTQDRILNYINQLCDKLPSPMGE  423

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG L++MP ++F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWI
Sbjct  424  SSVDCGSLASMPEIAFTIGGKQFALKPEQYILKVGEGPAAQCISGFTAMDIPPPRGPLWI  483

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYGKMRVGFA++A
Sbjct  484  LGDVFMGAYHTVFDYGKMRVGFAKSA  509



>dbj|BAE20413.1| aspartic proteinase [Triticum aestivum]
Length=508

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK +V  YGQ+++DLL+ E +PKK+CSQ+GLCTF+G RGVS GI
Sbjct  303  TEINEKIGAAGVVSQECKTIVSQYGQQILDLLLAETQPKKVCSQVGLCTFDGTRGVSAGI  362

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
             SVVD++   S  LH D MCSACEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSPMGE
Sbjct  363  RSVVDDEPVKSNGLHTDPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGE  422

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  L +MP + F+I GK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWI
Sbjct  423  SAVDCASLGSMPDIEFTISGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWI  482

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYGK+RVGFA+AA
Sbjct  483  LGDVFMGPYHTVFDYGKLRVGFAKAA  508



>ref|XP_009347130.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=512

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK VVE YG+ +I++LV +A+P+KICSQIG CTF+G RGVS GI
Sbjct  307  TQINHAIGASGVVSQECKIVVEQYGKTIIEMLVAKAQPQKICSQIGFCTFDGTRGVSTGI  366

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+VD+K    +D +HDA C+ACEM VVWMQN+L +NQT+E IL YVN+LC RLPSP GE
Sbjct  367  ESMVDQKQEKKSDGVHDATCAACEMAVVWMQNKLMKNQTEEQILDYVNQLCERLPSPSGE  426

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V+C  LS++PSVSF+IG KVFDL+P +Y+LKVGEG AAQCISGF ALD+ PPRGPLWI
Sbjct  427  SVVECDALSSLPSVSFTIGAKVFDLAPEQYVLKVGEGVAAQCISGFIALDIAPPRGPLWI  486

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFDYG + VGFAEAA
Sbjct  487  LGDVFMGKYHTVFDYGNLSVGFAEAA  512



>ref|XP_010046321.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010046325.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW88765.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
 gb|KCW88766.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
Length=514

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK VV  YG+ ++++L+ EA+P+KICSQ+G CTF+G  GV MGI
Sbjct  309  TQINHAIGASGVVSQECKMVVGQYGKTILEMLLAEAQPQKICSQVGFCTFDGTHGVRMGI  368

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ ++  S  L D MC+ACEM VVWMQNQL +NQT+E IL YVN+LC RLPSPMGE
Sbjct  369  ESVVDKNEHKSSGGLGDGMCTACEMAVVWMQNQLRKNQTEEQILDYVNQLCERLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LS++PSVS +IGGKVFDL+P EY+L+VGEG AAQC+SGF ALDV PPRGPLWI
Sbjct  429  SVVDCSELSSLPSVSLTIGGKVFDLAPEEYVLQVGEGVAAQCVSGFIALDVAPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG M+VGFAEAA
Sbjct  489  LGDVFMGRYHTVFDYGNMQVGFAEAA  514



>emb|CAA57510.1| cyprosin [Cynara cardunculus]
Length=509

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S++CK +V  YG+ MI++L+ EA+P KICSQ+ LCTF+G R  S  I
Sbjct  304  TEINHAIGAKGVMSQQCKTLVSQYGKTMIEMLLSEAQPDKICSQMKLCTFDGARDASSII  363

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVDE NG S+  +HD MC+ CEM VVWMQNQ+  N+T++NI++YVNELC+RLPSPMGE
Sbjct  364  ESVVDENNGKSSSGVHDEMCTFCEMAVVWMQNQIKRNETEDNIINYVNELCDRLPSPMGE  423

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+++F+IGGKVF+L P +YILK+GEG AAQCISGFTA+DV PPRGPLWI
Sbjct  424  SAVDCNSLSSMPNIAFTIGGKVFELCPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWI  483

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYGK+RVGFAEAA
Sbjct  484  LGDVFMGRYHTVFDYGKLRVGFAEAA  509



>gb|AFK46704.1| unknown [Medicago truncatula]
Length=510

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GV S+EC+ VV+ YG  ++ LLV EA+PKK+CSQIGLCTF+G +G+SMGI
Sbjct  305  TMINQAIGASGVYSQECRTVVDQYGHSILQLLVAEAQPKKVCSQIGLCTFDGTQGISMGI  364

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVV++ + +S+  H DA C  CEM VVWMQNQL +NQT+E I++Y + LC+++P+P+G+
Sbjct  365  QSVVEQTDRISSGGHQDATCFVCEMAVVWMQNQLKQNQTEERIINYADSLCDKMPNPLGQ  424

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC K+S+MP VSF+IGGK FDL+P EYILKVGEG+AAQCISGFTALDVPPPRGPLWI
Sbjct  425  SSVDCAKISSMPKVSFTIGGKKFDLAPEEYILKVGEGAAAQCISGFTALDVPPPRGPLWI  484

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
             GD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  485  PGDIFMGRYHTVFDYGKLRVGFAEAA  510



>ref|XP_011046961.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011046962.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMIN AIGA GVVS++CKAVV  YG+ ++DLL+ EA+PK+ICSQIGLC F+G RG+S+ I
Sbjct  307  TMINQAIGASGVVSQQCKAVVSQYGEAIMDLLLSEAQPKRICSQIGLCMFDGTRGISISI  366

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE N  S+  L DAMCSACEM VVWM++QL +NQTQ+ IL Y ++LC R+P+PMGE
Sbjct  367  QSVVDEGNDKSSGVLGDAMCSACEMAVVWMRSQLKQNQTQDRILDYASQLCERMPNPMGE  426

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  + +MP+V+F+IGGK F+L+P EYILKVG+GSAAQCISGFTALD+PPPRGPLWI
Sbjct  427  SAVDCESVPSMPTVAFTIGGKEFELAPEEYILKVGQGSAAQCISGFTALDIPPPRGPLWI  486

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFD GK+RVGFAEAA
Sbjct  487  LGDIFMGRYHTVFDSGKLRVGFAEAA  512



>ref|XP_010924299.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase oryzasin-1-like 
[Elaeis guineensis]
Length=546

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INH IGA GVVS+ECKAVV  YGQ ++D+L+ E +P KICS+IGLC F+G  GVS+GIE+
Sbjct  343  INHKIGAAGVVSQECKAVVAQYGQEILDMLLSETQPAKICSRIGLCAFDGTHGVSIGIEN  402

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV +   +SA    DAMC+ACEM VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES 
Sbjct  403  VVHDNGDLSAGFQSDAMCTACEMAVVWMQNQLRQNETQERILNYINELCERLPSPMGESS  462

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  L++MPS+SF+IGGK F+L+P +YILKVGEG AAQCISGFTALDVPPPRGPLWILG
Sbjct  463  VDCASLASMPSISFTIGGKSFELTPEQYILKVGEGVAAQCISGFTALDVPPPRGPLWILG  522

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG +RVGFA+AA
Sbjct  523  DVFMGVYHTVFDYGNLRVGFADAA  546



>gb|KJB22150.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
 gb|KJB22151.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
Length=514

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            +NHAIGA GVVS+ECK VV  YG+ +IDLL+ + +P K+CSQIGLC+F+G R VSMGIES
Sbjct  311  VNHAIGATGVVSQECKTVVSEYGETIIDLLLSKDQPLKVCSQIGLCSFDGTRDVSMGIES  370

Query  591  VVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV+E  G  S ++HDAMCS CEM V+W+Q+QL +NQTQE IL YVNELC+RLPSPMGES 
Sbjct  371  VVNENAGKASGNVHDAMCSVCEMAVIWVQSQLKQNQTQERILDYVNELCDRLPSPMGESV  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  LS+MPSV+F+IGGK+ +L+P +YILKVG+G  AQCISGF ALDVPPPRGPLWILG
Sbjct  431  VDCNSLSSMPSVAFTIGGKILELTPEQYILKVGDGELAQCISGFGALDVPPPRGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG++HTVFDYG M++GFAEAA
Sbjct  491  DVFMGKFHTVFDYGNMQIGFAEAA  514



>gb|AFW79207.1| hypothetical protein ZEAMMB73_486493 [Zea mays]
Length=382

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  176  TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  235

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++ G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  236  RSVVDDEAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  295

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L++MP ++F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLW
Sbjct  296  ESAVDCGSLASMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLW  355

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  356  ILGDVFMGVYHTVFDYGKLRVGFAESA  382



>gb|AFW85769.1| hypothetical protein ZEAMMB73_486102 [Zea mays]
Length=267

 Score =   310 bits (794),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 170/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IG  GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  61   TEINEKIGVAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  120

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++ G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  121  RSVVDDEAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  180

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L++MP ++F+IGGK F L P +YILKVGEG AAQCISGF A+D+PPPRGPLW
Sbjct  181  ESAVDCGSLASMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFKAMDIPPPRGPLW  240

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  241  ILGDVFMGVYHTVFDYGKLRVGFAESA  267



>dbj|BAB20971.1| aspartic proteinase 3 [Nepenthes alata]
Length=507

 Score =   318 bits (815),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 178/207 (86%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVS+ECKAVV  YGQ ++DLL+ E  P+KICSQIGLCTF+G RGVS+GI
Sbjct  301  TMINHAIGATGVVSEECKAVVSQYGQTIMDLLLAEVSPEKICSQIGLCTFDGTRGVSIGI  360

Query  597  ESVVD-EKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
            +SVVD E NG S+  L DA+C ACEM VVWM++QL +NQTQ  IL+YVN+LC++LPSPMG
Sbjct  361  KSVVDKENNGKSSGILRDALCPACEMAVVWMKSQLEQNQTQNLILNYVNDLCDQLPSPMG  420

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC ++S+M +VS +IGGKVFDL P +YIL+VGEG AAQCISGFTA+D+PPP GPLW
Sbjct  421  ESAVDCARISSMATVSSTIGGKVFDLRPEQYILRVGEGPAAQCISGFTAMDIPPPGGPLW  480

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGD+ MGRYHTVFDYG +RVGFAEAA
Sbjct  481  ILGDILMGRYHTVFDYGNLRVGFAEAA  507



>ref|XP_009353298.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=510

 Score =   318 bits (815),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK VVE YG+ +I++LV +A+P+KICSQIG CTF+G RGVS GI
Sbjct  305  TQINHAIGASGVVSQECKIVVEQYGKTIIEMLVAKAQPQKICSQIGFCTFDGTRGVSTGI  364

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+VD+K    +D +HDA C+ACEM VVWMQN+L +NQT+E IL YVN+LC RLPSP GE
Sbjct  365  ESMVDQKQEKKSDGVHDATCAACEMAVVWMQNKLMKNQTEEQILDYVNQLCERLPSPSGE  424

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V+C  LS++PSVSF+IG KVFDL+P +Y+LKVGEG AAQCISGF ALD+ PPRGPLWI
Sbjct  425  SVVECDALSSLPSVSFTIGAKVFDLAPEQYVLKVGEGVAAQCISGFIALDIAPPRGPLWI  484

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFDYG   VGFAEAA
Sbjct  485  LGDVFMGKYHTVFDYGNSSVGFAEAA  510



>emb|CAA70340.1| aspartic proteinase [Centaurea calcitrapa]
Length=509

 Score =   318 bits (814),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S++CK +V+ YG+ +I++L+ EA+P KICSQ+ LCTF+G R VS  I
Sbjct  304  TQINHAIGAKGVMSQQCKTLVDQYGKTIIEMLLSEAQPDKICSQMKLCTFDGARDVSSII  363

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ NG S+  +HD MC+ CEM VVWMQNQ+  NQT++NI++YVNELC+RLPSPMGE
Sbjct  364  ESVVDKNNGKSSGGVHDEMCTFCEMAVVWMQNQIKRNQTEDNIINYVNELCDRLPSPMGE  423

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+++F+IGGKVF+L P +YILK+GEG AAQCISGFTA+DV PPRGPLWI
Sbjct  424  SAVDCNDLSSMPNIAFTIGGKVFELCPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWI  483

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFDYGK+RVGFAEAA
Sbjct  484  LGDVFMGQYHTVFDYGKLRVGFAEAA  509



>ref|XP_010553449.1| PREDICTED: aspartic proteinase A1 [Tarenaya hassleriana]
Length=518

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 170/201 (85%), Gaps = 1/201 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CKAVVE YGQ ++DLL+ E +PKKICSQIGLCTF+G  GVSM IE
Sbjct  310  MINKAIGASGVVSQQCKAVVEQYGQTILDLLLAETQPKKICSQIGLCTFDGAHGVSMDIE  369

Query  594  SVVDEKNGV-SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD +N   S  L DA CSACEM VVW+QNQL +N TQ+ IL+Y+NELC R+PSPMGES
Sbjct  370  SVVDRENAKPSGALGDAACSACEMAVVWIQNQLRQNMTQDRILNYINELCERMPSPMGES  429

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LSTMP+VS +IGGKVFDL+P EYILK+GEG  AQCISGF ALDVPPPRGPLWIL
Sbjct  430  AVDCAQLSTMPTVSLTIGGKVFDLAPEEYILKMGEGPVAQCISGFIALDVPPPRGPLWIL  489

Query  237  GDVFMGRYHTVFDYGKMRVGF  175
            GDVFMG+YHTVFD+G  RVGF
Sbjct  490  GDVFMGKYHTVFDFGNERVGF  510



>ref|XP_007215237.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
 gb|EMJ16436.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
Length=515

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK VVE YG+ ++++L+ +A+PKKICSQIG CTF+G  GVSMGI
Sbjct  310  TQINHAIGASGVVSQECKTVVEQYGKTIMEMLLAQAQPKKICSQIGFCTFDGTHGVSMGI  369

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+V+EK  +++D +HDA C+ACEM VVWMQN+L  N+T++ IL+YVNELC RLPSP GE
Sbjct  370  ESMVNEKLEMTSDGVHDAACTACEMAVVWMQNRLRLNETEDQILNYVNELCERLPSPSGE  429

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V C  LS++PSVSF+IGGKVFDL+P +Y+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  430  SVVQCDALSSLPSVSFTIGGKVFDLAPEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWI  489

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFDYG   VGFAEAA
Sbjct  490  LGDIFMGRYHTVFDYGNSTVGFAEAA  515



>ref|NP_001056348.1| Os05g0567100 [Oryza sativa Japonica Group]
 sp|Q42456.2|ASPR1_ORYSJ RecName: Full=Aspartic proteinase oryzasin-1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAU10663.1| aspartic proteinase oryzasin 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18262.1| Os05g0567100 [Oryza sativa Japonica Group]
 gb|EAY99059.1| hypothetical protein OsI_21016 [Oryza sativa Indica Group]
 gb|ACA50495.1| aspartic proteinase oryzasin 1 [Oryza sativa Japonica Group]
 dbj|BAG90572.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96074.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96985.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64719.1| hypothetical protein OsJ_19575 [Oryza sativa Japonica Group]
Length=509

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  304  TEINEKIGATGVVSQECKTVVSQYGQQILDLLLAETQPSKICSQVGLCTFDGKHGVSAGI  363

Query  597  ESVVDEKNGVSADLHDA-MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVD++ G S  L    MC+ACEM VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGE
Sbjct  364  KSVVDDEAGESNGLQSGPMCNACEMAVVWMQNQLAQNKTQDLILNYINQLCDKLPSPMGE  423

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG L++MP +SF+IGGK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWI
Sbjct  424  SSVDCGSLASMPEISFTIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWI  483

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYGKMRVGFA++A
Sbjct  484  LGDVFMGAYHTVFDYGKMRVGFAKSA  509



>ref|XP_010473444.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase A2-like [Camelina 
sativa]
Length=498

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 172/204 (84%), Gaps = 1/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLC F+G  GVSMGIE
Sbjct  294  MINKAIGASGVVSQQCKTVVDQYGQIILDLLLAETQPKKICSQIGLCDFDGTEGVSMGIE  353

Query  594  SVVDEKN-GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++N   S+ L DA C  CEM VVW+Q+QL +N TQE I++YVNE+C R+P+P GES
Sbjct  354  SVVDKENMKSSSSLRDAGCLPCEMAVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGES  413

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC KLSTMP+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTA D+PPPRGPLWIL
Sbjct  414  AVDCSKLSTMPTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTAFDIPPPRGPLWIL  473

Query  237  GDVFMGRYHTVFDYGKMRVGFAEA  166
            GDVFMG+YHTVFD+G  RVGFAEA
Sbjct  474  GDVFMGKYHTVFDFGNERVGFAEA  497



>ref|XP_008660718.1| PREDICTED: aspartic proteinase oryzasin-1-like [Zea mays]
Length=299

 Score =   309 bits (791),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 170/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IG  GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  93   TEINEKIGVAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  152

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++ G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  153  RSVVDDEAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  212

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L++MP ++F+IGGK F L P +YILKVGEG AAQCISGF A+D+PPPRGPLW
Sbjct  213  ESAVDCGSLASMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFKAMDIPPPRGPLW  272

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  273  ILGDVFMGVYHTVFDYGKLRVGFAESA  299



>ref|XP_010430270.1| PREDICTED: aspartic proteinase A2-like [Camelina sativa]
Length=514

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLC F+G  GVSMGIE
Sbjct  310  MINKAIGASGVVSQQCKTVVDQYGQIILDLLLAETQPKKICSQIGLCDFDGTEGVSMGIE  369

Query  594  SVVDEKN-GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++N   S+ L  A C  CEM VVW+Q+QL +N TQE I++YVNE+C R+P+P GES
Sbjct  370  SVVDKENMKSSSGLRGAGCPPCEMAVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGES  429

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC KLSTMP+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  430  AVDCSKLSTMPTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTALDIPPPRGPLWIL  489

Query  237  GDVFMGRYHTVFDYGKMRVGFAEA  166
            GDVFMG+YHTVFD+GK RVGFAEA
Sbjct  490  GDVFMGKYHTVFDFGKERVGFAEA  513



>gb|KHG04193.1| Asparticase [Gossypium arboreum]
Length=514

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            +NHAIGA GVVS+ECK VV  YG+ +IDLL+ + +P K+CSQIGLC+F+G R VSMGIES
Sbjct  311  VNHAIGATGVVSQECKTVVSEYGEMIIDLLLSKDQPLKVCSQIGLCSFDGTRDVSMGIES  370

Query  591  VVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV+E  G  S ++HDAMCS CEM V+W+Q+QL +NQTQE IL YVNELC+RLPSPMGES 
Sbjct  371  VVNENAGKASGNVHDAMCSVCEMAVIWVQSQLKQNQTQERILDYVNELCDRLPSPMGESV  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  LS MPSV+F+IGGK+ +L+P +YILKVG+G  AQCISGF ALDVPPPRGPLWILG
Sbjct  431  VDCNSLSAMPSVAFTIGGKILELTPEQYILKVGDGELAQCISGFGALDVPPPRGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG++HTVFDYG M++GFAEA 
Sbjct  491  DVFMGKFHTVFDYGNMQIGFAEAT  514



>ref|XP_003610462.1| Aspartic proteinase [Medicago truncatula]
 gb|AES92659.1| fungal proteinase A, aspartic proteinase superfamily protein 
[Medicago truncatula]
Length=519

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 174/206 (84%), Gaps = 2/206 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GVVSKECK +V  YGQ +++LL+ EA+PKKICS+IGLCTF+G  GV + I
Sbjct  315  TMINHAIGASGVVSKECKTIVAEYGQTILNLLLAEAQPKKICSEIGLCTFDGTHGVDLAI  374

Query  597  ESVVD-EKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD  +   S+ LH A CSACEM VVWMQNQL +N+TQ+ IL+Y+N LC+++PSPMGE
Sbjct  375  ESVVDGNERKSSSGLHGASCSACEMAVVWMQNQLRQNKTQDQILTYINNLCDKMPSPMGE  434

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  +S++P +SF+IGG+ FDL+P EYI KVGEG AAQCISGF A+DVPPPRGP+WI
Sbjct  435  SSVDCENISSLPVISFTIGGRTFDLAPEEYI-KVGEGPAAQCISGFVAIDVPPPRGPIWI  493

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFD+GK RVGFAEAA
Sbjct  494  LGDIFMGRYHTVFDFGKSRVGFAEAA  519



>dbj|BAA96446.1| aspartic endopeptidase [Pyrus pyrifolia]
Length=273

 Score =   307 bits (787),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK VVE YG+ +I++L+ +++P+KICSQIG CTF+G RGVS GI
Sbjct  68   TQINHAIGASGVVSQECKTVVEQYGKTIIEMLMAKSQPQKICSQIGFCTFDGTRGVSPGI  127

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+VD+     +D +HDA C+ACEM VV MQ +L +NQT+E IL YVN+LC RLPSP GE
Sbjct  128  ESLVDQNPEKQSDGVHDATCAACEMPVVLMQIRLRKNQTEEQILDYVNQLCERLPSPSGE  187

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V C  LS++PSVSF+IGGKVFDL+P +Y+LKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  188  SVVQCDSLSSLPSVSFTIGGKVFDLAPEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWI  247

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFDYG + VGFAEAA
Sbjct  248  LGDIFMGRYHTVFDYGNLSVGFAEAA  273



>gb|KJB13723.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=508

 Score =   315 bits (807),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 174/206 (84%), Gaps = 5/206 (2%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECKAVV  YG++++D+L+     KKICSQIGLC F+G +GVSM I
Sbjct  307  TQINHAIGASGVVSQECKAVVSEYGEKILDMLL----AKKICSQIGLCLFDGTQGVSMEI  362

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+V+E  G  S  L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGE
Sbjct  363  ESIVNENAGKASGSLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGE  422

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +DC  LS+MPSVSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWI
Sbjct  423  SSIDCKSLSSMPSVSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWI  482

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG++HTVFDYG M++GFAEAA
Sbjct  483  LGDVFMGQFHTVFDYGNMQIGFAEAA  508



>dbj|BAA06876.1| aspartic protease [Oryza sativa]
 dbj|BAA06875.1| aspartic protease [Oryza sativa]
Length=509

 Score =   315 bits (807),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  304  TEINEKIGATGVVSQECKTVVSQYGQQILDLLLAETQPSKICSQVGLCTFDGKHGVSAGI  363

Query  597  ESVVDEKNGVSADLHDA-MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVD++ G S  L    MC+ACEM VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGE
Sbjct  364  KSVVDDEAGESNGLQSGPMCNACEMAVVWMQNQLAQNKTQDLILNYINQLCDKLPSPMGE  423

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG L++MP +SF+IG K F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWI
Sbjct  424  SSVDCGSLASMPEISFTIGAKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWI  483

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYGKMRVGFA++A
Sbjct  484  LGDVFMGAYHTVFDYGKMRVGFAKSA  509



>ref|XP_008647844.1| PREDICTED: aspartic proteinase oryzasin-1 isoform X1 [Zea mays]
 gb|ACN27572.1| unknown [Zea mays]
 gb|ACR38429.1| unknown [Zea mays]
 gb|AFW79205.1| aspartic proteinase oryzasin-1 isoform 1 [Zea mays]
 gb|AFW79206.1| aspartic proteinase oryzasin-1 isoform 2 [Zea mays]
Length=510

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  304  TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  363

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++ G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  364  RSVVDDEAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  423

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L++MP ++F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLW
Sbjct  424  ESAVDCGSLASMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLW  483

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  484  ILGDVFMGVYHTVFDYGKLRVGFAESA  510



>ref|XP_002886481.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62740.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLC F+G  GVSMGIE
Sbjct  309  MINKAIGASGVVSQQCKTVVDQYGQTILDLLLAETQPKKICSQIGLCAFDGTHGVSMGIE  368

Query  594  SVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++N  S+  L DA C ACEM V+W+Q+QL +N TQE I++Y+NE+C R+PSP GES
Sbjct  369  SVVDKENTRSSSGLRDAGCPACEMAVMWIQSQLRQNMTQERIVNYINEICERMPSPNGES  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LS MP+VSF+IGGKVFDL+P EY+LK+GEG  AQCISGFTALDVPPPRGPLWIL
Sbjct  429  AVDCSQLSKMPTVSFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDVPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEA  166
            GDVFMG+YHTVFD+G  +VGFAEA
Sbjct  489  GDVFMGKYHTVFDFGNEQVGFAEA  512



>ref|XP_009395027.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395028.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECKAVV  YGQ+++  L+ + +P KICSQ+GLCTF+G  GVS+GI
Sbjct  310  TEINQKIGASGVVSQECKAVVAQYGQQILAKLMSQTQPSKICSQVGLCTFDGTHGVSIGI  369

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESV++E    SA LH D MC ACEM VVWMQNQL  NQTQE+IL+Y+NELC RLPSPMGE
Sbjct  370  ESVINENEDASAGLHSDGMCHACEMAVVWMQNQLRLNQTQESILNYINELCERLPSPMGE  429

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  +++MPSVSF+IG K F+L P +YILKVG+G+AAQCISGFTALDVPPPRGPLWI
Sbjct  430  SSVDCASVASMPSVSFTIGDKTFELKPEQYILKVGQGTAAQCISGFTALDVPPPRGPLWI  489

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG YHTVFDYG +RVGFA A
Sbjct  490  LGDVFMGVYHTVFDYGNLRVGFAPA  514



>ref|XP_006391910.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
 gb|ESQ29196.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
Length=511

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 174/205 (85%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++ LL+ E +PKKICSQIG+CTF+G  GVSMGIE
Sbjct  307  MINKAIGASGVVSQQCKTVVDQYGQTILSLLLAETQPKKICSQIGVCTFDGTHGVSMGIE  366

Query  594  SVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD+++  S   L DA C ACEM VVW+Q+QL +N TQE I++Y+N++C R+PSP GES
Sbjct  367  SVVDKEDTKSPRGLRDAGCVACEMAVVWIQSQLKQNMTQERIVNYINDICERMPSPNGES  426

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LSTMP+VSF+IGGKVFDL+P EY+LK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  427  AVDCSQLSTMPTVSFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDIPPPRGPLWIL  486

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD+G  +VGFAEAA
Sbjct  487  GDVFMGRYHTVFDFGNEQVGFAEAA  511



>gb|AGE15494.1| preprosilpepsin 1 [Silybum marianum]
Length=506

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 176/205 (86%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S++CK +V+ YG+ +I++L+ EA+P KICSQ+ LCTFNG R VS  I
Sbjct  304  TQINHAIGAKGVMSQQCKTLVDQYGKSIIEMLLSEAQPDKICSQMKLCTFNGARDVSSII  363

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD+ NG S+   + MC+ CEM VVWMQNQ+  NQTQ+NI++YV+ELC+RLPSPMGES
Sbjct  364  ESVVDKNNGKSSG--NEMCTFCEMAVVWMQNQIKRNQTQDNIINYVSELCDRLPSPMGES  421

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  LS+MP++SF+IGGKVF+L P +YILK+G+G AAQCISGFTA+DV PPRGPLWIL
Sbjct  422  AVDCNSLSSMPNISFTIGGKVFELCPEQYILKIGDGEAAQCISGFTAMDVAPPRGPLWIL  481

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYGK+RVGFAEAA
Sbjct  482  GDVFMGRYHTVFDYGKLRVGFAEAA  506



>ref|XP_004961190.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica]
Length=507

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 173/207 (84%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  301  TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  360

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++ G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC+RLPSPMG
Sbjct  361  RSVVDDEAGKSNGGLRSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCDRLPSPMG  420

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC  L +MP+++F+IGGK F L P +YILKVGEGSAAQCISGFTA+D+PPPRGPLW
Sbjct  421  ESSVDCASLKSMPNIAFTIGGKKFSLKPEQYILKVGEGSAAQCISGFTAIDIPPPRGPLW  480

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFA++A
Sbjct  481  ILGDVFMGAYHTVFDYGKLRVGFADSA  507



>ref|NP_176419.2| aspartic proteinase A2 [Arabidopsis thaliana]
 ref|NP_001031219.1| aspartic proteinase A2 [Arabidopsis thaliana]
 sp|Q8VYL3.1|APA2_ARATH RecName: Full=Aspartic proteinase A2; AltName: Full=Aspartic 
protease 57; Short=AtASP57; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49856.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AAN13225.1| putative aspartic protease [Arabidopsis thaliana]
 dbj|BAH19961.1| AT1G62290 [Arabidopsis thaliana]
 gb|AEE33946.1| aspartic proteinase A2 [Arabidopsis thaliana]
 gb|AEE33947.1| aspartic proteinase A2 [Arabidopsis thaliana]
Length=513

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLC ++G  GVSMGIE
Sbjct  309  MINKAIGASGVVSQQCKTVVDQYGQTILDLLLAETQPKKICSQIGLCAYDGTHGVSMGIE  368

Query  594  SVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++N  S+  L DA C ACEM VVW+Q+QL +N TQE I++Y+NE+C R+PSP GES
Sbjct  369  SVVDKENTRSSSGLRDAGCPACEMAVVWIQSQLRQNMTQERIVNYINEICERMPSPNGES  428

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LS MP+VSF+IGGKVFDL+P EY+LK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  429  AVDCSQLSKMPTVSFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDIPPPRGPLWIL  488

Query  237  GDVFMGRYHTVFDYGKMRVGFAEA  166
            GDVFMG+YHTVFD+G  +VGFAEA
Sbjct  489  GDVFMGKYHTVFDFGNEQVGFAEA  512



>ref|XP_006838131.1| hypothetical protein AMTR_s00106p00075970 [Amborella trichopoda]
 gb|ERN00700.1| hypothetical protein AMTR_s00106p00075970 [Amborella trichopoda]
Length=513

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INH IGA GVVS+ECKAVV+ YG +++ LL+ EA+P+KICSQIGLC F+G+  V MGI
Sbjct  308  TEINHKIGAAGVVSQECKAVVQQYGDKIMQLLLAEAQPQKICSQIGLCEFDGSHSVGMGI  367

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD KNG  + L  D+MCSACEM VVW+QNQL +N TQ+ I++Y+NELC RLPSPMG+
Sbjct  368  ESVVDMKNGGKSSLKTDSMCSACEMAVVWIQNQLKQNMTQDRIMNYINELCERLPSPMGQ  427

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC KLS+MP+V+F+IGGK F+L+P +YILKVGEG+AAQCISGF+ALDV PPRGPLWI
Sbjct  428  SAVDCNKLSSMPNVAFTIGGKAFELTPQQYILKVGEGAAAQCISGFSALDVAPPRGPLWI  487

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDV +G YHTVFDYG +RVGFA+AA
Sbjct  488  LGDVVLGVYHTVFDYGNLRVGFAKAA  513



>ref|XP_009410967.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410968.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410969.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 171/204 (84%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN  IGA GVVS+ECKAVV  YG++++D+L+ E  P K+CS+IGLCTF+G  GVS+GIES
Sbjct  306  INQKIGASGVVSQECKAVVAQYGEQILDMLLSETEPSKVCSRIGLCTFDGTHGVSIGIES  365

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV+E   VS+ L  DA+CS CEM VVWMQNQL +NQTQE +L+Y+NELC RLPSPMGES 
Sbjct  366  VVNENADVSSGLQSDAICSVCEMAVVWMQNQLRQNQTQERVLNYINELCERLPSPMGESS  425

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  +S+MP VSF+IG K F+L+  +YILKVGEG+AAQCISGF ALDVPPPRGP+WILG
Sbjct  426  VDCAAISSMPGVSFTIGNKTFELTAEQYILKVGEGAAAQCISGFIALDVPPPRGPIWILG  485

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG +RVGFAEAA
Sbjct  486  DVFMGVYHTVFDYGNLRVGFAEAA  509



>ref|XP_008342027.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=538

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK VVE YG+ +I++L+ +++P+K+CSQIG CTF+G RGVS GI
Sbjct  333  TQINHAIGASGVVSQECKTVVEQYGKTIIEMLMAKSQPQKVCSQIGFCTFDGTRGVSTGI  392

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ES+VD+K    +D ++DA C+ACEM VVWMQ++L +NQT+E IL YVN+LC RLPSP GE
Sbjct  393  ESMVDQKPEKQSDGVNDATCAACEMAVVWMQSRLRKNQTEEQILDYVNQLCERLPSPSGE  452

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V C  LS++PSVSF+IGGKVFDL+P +YILKVGEG AAQCISGF ALDV PPRGPLWI
Sbjct  453  SVVQCDALSSLPSVSFTIGGKVFDLAPEQYILKVGEGVAAQCISGFIALDVAPPRGPLWI  512

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMGRYHTVFDYG + VGFAEAA
Sbjct  513  LGDIFMGRYHTVFDYGNLSVGFAEAA  538



>ref|NP_001148782.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG32889.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=510

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 171/206 (83%), Gaps = 2/206 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  304  TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPTKICSQVGLCTFDGTHGVSAGI  363

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++ G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  364  RSVVDDEAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  423

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L++MP ++F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLW
Sbjct  424  ESAVDCGSLASMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLW  483

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEA  166
            ILGDVFMG YHTVFDYGK+RVGFAE+
Sbjct  484  ILGDVFMGVYHTVFDYGKLRVGFAES  509



>ref|XP_006301275.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
 gb|EOA34173.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
Length=514

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ +++LL+ + +PKKICSQIGLCTF+G +GVSMGIE
Sbjct  310  MINKAIGASGVVSQQCKTVVDQYGQTILELLLAKTQPKKICSQIGLCTFDGTKGVSMGIE  369

Query  594  SVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++   +S  L  A C ACEM VVW+Q+QL +N TQE I++YVNE+C R+PSP GES
Sbjct  370  SVVDKETAKLSNGLRGAGCPACEMAVVWIQSQLRQNMTQERIVNYVNEMCERMPSPNGES  429

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LS MP+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  430  AVDCSQLSKMPTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTALDIPPPRGPLWIL  489

Query  237  GDVFMGRYHTVFDYGKMRVGFAEA  166
            GDVFMG+YHTVFD+G  RVGFAEA
Sbjct  490  GDVFMGKYHTVFDFGNERVGFAEA  513



>gb|KDO62069.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=505

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 172/206 (83%), Gaps = 10/206 (5%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECKAVV  YG+ +I++L+         ++IGLCTF+G+RGVSMGI
Sbjct  309  TQVNHAIGATGIVSQECKAVVSQYGEEIINMLL---------AKIGLCTFDGSRGVSMGI  359

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV E N   S   HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGE
Sbjct  360  ESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGE  419

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LS++P VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLWI
Sbjct  420  SAVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWI  479

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDY  MRVGFAEAA
Sbjct  480  LGDVFMGPYHTVFDYSNMRVGFAEAA  505



>ref|XP_010418214.1| PREDICTED: aspartic proteinase A2 isoform X2 [Camelina sativa]
Length=479

 Score =   311 bits (798),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ E +P+KICSQIGLC F+G +GVSMGI+
Sbjct  275  MINKAIGASGVVSQQCKTVVDQYGQIILDLLLAETQPQKICSQIGLCGFDGTQGVSMGID  334

Query  594  SVVDEKN-GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++N   S+ L  A C  CEM VVW+Q+QL +N TQE I++YVNE+C R+P+P GES
Sbjct  335  SVVDKENMKSSSGLRGAGCPPCEMAVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGES  394

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC KLSTMP+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  395  AVDCSKLSTMPTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTALDIPPPRGPLWIL  454

Query  237  GDVFMGRYHTVFDYGKMRVGFAEA  166
            GDVFMG+YHTVFD+G  RVGFAEA
Sbjct  455  GDVFMGKYHTVFDFGNERVGFAEA  478



>tpg|DAA63137.1| TPA: hypothetical protein ZEAMMB73_794362 [Zea mays]
Length=608

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  402  TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  461

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++ G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  462  RSVVDDEAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  521

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L++MP ++F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLW
Sbjct  522  ESAVDCGSLASMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLW  581

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  582  ILGDVFMGVYHTVFDYGKLRVGFAESA  608



>ref|XP_008650245.1| PREDICTED: aspartic proteinase oryzasin-1-like, partial [Zea 
mays]
Length=304

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 168/207 (81%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  98   TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  157

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++   S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  158  RSVVDDEARKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  217

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L +MP + F+IGGK F L P +YILKVGEG A QCISGFTA+D+PPPRGPLW
Sbjct  218  ESAVDCGSLVSMPDIVFTIGGKKFKLKPEQYILKVGEGQAVQCISGFTAMDIPPPRGPLW  277

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  278  ILGDVFMGVYHTVFDYGKLRVGFAESA  304



>ref|XP_010686810.1| PREDICTED: aspartic proteinase A1-like [Beta vulgaris subsp. 
vulgaris]
Length=516

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN AIG  GV S+ CK VV+ YG+ +IDLL  E  PKK+CSQIG+CT++G  GVSMGIES
Sbjct  312  INQAIGVSGVASQACKKVVDQYGETIIDLLFSEGSPKKVCSQIGVCTYDGTHGVSMGIES  371

Query  591  VVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            VVD+++  S+   LHD MCSACEM VVWMQ+QL +N T++ ++SY NELC+R+P+PMG S
Sbjct  372  VVDKESSDSSSEGLHDGMCSACEMAVVWMQSQLKQNATKDRVISYANELCDRVPNPMGTS  431

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
            GVDC ++S MP VSF+I GK F+LSP EYILKVGEG AAQCISGFTALDVPPPRGP+WIL
Sbjct  432  GVDCARVSKMPPVSFTIAGKEFELSPEEYILKVGEGPAAQCISGFTALDVPPPRGPIWIL  491

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG +RVGFAEAA
Sbjct  492  GDVFMGRYHTVFDYGNLRVGFAEAA  516



>ref|XP_011100273.1| PREDICTED: cyprosin-like [Sesamum indicum]
Length=504

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T+INHAIGA GVVS+ECK+VV  YG+ ++++L+ +  P++ICS+IGLC+ +G R VSM I
Sbjct  299  TLINHAIGATGVVSQECKSVVSLYGKTILEMLLSKEEPQRICSRIGLCSSDGIRDVSMII  358

Query  597  ESVVDEKNGV-SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ +   S  LHD MC+AC+M VVWMQNQL  N T+E IL Y+NELC+RLPSPMGE
Sbjct  359  ESVVDKDSTKDSYGLHDEMCTACQMAVVWMQNQLRRNVTEEKILDYINELCDRLPSPMGE  418

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+VSF+IGGK FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWI
Sbjct  419  SAVDCSVLSSMPNVSFTIGGKSFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWI  478

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFDYG M+VGFAEAA
Sbjct  479  LGDVFMGQYHTVFDYGNMKVGFAEAA  504



>ref|XP_010418210.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418211.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418212.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418213.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
Length=514

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ E +P+KICSQIGLC F+G +GVSMGI+
Sbjct  310  MINKAIGASGVVSQQCKTVVDQYGQIILDLLLAETQPQKICSQIGLCGFDGTQGVSMGID  369

Query  594  SVVDEKN-GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++N   S+ L  A C  CEM VVW+Q+QL +N TQE I++YVNE+C R+P+P GES
Sbjct  370  SVVDKENMKSSSGLRGAGCPPCEMAVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGES  429

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC KLSTMP+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  430  AVDCSKLSTMPTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTALDIPPPRGPLWIL  489

Query  237  GDVFMGRYHTVFDYGKMRVGFAEA  166
            GDVFMG+YHTVFD+G  RVGFAEA
Sbjct  490  GDVFMGKYHTVFDFGNERVGFAEA  513



>ref|NP_001150729.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG40142.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=518

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  312  TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSTGI  371

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD+K G S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  372  RSVVDDKAGKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILTYINQLCERLPSPMG  431

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC  L +MP ++F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLW
Sbjct  432  ESAVDCASLGSMPDIAFTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLW  491

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDY K+RVGFAE+A
Sbjct  492  ILGDVFMGVYHTVFDYXKLRVGFAESA  518



>ref|XP_010667516.1| PREDICTED: aspartic proteinase A1-like [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INHAIGA GV S ECKAVV  YG+++++LL+ E +PKKICSQIGLCTF+G R VSMGIES
Sbjct  310  INHAIGASGVASMECKAVVSQYGKQILELLLSETQPKKICSQIGLCTFDGKRDVSMGIES  369

Query  591  VVD-EKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VVD   +  S  L D+MC+ACEM VVWMQNQL +NQT+E IL+Y NELC RLPSPMGES 
Sbjct  370  VVDVNVDKSSGGLRDSMCTACEMAVVWMQNQLRQNQTEERILNYANELCERLPSPMGESA  429

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  LS+MPS+SF+I G  FDL+P +YILKVGEG+AAQCISGF ALDVPPPRGPLWILG
Sbjct  430  VDCSSLSSMPSISFTIAGTTFDLTPEQYILKVGEGAAAQCISGFIALDVPPPRGPLWILG  489

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            D+FMGRYHTVFDYG +RVGFAEAA
Sbjct  490  DIFMGRYHTVFDYGNLRVGFAEAA  513



>emb|CDY24888.1| BnaA03g59920D [Brassica napus]
Length=511

 Score =   310 bits (793),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 174/205 (85%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIE
Sbjct  307  MINKAIGASGVVSQQCKTVVDQYGQTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIE  366

Query  594  SVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD++N  S+  L DA C+ CEM VVW+Q+QL +N TQ+ I++ +N++C R+PSP GES
Sbjct  367  SVVDKENTKSSSGLRDAGCAPCEMAVVWIQSQLMQNMTQKRIVNNINDICERMPSPNGES  426

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LS MP+VSF+IGGKVFDLSP EY+LK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  427  AVDCSQLSKMPTVSFTIGGKVFDLSPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWIL  486

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD+G  +VGFAEAA
Sbjct  487  GDVFMGRYHTVFDFGNEQVGFAEAA  511



>gb|AFB73927.2| preprocirsin [Cirsium vulgare]
Length=509

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHA GA GV+S++CK +V  YG+ +I++L+ EA+P KICSQ+ LCTF+G R VS  I
Sbjct  304  TEINHASGAKGVMSQQCKTLVSQYGKSIIEMLLSEAQPDKICSQMKLCTFDGARDVSSII  363

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ NG S+   +D MC+ CEM VVWMQNQ+  N+T++NI++YVNELC+RLPSPMGE
Sbjct  364  ESVVDKNNGKSSGGANDEMCTFCEMAVVWMQNQIKRNETEDNIINYVNELCDRLPSPMGE  423

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+++F+IGGKVF+L P +YILK+GEG AAQCISGFTA+DV PPRGPLWI
Sbjct  424  SAVDCNSLSSMPNIAFTIGGKVFELCPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWI  483

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYGK RVGFAEAA
Sbjct  484  LGDVFMGRYHTVFDYGKSRVGFAEAA  509



>emb|CAA48939.1| cyprosin [Cynara cardunculus]
Length=474

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN AIGA GV+S++CK++V+ YG+ MI++L+ E +P+KICSQ+ LC+F+G+   SM I
Sbjct  270  TQINQAIGAAGVMSQQCKSLVDQYGKSMIEMLLSEEQPEKICSQMKLCSFDGSHDTSMII  329

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD+  G S+ LHD MC+ C+M VVWMQNQ+ +N+T+ENI++YV++LC RLPSPMGES
Sbjct  330  ESVVDKSKGKSSGLHDEMCTMCQMAVVWMQNQIRQNETEENIINYVDKLCERLPSPMGES  389

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  LS+MP+++F++GGK F+LSP +Y+LKVGEG+ AQCISGFTA+DV PP GPLWIL
Sbjct  390  AVDCSSLSSMPNIAFTVGGKTFNLSPEQYVLKVGEGATAQCISGFTAMDVAPPHGPLWIL  449

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG+YHTVFDYG +RVGFAEAA
Sbjct  450  GDVFMGQYHTVFDYGNLRVGFAEAA  474



>emb|CDY08632.1| BnaC04g19410D [Brassica napus]
Length=511

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ +A+PK ICSQIGLCTF+G  GVSMGIE
Sbjct  307  MINKAIGASGVVSQQCKTVVDQYGQSILDLLLAKAQPKHICSQIGLCTFDGTHGVSMGIE  366

Query  594  SVVD-EKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVVD E    S+ L DA C+ CEM VVW+Q+QL +N TQ+ I++Y+N++C R+PSP GES
Sbjct  367  SVVDKESTKSSSGLRDAGCAPCEMAVVWIQSQLMQNMTQKRIVNYINDICERMPSPNGES  426

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +L  MP+VSF+IGGKVFDL+P EY+LK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  427  AVDCSQLCKMPTVSFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWIL  486

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVF +G  +VGFAEAA
Sbjct  487  GDVFMGRYHTVFHFGNEQVGFAEAA  511



>ref|XP_009600571.1| PREDICTED: cyprosin-like [Nicotiana tomentosiformis]
Length=508

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK++V  YG+ ++DLL  +A P+KICSQIGLC+ +G+R VSM I
Sbjct  304  TQINHAIGASGVVSQECKSLVTEYGKTILDLLESKAAPQKICSQIGLCSSDGSRDVSMII  363

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD+ NG S  L D MC  CEM V+WMQNQ+  N+T ++I  YVN+LC+RLPSPMGES
Sbjct  364  ESVVDKHNGASNGLGDEMCRVCEMAVIWMQNQMRRNETADSIYDYVNQLCDRLPSPMGES  423

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  L++MP+VSF++G + F L+P +Y+L+VGEG  AQCISGFTALDVPPPRGPLWIL
Sbjct  424  AVDCSSLASMPNVSFTVGNQTFGLTPQQYVLQVGEGPVAQCISGFTALDVPPPRGPLWIL  483

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG  RVGFAEAA
Sbjct  484  GDVFMGRYHTVFDYGNSRVGFAEAA  508



>gb|EYU34027.1| hypothetical protein MIMGU_mgv1a024943mg, partial [Erythranthe 
guttata]
Length=382

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 170/205 (83%), Gaps = 7/205 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T+INHAIGA GVVS+ECK+VV  YG+ ++++L  E +P+KICSQIGLC  +G R VSM I
Sbjct  185  TLINHAIGATGVVSQECKSVVSVYGKTILEMLTSETQPQKICSQIGLCASDGTRDVSMII  244

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVV++ +       D MC+ACEM VVWMQNQ+  N+T+E IL Y+N+LC RLPSPMGES
Sbjct  245  ESVVEKGS-------DEMCTACEMAVVWMQNQVKRNETEEKILDYINQLCERLPSPMGES  297

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCG LS+MP++SF+IGGK F+L+P +Y+LK+GEG AAQCISGFTALDV PPRGPLWIL
Sbjct  298  AVDCGVLSSMPNISFTIGGKSFELTPQQYVLKIGEGEAAQCISGFTALDVAPPRGPLWIL  357

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG YHTVFDYG ++VGFAEAA
Sbjct  358  GDVFMGPYHTVFDYGNLKVGFAEAA  382



>ref|XP_004287958.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   308 bits (788),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 175/208 (84%), Gaps = 3/208 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA G+VS+ECKA+V+ YG+ ++++L+ + +P++ICSQIGLCTF+G RGVSMGI
Sbjct  308  TQINHAIGASGIVSQECKAIVDQYGKIILEMLLAQVKPQRICSQIGLCTFDGTRGVSMGI  367

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQL--SENQTQENILSYVNELCNRLPSPM  427
            E+VVD+     +D +HDA C+ACEM VVW+QNQL  + NQT+E IL+Y NELC RLPSP 
Sbjct  368  ETVVDQNTETKSDGVHDAACTACEMAVVWIQNQLRLNLNQTEEQILNYANELCERLPSPN  427

Query  426  GESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPL  247
            GES V C  LS++P++SF+IGGKVFDL+P +Y+LK+GEG+AAQC+SGF ALDV PPRGPL
Sbjct  428  GESAVQCNTLSSLPTISFTIGGKVFDLAPEQYVLKMGEGAAAQCLSGFIALDVAPPRGPL  487

Query  246  WILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            WILGD+FMG+YHTVFDYG   VGFA AA
Sbjct  488  WILGDIFMGQYHTVFDYGNANVGFAVAA  515



>ref|XP_004243484.1| PREDICTED: cyprosin-like [Solanum lycopersicum]
Length=508

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK+VV  YG+ ++DLL  +A P++ICSQIGLC+ +G + VSM I
Sbjct  304  TQINHAIGASGVVSQECKSVVSEYGKTILDLLESKAAPQQICSQIGLCSRDGGKDVSMII  363

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD+ N  S  +HD MC  CEM VVWMQNQL  N+T + I  Y+N+LC+R+PSPMGES
Sbjct  364  ESVVDKHNEASNGVHDEMCRVCEMAVVWMQNQLRRNETADRIFDYMNKLCDRIPSPMGES  423

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  L++MP+VSF++G K F+L+P +Y+LKVGE   AQCISGFTALDVPPPRGPLWIL
Sbjct  424  AVDCNSLASMPNVSFTVGDKTFELTPQQYVLKVGEAPVAQCISGFTALDVPPPRGPLWIL  483

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDY KMRVGFAEAA
Sbjct  484  GDVFMGRYHTVFDYEKMRVGFAEAA  508



>gb|AHB32105.1| aspartic proteinase [Camellia sinensis]
Length=507

 Score =   307 bits (787),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA G+VS+ECKAVV  YG+ ++++L+ +A P+KICSQIGLC  +G++ VS+GI
Sbjct  302  TQINHAIGASGIVSQECKAVVAQYGKMILEMLLAQAEPQKICSQIGLCYSDGSQDVSIGI  361

Query  597  ESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+    S+ +H +A C+AC+M V+WMQNQL  NQTQ+ IL+Y+NELC+RLPSPMGE
Sbjct  362  ESVVDKNRHESSGVHGEASCTACQMMVIWMQNQLKGNQTQDRILNYINELCDRLPSPMGE  421

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP VSF+IGGKVFDL+P +Y+L+VG+G   QCISGFTALDV PPRGPLWI
Sbjct  422  SAVDCSSLSSMPIVSFTIGGKVFDLTPEQYVLQVGDGPETQCISGFTALDVTPPRGPLWI  481

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTVFDYG M VGFAEAA
Sbjct  482  LGDVFMGQYHTVFDYGNMTVGFAEAA  507



>gb|AFH58568.1| aspartic acid protease [Ananas comosus]
Length=514

 Score =   307 bits (787),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN  IGA GVVS+ECKAVV  YGQ+++ +L+ E +P KICS IGLCTF+G +GVS GIES
Sbjct  311  INQKIGASGVVSQECKAVVAEYGQQILQMLLAEVQPGKICSSIGLCTFDGKQGVSAGIES  370

Query  591  VVDEKNGVSA-DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV++    SA  L DAMC+ CEM VVWMQNQ+S+NQTQE I +Y+N+LC +LPSPMGES 
Sbjct  371  VVNKDTRRSAAGLSDAMCNVCEMAVVWMQNQISQNQTQELIFNYLNQLCEKLPSPMGESS  430

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  +++MP +SF+IGGK F L P +YIL+VGEG AAQCISGFTALDVPPPRGPLWILG
Sbjct  431  VDCSSVASMPDISFTIGGKKFSLKPEQYILQVGEGYAAQCISGFTALDVPPPRGPLWILG  490

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG MRVGFA+AA
Sbjct  491  DVFMGAYHTVFDYGNMRVGFADAA  514



>ref|XP_009123370.1| PREDICTED: aspartic proteinase A2 isoform X2 [Brassica rapa]
Length=501

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIE
Sbjct  297  MINKAIGASGVVSQQCKTVVDQYGQTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIE  356

Query  594  SVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVV+++N  S+  L DA C+ CEM V+W+Q+QL +N TQ+ I++ +N++C R+PSP GES
Sbjct  357  SVVEKENTKSSSGLRDAGCAPCEMAVMWIQSQLMQNMTQKRIVNNINDICERMPSPNGES  416

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LS MP+VSF+IGGKVFDLSP EY+LK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  417  AVDCSQLSKMPTVSFTIGGKVFDLSPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWIL  476

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD+G  +VGFAEAA
Sbjct  477  GDVFMGRYHTVFDFGNEQVGFAEAA  501



>ref|XP_004293311.1| PREDICTED: aspartic proteinase A1 [Fragaria vesca subsp. vesca]
Length=512

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 178/206 (86%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
             MIN AIGA+GVVS+ECKAVV+ YGQ +++LL+ EA+P+KICSQIG+CTF+G R VSMGI
Sbjct  307  AMINKAIGANGVVSQECKAVVQQYGQTILELLLAEAQPRKICSQIGVCTFDGTRSVSMGI  366

Query  597  ESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ +   S  LHDA CSACEM VVWMQNQL +NQTQE IL+YVNELC+R+PSP G+
Sbjct  367  ESVVDKNRKKSSGVLHDASCSACEMAVVWMQNQLQQNQTQEFILNYVNELCDRMPSPNGQ  426

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LSTMP++SF+IGGKVF L   EY+LKVGEG+ AQCISGF  +DVPPPRGPLWI
Sbjct  427  SAVDCQRLSTMPTISFTIGGKVFPLRAEEYVLKVGEGAQAQCISGFIGMDVPPPRGPLWI  486

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYGK RVGFAEAA
Sbjct  487  LGDVFMGRYHTVFDYGKKRVGFAEAA  512



>ref|XP_009123365.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123366.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123367.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123369.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
Length=509

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 1/205 (0%)
 Frame = -2

Query  774  MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  595
            MIN AIGA GVVS++CK VV+ YGQ ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIE
Sbjct  305  MINKAIGASGVVSQQCKTVVDQYGQTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIE  364

Query  594  SVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            SVV+++N  S+  L DA C+ CEM V+W+Q+QL +N TQ+ I++ +N++C R+PSP GES
Sbjct  365  SVVEKENTKSSSGLRDAGCAPCEMAVMWIQSQLMQNMTQKRIVNNINDICERMPSPNGES  424

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC +LS MP+VSF+IGGKVFDLSP EY+LK+GEG  AQCISGFTALD+PPPRGPLWIL
Sbjct  425  AVDCSQLSKMPTVSFTIGGKVFDLSPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWIL  484

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD+G  +VGFAEAA
Sbjct  485  GDVFMGRYHTVFDFGNEQVGFAEAA  509



>gb|AFW74920.1| hypothetical protein ZEAMMB73_522985 [Zea mays]
Length=468

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 168/207 (81%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI
Sbjct  262  TEINEKIGAAGVVSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGI  321

Query  597  ESVVDEKNGVSAD--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
             SVVD++   S      D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMG
Sbjct  322  RSVVDDEARKSNGGLKSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMG  381

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDCG L +MP + F+IGGK F L P +YILKVGEG A QCISGFTA+D+PPPRGPLW
Sbjct  382  ESAVDCGSLVSMPDIVFTIGGKKFKLKPEQYILKVGEGQAVQCISGFTAMDIPPPRGPLW  441

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYGK+RVGFAE+A
Sbjct  442  ILGDVFMGVYHTVFDYGKLRVGFAESA  468



>ref|XP_009394234.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN  IGA GVVS+ECKAVV  YGQ+++ +L+ E  P KICSQIGLCTF+G RGVS+ IES
Sbjct  306  INQKIGASGVVSQECKAVVAQYGQQILKMLLSETEPAKICSQIGLCTFDGTRGVSIDIES  365

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV+E    S+ +  ++MC  CEM+VVWMQNQL +NQTQE +L+Y+N LC RLPSPMGES 
Sbjct  366  VVNENADASSGVQTNSMCGVCEMSVVWMQNQLRQNQTQERVLNYINGLCERLPSPMGESS  425

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  +S+MP VSF+IG K F+L+  +YILKVGEG+AAQCISGFTALDVPPPRGPLWILG
Sbjct  426  VDCAAISSMPGVSFTIGNKTFELAAEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILG  485

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDY  +RVGFAEAA
Sbjct  486  DVFMGVYHTVFDYRNLRVGFAEAA  509



>gb|ABG37021.1| aspartic protease [Nicotiana tabacum]
Length=508

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INH IGA GVVS+ECK++V  YG+ ++DLL  +A P+KICSQIGLC+ +G+R VSM I
Sbjct  304  TQINHVIGASGVVSQECKSLVTEYGKTILDLLESKAAPQKICSQIGLCSSDGSRDVSMII  363

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD+ NG S  L D MC  CEM V+WMQNQ+  N+T ++I  YVN+LC+RLPSPMGES
Sbjct  364  ESVVDKHNGASNGLGDEMCRVCEMAVIWMQNQMRRNETADSIYDYVNQLCDRLPSPMGES  423

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  L++MP+VSF++G + F L+P +Y+L+VGEG  AQCISGFTALDVPPPRGPLWIL
Sbjct  424  AVDCSSLASMPNVSFTVGNQTFGLTPQQYVLQVGEGPVAQCISGFTALDVPPPRGPLWIL  483

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFDYG  RVGFAEAA
Sbjct  484  GDVFMGRYHTVFDYGNSRVGFAEAA  508



>ref|XP_006840365.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda]
 gb|ERN02040.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda]
Length=510

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INHAIGA+G+VS++CK VV  YG+ +++LL+ E +P+KICSQIGLC F+GNR VS GI S
Sbjct  307  INHAIGAEGIVSQQCKLVVSQYGEMILELLLSETQPQKICSQIGLCVFDGNRDVSSGIAS  366

Query  591  VVDEKNGVSADLHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VVD+++G  A + D AMC+ACEM VVW+QNQ+  N+T+  IL Y N+LC RLPSPMGES 
Sbjct  367  VVDKEDGSKASVGDSAMCTACEMAVVWIQNQIKRNETKTQILEYANQLCERLPSPMGESA  426

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  +S MP+VSF IG K FDL P++Y+LKVGEG  AQCISGF+ALD+PPPRGPLWILG
Sbjct  427  VDCNNISGMPNVSFIIGNKAFDLRPDQYVLKVGEGVTAQCISGFSALDMPPPRGPLWILG  486

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG +RVGFAEAA
Sbjct  487  DVFMGAYHTVFDYGNLRVGFAEAA  510



>dbj|BAA76870.1| aspartic proteinase [Helianthus annuus]
Length=509

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S++CK +V+ YG+ +I++L+ EA+P KICS++ LCTF+G+R VS  I
Sbjct  304  TQINHAIGAAGVMSQQCKTLVDQYGKTIIEMLLSEAQPDKICSRMNLCTFDGSRDVSSII  363

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+ NG  SA L+D +C+ CEM VVWMQ+QL  NQT+++I++YVNELC+R+PSPMGE
Sbjct  364  ESVVDKNNGKSSAGLNDGICAFCEMAVVWMQSQLKRNQTEDSIINYVNELCDRIPSPMGE  423

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS MP+++F+IGGK FDL+P +YILKVGEG  AQCISGFTALDV PP GPLWI
Sbjct  424  SAVDCQTLSNMPNIAFTIGGKTFDLTPEQYILKVGEGEVAQCISGFTALDVAPPHGPLWI  483

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
             GDVFMG+YHTVFD+GK RVGFAEAA
Sbjct  484  HGDVFMGQYHTVFDFGKSRVGFAEAA  509



>ref|XP_009419881.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            IN+ IG  GVVS+ECKAVV  YGQR+ ++L+ + +P K+CSQIGLC  +G   VS+ IES
Sbjct  312  INNRIGVSGVVSQECKAVVAQYGQRIFEMLISQTQPTKMCSQIGLCASDGTGAVSIAIES  371

Query  591  VVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV E   VS+ LH DAMC+ACEM +VWMQNQLS+NQTQE +L+++NELC RLPSPMGES 
Sbjct  372  VVSENKDVSSSLHNDAMCNACEMALVWMQNQLSQNQTQEEMLNHINELCERLPSPMGESS  431

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  + +MPSVSF+IG ++F+L P +YILKVGEG+  QCISGFTALDVPPPRGPLWILG
Sbjct  432  VDCAAIPSMPSVSFTIGDRIFELQPEQYILKVGEGAEEQCISGFTALDVPPPRGPLWILG  491

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG  RVGFA+AA
Sbjct  492  DVFMGVYHTVFDYGNSRVGFAQAA  515



>gb|AFX73039.1| preprogaline A [Galium verum]
Length=506

 Score =   302 bits (774),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            INHAIGA GVVS+ECK+VV  YG+ ++D+L+ +  PK IC+ IGLC   G+R   M IES
Sbjct  303  INHAIGATGVVSQECKSVVSQYGKTILDMLLAKTEPKTICASIGLCLPKGSRDDDMIIES  362

Query  591  VVDEKNGVSADL-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV+E +  S  L +D MCSAC+M VVWMQNQ+ +NQT+E IL Y+N+LC+RLPSPMGES 
Sbjct  363  VVEETDSASDGLRNDEMCSACQMAVVWMQNQVRQNQTEEKILDYINQLCDRLPSPMGESA  422

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  L+++P ++FSIGGK F+LSP EY+LKVGEG+AAQCISGFTALDV PP GPLWILG
Sbjct  423  VDCSSLASLPKIAFSIGGKAFELSPEEYVLKVGEGAAAQCISGFTALDVAPPLGPLWILG  482

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG MRVGFAEAA
Sbjct  483  DVFMGSYHTVFDYGNMRVGFAEAA  506



>ref|XP_006364164.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=508

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GVVS+ECK+VV  YG+ ++DLL  +A P++ICSQI LC+ +G R VSM I
Sbjct  304  TQINHAIGASGVVSQECKSVVSEYGKTILDLLESKAAPQQICSQINLCSRDGGRDVSMII  363

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD+ N  S  +HD MC  CEM VVWMQNQL  N+T + I  Y+N+LC+RLPSPMGES
Sbjct  364  ESVVDKHNEASNGVHDEMCRVCEMAVVWMQNQLRRNETADRIFDYMNKLCDRLPSPMGES  423

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             V+C  L++MP+VSF++G K F+L+P +Y+LKVGE    QCISGFTALDVPPPRGPLWIL
Sbjct  424  AVNCNSLASMPNVSFTVGNKTFELTPQQYVLKVGEAPVTQCISGFTALDVPPPRGPLWIL  483

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMGRYHTVFD  KMRVGFAEAA
Sbjct  484  GDVFMGRYHTVFDSEKMRVGFAEAA  508



>ref|XP_004151126.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=513

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKAVV  YG+ +I +L+ + +PKKICS +GLC F+G RGVSMGI
Sbjct  308  TQVNHAIGASGVVSEECKAVVAEYGETIIKMLLAKDQPKKICSTLGLCAFDGERGVSMGI  367

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD     S++ L D MC+ACEM VVW Q+QL E +TQ+ IL+Y++ LC +LPSPMGE
Sbjct  368  ESVVDNTTQKSSNGLRDVMCNACEMAVVWAQSQLKEEKTQDQILNYIDGLCEKLPSPMGE  427

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +DC  LST+PS+SF+IGGKVF+L P +Y+LKV EG   +CISGF ALDVPPPRGPLWI
Sbjct  428  SVIDCDSLSTLPSISFTIGGKVFELKPEQYVLKVTEGPVTECISGFAALDVPPPRGPLWI  487

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYG  RVGFAEAA
Sbjct  488  LGDVFMGSYHTVFDYGNSRVGFAEAA  513



>ref|XP_004161880.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=516

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA GVVS+ECKAVV  YG+ +I +L+ + +PKKICS +GLC F+G RGVSMGI
Sbjct  311  TQVNHAIGASGVVSEECKAVVAEYGETIIKMLLAKDQPKKICSTLGLCAFDGERGVSMGI  370

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD     S++ L D MC+ACEM VVW Q+QL E +TQ+ IL+Y++ LC +LPSPMGE
Sbjct  371  ESVVDNTTQKSSNGLRDVMCNACEMAVVWAQSQLKEEKTQDQILNYIDGLCEKLPSPMGE  430

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S +DC  LST+PS+SF+IGGKVF+L P +Y+LKV EG   +CISGF ALDVPPPRGPLWI
Sbjct  431  SVIDCDSLSTLPSISFTIGGKVFELKPEQYVLKVTEGPVTECISGFAALDVPPPRGPLWI  490

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYG  RVGFAEAA
Sbjct  491  LGDVFMGSYHTVFDYGNSRVGFAEAA  516



>ref|XP_007020767.1| Aspartic proteinase A1 [Theobroma cacao]
 gb|EOY12292.1| Aspartic proteinase A1 [Theobroma cacao]
Length=470

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA G+VS+ECKA+V  YG+ +ID+L+ E +P+KICSQIGLC  +G RG SM I
Sbjct  265  TEINHAIGASGIVSQECKALVLQYGETIIDMLLAEDQPQKICSQIGLCALDGTRGASMSI  324

Query  597  ESVVDEK-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD+     S  +H++MCSACEMT+ W+QNQL +NQT +++L+Y+NELC+RLPSPMG 
Sbjct  325  ESVVDKNAQKSSGGVHNSMCSACEMTISWIQNQLKQNQTLDHVLNYINELCDRLPSPMGA  384

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP++SF IGG++FDL+P +YILKVGEG+ A+CISGFTALD+P P  PLWI
Sbjct  385  SAVDCNALSSMPNLSFVIGGRIFDLNPEQYILKVGEGNTARCISGFTALDLPLPHEPLWI  444

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG+YHTV DYG M+VGFA AA
Sbjct  445  LGDVFMGQYHTVLDYGNMKVGFAAAA  470



>ref|XP_006644474.1| PREDICTED: aspartic proteinase oryzasin-1-like [Oryza brachyantha]
Length=517

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECK VV  YGQ+++D L+ E++P ++CS +GLCTF+G  GVS GI
Sbjct  312  TQINEKIGATGVVSQECKTVVSQYGQQILDQLLAESKPAQVCSSVGLCTFDGIHGVSAGI  371

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
             SVVD++NG S+     AMC+ACE  VVWM  QL++NQTQ+ IL Y+N+LC+RLPSPMGE
Sbjct  372  RSVVDDENGKSSSPFSSAMCNACETAVVWMHTQLAQNQTQDLILQYINQLCDRLPSPMGE  431

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  L++MP ++F+IGGK F L P +YILKV EG A QCISGFTA+D+PPPRGPLWI
Sbjct  432  SSVDCSSLASMPDIAFTIGGKKFVLKPEQYILKVSEGDATQCISGFTAMDIPPPRGPLWI  491

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYGK++VGFAEAA
Sbjct  492  LGDVFMGAYHTVFDYGKLKVGFAEAA  517



>ref|XP_004969436.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica]
Length=507

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T+IN  IGA GVVS+ECKAVV  YGQ++ID L+ E +P KICS +GLCTF+G  GVS GI
Sbjct  302  TLINEKIGAAGVVSQECKAVVSQYGQQIIDQLLAETQPSKICSSVGLCTFDGAHGVSAGI  361

Query  597  ESVVDEKNGVSADL-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
             SVVD++ G S  L ++AMC+ACE  VVW+++QL++NQTQ+ +L Y+N+LC +LPSPMGE
Sbjct  362  RSVVDDEAGESNGLFNEAMCNACETAVVWIRSQLAQNQTQDLVLQYINQLCEKLPSPMGE  421

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC ++++MP ++F+IGG+ F L P +YILKVGEG+AAQCISGFTA+D+PPPRGPLWI
Sbjct  422  SSVDCSRVASMPDIAFTIGGRKFALKPEQYILKVGEGTAAQCISGFTAMDIPPPRGPLWI  481

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMG YHTVFDYG ++VGFAEAA
Sbjct  482  LGDIFMGAYHTVFDYGNLKVGFAEAA  507



>emb|CDP10762.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   300 bits (767),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 169/205 (82%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA GV+S+EC +VV  YG+ +I++L+ +  P++ICS+IGLC+ +G+  VSM I
Sbjct  304  TQINHAIGASGVLSQECMSVVTEYGKTIIEMLLAKVEPQQICSKIGLCSSDGSHDVSMLI  363

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVV E +  S    D MC+AC+M VVWMQNQL  NQT+E IL Y+N+LC+RLPSPMGES
Sbjct  364  ESVV-ETDMTSDGPRDNMCTACQMAVVWMQNQLRRNQTEEKILDYINQLCDRLPSPMGES  422

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  L++MP +SF IG K F+LSP +YIL+VGEG+AAQCISGFTALDV PPRGPLWIL
Sbjct  423  AVDCSALASMPKISFIIGSKTFELSPEQYILRVGEGAAAQCISGFTALDVLPPRGPLWIL  482

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG+YHTVFDYGKMRVGFAEAA
Sbjct  483  GDVFMGQYHTVFDYGKMRVGFAEAA  507



>gb|KGN64503.1| Aspartic proteinase [Cucumis sativus]
Length=489

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -2

Query  672  ARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLS  496
            A PKKICSQI LCTF+G RGVSMGIESVVDE  G S+D L D MCS CEMTVVWMQNQL 
Sbjct  319  ADPKKICSQIKLCTFDGTRGVSMGIESVVDENAGKSSDGLRDGMCSVCEMTVVWMQNQLR  378

Query  495  ENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVG  316
            +NQT+E I++Y+NELC+R+PSPMG+S VDCG LS+MPSVSF+IG KVFDL+P EYILKVG
Sbjct  379  QNQTKERIINYINELCDRMPSPMGQSAVDCGTLSSMPSVSFTIGDKVFDLAPEEYILKVG  438

Query  315  EGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            EG+AAQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  439  EGAAAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEAA  489



>gb|KDP24853.1| hypothetical protein JCGZ_24447 [Jatropha curcas]
Length=512

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 171/207 (83%), Gaps = 2/207 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLV-MEARPKKICSQIGLCTFNGNRGVSMG  601
            T INHAIGA GVVS+ECK +VE YG+ +++LL+  +A+P+KICSQIG CTF+G +GVS  
Sbjct  306  TQINHAIGASGVVSQECKTMVEQYGKVILELLLAQQAQPQKICSQIGFCTFDGTQGVSTN  365

Query  600  IESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMG  424
            IESVVD      +D L DA C+ACEM VVW+QN+L  NQTQ+ IL+YVN+LC+RLPSP G
Sbjct  366  IESVVDASMDRQSDGLQDAACTACEMMVVWIQNRLRLNQTQDQILNYVNQLCDRLPSPNG  425

Query  423  ESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  244
            ES VDC  LS+M ++SF+IGGK F+L+P +Y+LKVGEG +AQCISGFTA D+PPPRGPLW
Sbjct  426  ESAVDCSSLSSMANISFTIGGKAFELTPEQYVLKVGEGVSAQCISGFTAFDLPPPRGPLW  485

Query  243  ILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ILGDVFMG YHTVFDYG + VGFA+AA
Sbjct  486  ILGDVFMGPYHTVFDYGNLTVGFAKAA  512



>ref|XP_011006459.1| PREDICTED: cyprosin-like isoform X2 [Populus euphratica]
Length=514

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN+AIGA G+VS+ECK VV  YG+ ++++LV +A+P+K+CSQI  CTF+G +GVSM I
Sbjct  309  TQINNAIGASGIVSEECKTVVAQYGKIILEMLVAQAQPRKVCSQISFCTFDGTQGVSMNI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV+E +  S+D LHDAMC+ACEM VVWM+N+L  N T++ IL YVN+LC+RLPSP GE
Sbjct  369  ESVVEESSDKSSDGLHDAMCTACEMIVVWMENRLRLNDTKDQILDYVNDLCDRLPSPNGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V+C  LS+M SVSF IGGK+F+LSP +Y+LKVGEG +AQCISGFTALDVPPPRGPLWI
Sbjct  429  SAVECSSLSSMSSVSFEIGGKLFELSPEQYVLKVGEGVSAQCISGFTALDVPPPRGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG + VGFA+AA
Sbjct  489  LGDVFMGRYHTVFDYGNLTVGFADAA  514



>ref|NP_001043786.1| Os01g0663400 [Oryza sativa Japonica Group]
 dbj|BAF05700.1| Os01g0663400 [Oryza sativa Japonica Group]
 dbj|BAG92907.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71223.1| hypothetical protein OsI_03158 [Oryza sativa Indica Group]
 gb|EEE55128.1| hypothetical protein OsJ_02912 [Oryza sativa Japonica Group]
 gb|AFI71272.1| unnamed protein [Oryza sativa Japonica Group]
Length=522

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECKAVV  YGQ+++D L  E +P K+CS +GLCTF+G  GVS GI
Sbjct  317  TQINEKIGATGVVSQECKAVVSQYGQQILDQLRAETKPAKVCSSVGLCTFDGTHGVSAGI  376

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
             SVVD++ G S+     AMC+ACE  VVWM  QL++NQTQ+ +L Y+++LC+RLPSPMGE
Sbjct  377  RSVVDDEVGKSSGPFSSAMCNACETAVVWMHTQLAQNQTQDLVLQYIDQLCDRLPSPMGE  436

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  L++MP ++F+IGG  F L P +YILKVGEG+A QCISGFTA+D+PPPRGPLWI
Sbjct  437  SSVDCSSLASMPDIAFTIGGNKFVLKPEQYILKVGEGTATQCISGFTAMDIPPPRGPLWI  496

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMG YHTVFDYG ++VGFAEAA
Sbjct  497  LGDVFMGAYHTVFDYGNLKVGFAEAA  522



>ref|XP_011006458.1| PREDICTED: cyprosin-like isoform X1 [Populus euphratica]
Length=536

 Score =   296 bits (758),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN+AIGA G+VS+ECK VV  YG+ ++++LV +A+P+K+CSQI  CTF+G +GVSM I
Sbjct  331  TQINNAIGASGIVSEECKTVVAQYGKIILEMLVAQAQPRKVCSQISFCTFDGTQGVSMNI  390

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV+E +  S+D LHDAMC+ACEM VVWM+N+L  N T++ IL YVN+LC+RLPSP GE
Sbjct  391  ESVVEESSDKSSDGLHDAMCTACEMIVVWMENRLRLNDTKDQILDYVNDLCDRLPSPNGE  450

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V+C  LS+M SVSF IGGK+F+LSP +Y+LKVGEG +AQCISGFTALDVPPPRGPLWI
Sbjct  451  SAVECSSLSSMSSVSFEIGGKLFELSPEQYVLKVGEGVSAQCISGFTALDVPPPRGPLWI  510

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG + VGFA+AA
Sbjct  511  LGDVFMGRYHTVFDYGNLTVGFADAA  536



>dbj|BAC16370.1| aspartic proteinase 4 [Glycine max]
Length=169

 Score =   282 bits (722),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = -2

Query  666  PKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSEN  490
            PKKICSQIGLCTF+G  GVSMGIESVVD+ +   S  + DA CSACEM V+WMQNQL +N
Sbjct  1    PKKICSQIGLCTFDGTHGVSMGIESVVDKNERKSSGSIRDAGCSACEMAVIWMQNQLRQN  60

Query  489  QTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEG  310
            QT++ I+ Y NELC++LP+PMG+S VDC KLS+MP VSF+IGGKVFDLSP EYILKVGEG
Sbjct  61   QTEDRIIDYANELCDKLPNPMGQSSVDCEKLSSMPIVSFTIGGKVFDLSPQEYILKVGEG  120

Query  309  SAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  163
              AQCISGFTALDVPPPRGPLWILGDVFMGRYHT+FDYGK+RVGFAEAA
Sbjct  121  PEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTIFDYGKLRVGFAEAA  169



>ref|XP_010455726.1| PREDICTED: aspartic proteinase A3 isoform X1 [Camelina sativa]
 ref|XP_010455728.1| PREDICTED: aspartic proteinase A3 isoform X1 [Camelina sativa]
Length=508

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C F+G   VSMGI
Sbjct  306  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGI  365

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVD+  G S  L+ AMCSAC+M  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S
Sbjct  366  QSVVDD--GASGLLNQAMCSACQMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQS  423

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC K+S+MP VSF+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWIL
Sbjct  424  AVDCEKVSSMPIVSFTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWIL  483

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  484  GDIFMGPYHTVFDYGKARVGFAKAA  508



>ref|XP_009114573.1| PREDICTED: aspartic proteinase A3 isoform X2 [Brassica rapa]
Length=499

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+ S+ECK V+  YGQ M++ LV +  P+K+CSQIGLC F+G   VSMGI
Sbjct  297  TMINHAIGAVGIASQECKTVIGQYGQTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGI  356

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVV++  GVS+ L++AMCSACEM  VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S
Sbjct  357  KSVVED--GVSSLLNEAMCSACEMASVWMQSELSQNQTQERILAYAAELCDHIPNPNQQS  414

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC ++S+MP V+F+IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWIL
Sbjct  415  AVDCERVSSMPIVTFTIGGKPFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWIL  474

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+A 
Sbjct  475  GDIFMGPYHTVFDYGKTRVGFAKAT  499



>ref|XP_010496363.1| PREDICTED: aspartic proteinase A3-like [Camelina sativa]
Length=512

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C F+G   VSMGI
Sbjct  310  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGI  369

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVD+  G S  L+ AMCSAC+M  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S
Sbjct  370  QSVVDD--GASGLLNQAMCSACQMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQS  427

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC K+S+MP VSF+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWIL
Sbjct  428  AVDCEKVSSMPIVSFTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWIL  487

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  488  GDIFMGPYHTVFDYGKARVGFAKAA  512



>ref|XP_009114571.1| PREDICTED: aspartic proteinase A3 isoform X1 [Brassica rapa]
Length=507

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+ S+ECK V+  YGQ M++ LV +  P+K+CSQIGLC F+G   VSMGI
Sbjct  305  TMINHAIGAVGIASQECKTVIGQYGQTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGI  364

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVV++  GVS+ L++AMCSACEM  VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S
Sbjct  365  KSVVED--GVSSLLNEAMCSACEMASVWMQSELSQNQTQERILAYAAELCDHIPNPNQQS  422

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC ++S+MP V+F+IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWIL
Sbjct  423  AVDCERVSSMPIVTFTIGGKPFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWIL  482

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+A 
Sbjct  483  GDIFMGPYHTVFDYGKTRVGFAKAT  507



>ref|XP_008784384.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=518

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 169/204 (83%), Gaps = 3/204 (1%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            +N  IGA G+VS++CKAVV  YG++++++L+ +  P KICS+IGLC F+G RGVSMGI+S
Sbjct  315  VNQKIGAAGIVSQQCKAVVSQYGEKIMEMLMEKEEPAKICSRIGLCAFDGTRGVSMGIKS  374

Query  591  VVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            +V+ K   S   L D MCS CEM VVWMQ+QL +NQT E +L+Y++ELC RLPSPMGES 
Sbjct  375  MVNGKRDRSTGGLGDGMCSYCEMAVVWMQSQLVQNQTLEQVLNYISELCERLPSPMGESA  434

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  LS+MP+VSF+IGGK+FDL P +YILKVG+GS+AQCISGFTALDV  P+GPLWILG
Sbjct  435  VDCNSLSSMPTVSFTIGGKIFDLKPEQYILKVGDGSSAQCISGFTALDV--PQGPLWILG  492

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG+ RVGFAEAA
Sbjct  493  DVFMGAYHTVFDYGQQRVGFAEAA  516



>ref|XP_002302872.2| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|EEE82145.2| aspartic endopeptidase family protein [Populus trichocarpa]
Length=514

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN+AIGA G+VS+ECK VV  YG+ ++++LV +A+P+K+CSQI  CTF+G +GVSM I
Sbjct  309  TQINNAIGASGIVSEECKTVVAQYGKIILEMLVAQAQPRKVCSQISFCTFDGTQGVSMNI  368

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV+E +  S+D LHDAMC+ACEM VVWM+N+L  N T++ IL YVN LC+RLPSP GE
Sbjct  369  ESVVEENSDKSSDGLHDAMCTACEMMVVWMENRLRLNDTEDQILDYVNNLCDRLPSPNGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V+C  LS+MPS+SF IGGK+F+LSP +Y+LKVGEG +AQCISGFTALDVPPP GPLWI
Sbjct  429  SAVECSSLSSMPSISFEIGGKLFELSPEQYVLKVGEGVSAQCISGFTALDVPPPHGPLWI  488

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGDVFMGRYHTVFDYG + VGFA+AA
Sbjct  489  LGDVFMGRYHTVFDYGNLTVGFADAA  514



>emb|CDY16668.1| BnaA09g20460D [Brassica napus]
Length=507

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+ S+ECK V+  YGQ M++ LV +  P+K+CSQIGLC F+G   VSMGI
Sbjct  305  TMINHAIGAVGIASQECKTVIGQYGQTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGI  364

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVV++  GVS+ L++AMCSACEM  VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S
Sbjct  365  KSVVED--GVSSLLNEAMCSACEMASVWMQSELSQNQTQERILAYAAELCDHIPNPNQQS  422

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC ++S+MP V+F+IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWIL
Sbjct  423  AVDCERVSSMPIVTFTIGGKPFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWIL  482

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+A 
Sbjct  483  GDIFMGPYHTVFDYGKTRVGFAKAT  507



>ref|XP_002872693.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48952.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C ++G   VSM I
Sbjct  305  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAYDGTHSVSMDI  364

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVD+  G S  L+ AMCSACEM  VWM+++L++NQTQE IL+Y  ELCN +P+   +S
Sbjct  365  QSVVDD--GTSGLLNQAMCSACEMAAVWMESELTQNQTQERILAYAAELCNHIPTKNQQS  422

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC ++S+MP VSFSIGG+ FDLSP +YI K+G+G  +QC SGFTA+D+PPPRGPLWIL
Sbjct  423  AVDCERVSSMPIVSFSIGGRTFDLSPQDYIFKIGDGVESQCTSGFTAMDIPPPRGPLWIL  482

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  483  GDIFMGPYHTVFDYGKARVGFAKAA  507



>gb|AFX73042.1| preprofigain C, partial [Ficus carica]
Length=386

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +N AIGA GVVS+ECKA+VE YGQ +I+ L+ + +PKKICSQIGLC+F+G RGVSMGI
Sbjct  202  TQLNQAIGASGVVSQECKAIVEQYGQTIIESLLAKDQPKKICSQIGLCSFDGTRGVSMGI  261

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVDE  G  S DL D MCSACEM VVWMQNQ+ +NQTQE IL+YVN+LC RLPSPMGE
Sbjct  262  KSVVDENVGKASGDLRDGMCSACEMAVVWMQNQIKQNQTQEQILNYVNQLCERLPSPMGE  321

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDCG LS++P V+F+IG K F+L+P +YILKVGEG AAQCISGFTALDVPPPRGPLWI
Sbjct  322  SSVDCGSLSSLPKVTFTIGEKKFELTPEQYILKVGEGDAAQCISGFTALDVPPPRGPLWI  381

Query  240  LGDVF  226
            LGDV 
Sbjct  382  LGDVL  386



>emb|CDX94554.1| BnaC09g22820D [Brassica napus]
Length=507

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+ S+ECK V+  YGQ M+D LV +  P+K+CS IGLC F+G   VSMGI
Sbjct  305  TMINHAIGAVGIASQECKTVIGQYGQTMLDSLVSQVDPRKVCSHIGLCGFDGTHSVSMGI  364

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVV++  GVS  L++AMCSACEM  VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S
Sbjct  365  KSVVED--GVSGLLNEAMCSACEMASVWMQSELSQNQTQERILAYAAELCDHIPNPNQQS  422

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC ++S+MP V+F+IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWIL
Sbjct  423  AVDCERVSSMPIVTFTIGGKPFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWIL  482

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+A 
Sbjct  483  GDIFMGPYHTVFDYGKTRVGFAKAT  507



>ref|XP_010432791.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Camelina sativa]
 ref|XP_010432799.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Camelina sativa]
Length=508

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C F+G   VSMGI
Sbjct  306  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGI  365

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVD+  G S  L+ AMCSAC+M  VWM+++L++N+TQE IL+Y  ELC+ +P+   +S
Sbjct  366  QSVVDD--GASGLLNQAMCSACQMAAVWMESELTQNKTQERILAYAAELCDHIPTQNQQS  423

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC K+S+MP VSF+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWIL
Sbjct  424  AVDCEKVSSMPIVSFTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWIL  483

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  484  GDIFMGPYHTVFDYGKARVGFAKAA  508



>ref|NP_192355.1| aspartic proteinase A3 [Arabidopsis thaliana]
 sp|Q9XEC4.1|APA3_ARATH RecName: Full=Aspartic proteinase A3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD29758.1|AF076243_5 putative aspartic protease [Arabidopsis thaliana]
 gb|AAK50111.1|AF372974_1 AT4g04460/T26N6_7 [Arabidopsis thaliana]
 emb|CAB77914.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AEE82390.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=508

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 169/205 (82%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C ++G + VSMGI
Sbjct  306  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAYDGTQSVSMGI  365

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVD+  G S  L+ AMCSACEM  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S
Sbjct  366  QSVVDD--GTSGLLNQAMCSACEMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQS  423

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCG++S+MP V+FSIGG+ FDL+P +YI K+GEG  +QC SGFTA+D+ PPRGPLWIL
Sbjct  424  AVDCGRVSSMPIVTFSIGGRSFDLTPQDYIFKIGEGVESQCTSGFTAMDIAPPRGPLWIL  483

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  484  GDIFMGPYHTVFDYGKGRVGFAKAA  508



>ref|XP_006396692.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
 gb|ESQ38145.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
Length=507

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV S+ECKAVV  YG+ M++ L+ +  P+K+CSQIGLC ++G   VSMGI
Sbjct  305  TMINHAIGAVGVASQECKAVVGQYGKTMLNSLLSQTDPRKVCSQIGLCGYDGAHSVSMGI  364

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
             SV++  NG S  L++AMC+ACEM  VWMQ++L++NQTQE ILSY  ELC+ +P+P  +S
Sbjct  365  RSVIE--NGTSDLLNEAMCNACEMAAVWMQSELTQNQTQERILSYAAELCDHIPNPNQQS  422

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             V+C K+S+MP V+F+IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWIL
Sbjct  423  AVNCEKVSSMPIVTFTIGGKSFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWIL  482

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  483  GDIFMGPYHTVFDYGKARVGFAKAA  507



>ref|XP_006396693.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
 gb|ESQ38146.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
Length=512

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA GV S+ECKAVV  YG+ M++ L+ +  P+K+CSQIGLC ++G   VSMGI
Sbjct  310  TMINHAIGAVGVASQECKAVVGQYGKTMLNSLLSQTDPRKVCSQIGLCGYDGAHSVSMGI  369

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
             SV++  NG S  L++AMC+ACEM  VWMQ++L++NQTQE ILSY  ELC+ +P+P  +S
Sbjct  370  RSVIE--NGTSDLLNEAMCNACEMAAVWMQSELTQNQTQERILSYAAELCDHIPNPNQQS  427

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             V+C K+S+MP V+F+IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWIL
Sbjct  428  AVNCEKVSSMPIVTFTIGGKSFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWIL  487

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  488  GDIFMGPYHTVFDYGKARVGFAKAA  512



>gb|KDO45252.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=295

 Score =   283 bits (724),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIG +GVVS ECK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI
Sbjct  93   TEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGI  152

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ++VV+++N  + D   A+CSACEM VVW+QNQL + QT+E +LSY+NELC+ LP+PMGES
Sbjct  153  KTVVEKENVSAGD--SAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGES  210

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             +DC ++ TMP+VSF+IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWIL
Sbjct  211  IIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWIL  270

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG YHTVFD GK+R+GFAEAA
Sbjct  271  GDVFMGVYHTVFDSGKLRIGFAEAA  295



>sp|P40782.2|CYPR1_CYNCA RecName: Full=Cyprosin; Flags: Precursor, partial [Cynara cardunculus]
 prf||2124255A cyprosin
Length=473

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 169/205 (82%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN AIGA GV+S++CK++V+ YG+ MI++L+ E +P+KICSQ+ LC+F+G+   SM I
Sbjct  270  TQINQAIGAAGVMSQQCKSLVDQYGKSMIEMLLSEEQPEKICSQMKLCSFDGSHDTSMII  329

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD+  G S+ L    C  C   VVWMQNQ+ +N+T+ENI++YV++LC RLPSPMGES
Sbjct  330  ESVVDKSKGKSSGL-PMRCVPCARWVVWMQNQIRQNETEENIINYVDKLCERLPSPMGES  388

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC  LS+MP+++F++GGK F+LSP +Y+LKVGEG+ AQCISGFTA+DV PP GPLWIL
Sbjct  389  AVDCSSLSSMPNIAFTVGGKTFNLSPEQYVLKVGEGATAQCISGFTAMDVAPPHGPLWIL  448

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG+YHTVFDYG +RVGFAEAA
Sbjct  449  GDVFMGQYHTVFDYGNLRVGFAEAA  473



>ref|XP_010233477.1| PREDICTED: aspartic proteinase oryzasin-1-like [Brachypodium 
distachyon]
Length=516

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 166/206 (81%), Gaps = 6/206 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECKAVV  YG++++DLL      KKICS +GLCTF+G  GVS GI
Sbjct  316  TQINKKIGATGVVSQECKAVVSQYGKQILDLL-----RKKICSSVGLCTFDGAHGVSAGI  370

Query  597  ESVVDEKNGVSADLHDAM-CSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVD+K   S D+   + C+ CEM VVWMQ+QL++NQTQE +L Y+N+LC+  PSPMGE
Sbjct  371  QSVVDDKVWGSNDIFSKVTCNMCEMAVVWMQHQLAQNQTQEFVLQYINQLCDSFPSPMGE  430

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +L++MP ++FSIGGK F L+P +YILKVGEG A QCISGFTA+D+PPPRGPLWI
Sbjct  431  SSVDCNRLASMPDIAFSIGGKQFVLTPEQYILKVGEGVATQCISGFTAVDIPPPRGPLWI  490

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMG YHTVFDYG ++VGFAEAA
Sbjct  491  LGDIFMGAYHTVFDYGNLKVGFAEAA  516



>gb|EMS54428.1| Aspartic proteinase oryzasin-1 [Triticum urartu]
Length=503

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 166/215 (77%), Gaps = 13/215 (6%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN  IGA GVVS+ECKAVV  YGQR++DLL+ E  P KICS +GLCT +G +GV  GI
Sbjct  292  TQINEKIGAPGVVSQECKAVVSQYGQRILDLLLKEMDPSKICSLVGLCTPDGTQGVRAGI  351

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNE----------LC  448
             SV+D + G S   +D MC ACEM VVWM NQL++NQTQ+ I  Y+N+          LC
Sbjct  352  RSVLDHEGGRS---NDVMCHACEMAVVWMTNQLAKNQTQDLIFKYINQACFLVYLVTPLC  408

Query  447  NRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDV  268
            +R+PSPMGES VDCG+L++MP ++FSIGGK F L+P +YILK+GEG A QCISGFTA+D+
Sbjct  409  DRIPSPMGESSVDCGRLASMPDIAFSIGGKQFVLTPEQYILKIGEGDATQCISGFTAMDI  468

Query  267  PPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            P PRGPLWILGD+FMG YHTV+DYG M++GFA+AA
Sbjct  469  PRPRGPLWILGDIFMGAYHTVYDYGNMKIGFAKAA  503



>ref|XP_006428329.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
 ref|XP_006480355.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|ESR41569.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
Length=506

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 164/205 (80%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIG +GVVS ECK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI
Sbjct  304  TEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGI  363

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ++VV+++N  + D   A+CSACEMTVVW+QNQL + QT+E +LSY+NELC+ LP+PMGES
Sbjct  364  KTVVEKENVSAGD--SAVCSACEMTVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGES  421

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             +DCG++ TMP+VSF+IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWIL
Sbjct  422  IIDCGRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWIL  481

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG YHTVFD GK+R+GFAEAA
Sbjct  482  GDVFMGVYHTVFDSGKLRIGFAEAA  506



>gb|KDO45249.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=412

 Score =   284 bits (727),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIG +GVVS ECK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI
Sbjct  210  TEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGI  269

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ++VV+++N  + D   A+CSACEM VVW+QNQL + QT+E +LSY+NELC+ LP+PMGES
Sbjct  270  KTVVEKENVSAGD--SAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGES  327

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             +DC ++ TMP+VSF+IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWIL
Sbjct  328  IIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWIL  387

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG YHTVFD GK+R+GFAEAA
Sbjct  388  GDVFMGVYHTVFDSGKLRIGFAEAA  412



>gb|KDO45250.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
 gb|KDO45251.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=388

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIG +GVVS ECK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI
Sbjct  186  TEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGI  245

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ++VV+++N  + D   A+CSACEM VVW+QNQL + QT+E +LSY+NELC+ LP+PMGES
Sbjct  246  KTVVEKENVSAGD--SAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGES  303

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             +DC ++ TMP+VSF+IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWIL
Sbjct  304  IIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWIL  363

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG YHTVFD GK+R+GFAEAA
Sbjct  364  GDVFMGVYHTVFDSGKLRIGFAEAA  388



>gb|ABK26865.1| unknown [Picea sitchensis]
Length=284

 Score =   279 bits (714),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 167/207 (81%), Gaps = 4/207 (2%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN+AIGA G+VS+ECK VV  YG  +++LL+ +  PKKICSQIGLC+++G R V +GI
Sbjct  78   TQINNAIGASGIVSQECKTVVSQYGDVIMELLMAQTNPKKICSQIGLCSYDGARDVGIGI  137

Query  597  ESVVD---EKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPM  427
             SV++   EK  +S+ + D  C+ACEM VVW+QNQ++ NQT+E I++Y+N+LC+RLPSP 
Sbjct  138  ASVLEKTHEKETLSS-ISDGTCTACEMAVVWVQNQIARNQTKEQIMTYLNQLCDRLPSPN  196

Query  426  GESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPL  247
            GES VDC ++S+MP+VSFSIG K F L+P++YIL+VGEGS AQC+SGF  LDV PP GP+
Sbjct  197  GESVVDCDQVSSMPTVSFSIGNKTFSLTPDQYILQVGEGSVAQCVSGFMGLDVSPPLGPI  256

Query  246  WILGDVFMGRYHTVFDYGKMRVGFAEA  166
            WILGD+FMG YHTVFDYG  RVGFAEA
Sbjct  257  WILGDIFMGVYHTVFDYGNSRVGFAEA  283



>gb|AFX73041.1| preprofigain B, partial [Ficus carica]
Length=385

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
             MIN AIGA GVVS+ECKAVV+ YGQ ++DLL+ +  PKK+CSQIGLCTF+G RGVS+ I
Sbjct  201  AMINRAIGASGVVSQECKAVVQQYGQNILDLLMAQVHPKKVCSQIGLCTFDGTRGVSIRI  260

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ES+VDE NG S  L DAMCSACEM VVWMQNQL++NQTQE IL Y NELC+R+PSPMGES
Sbjct  261  ESMVDENNGKSGILRDAMCSACEMAVVWMQNQLTQNQTQERILDYANELCDRMPSPMGES  320

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCG+LS+MP V+F+IGGK FDLSP EYILKVGEG+ AQCISGFT LDVPPPRGPLWIL
Sbjct  321  SVDCGRLSSMPKVAFTIGGKTFDLSPEEYILKVGEGAQAQCISGFTGLDVPPPRGPLWIL  380

Query  237  GDVFM  223
            GDV M
Sbjct  381  GDVLM  385



>ref|XP_010926196.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
Length=518

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 165/204 (81%), Gaps = 3/204 (1%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            +N  IGA GVVS++CKAVV  YG++++++L+ +  P KICS+IGLC F+G  GVSMGI+S
Sbjct  315  VNQKIGAAGVVSQQCKAVVSQYGEKIMEMLMEKEEPTKICSRIGLCAFDGTHGVSMGIKS  374

Query  591  VVD-EKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV+  ++  +  L D MCS CEM VVWMQNQ  ++QT + +L Y++ELC RLPSPMGES 
Sbjct  375  VVNGRRDRFTGGLGDGMCSYCEMAVVWMQNQFMQSQTVQQVLDYISELCERLPSPMGESA  434

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILG  235
            VDC  L++MP VSF+IGGK FDL P +YILKVG+GS AQCISGFTALDV  P+GPLWILG
Sbjct  435  VDCSSLASMPVVSFTIGGKRFDLKPEQYILKVGDGSLAQCISGFTALDV--PQGPLWILG  492

Query  234  DVFMGRYHTVFDYGKMRVGFAEAA  163
            DVFMG YHTVFDYG++RVGFAEAA
Sbjct  493  DVFMGVYHTVFDYGQLRVGFAEAA  516



>ref|XP_010455729.1| PREDICTED: aspartic proteinase A3 isoform X2 [Camelina sativa]
Length=504

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 165/205 (80%), Gaps = 6/205 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +    K+CSQIG+C F+G   VSMGI
Sbjct  306  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQ----KVCSQIGVCAFDGTDSVSMGI  361

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVD+  G S  L+ AMCSAC+M  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S
Sbjct  362  QSVVDD--GASGLLNQAMCSACQMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQS  419

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC K+S+MP VSF+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWIL
Sbjct  420  AVDCEKVSSMPIVSFTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWIL  479

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  480  GDIFMGPYHTVFDYGKARVGFAKAA  504



>gb|KDO45247.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=506

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIG +GVVS ECK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI
Sbjct  304  TEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGI  363

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ++VV+++N  + D   A+CSACEM VVW+QNQL + QT+E +LSY+NELC+ LP+PMGES
Sbjct  364  KTVVEKENVSAGD--SAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGES  421

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             +DC ++ TMP+VSF+IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWIL
Sbjct  422  IIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWIL  481

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG YHTVFD GK+R+GFAEAA
Sbjct  482  GDVFMGVYHTVFDSGKLRIGFAEAA  506



>gb|KDO62072.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=492

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T +NHAIGA G+VS+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGI
Sbjct  309  TQVNHAIGATGIVSQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGI  368

Query  597  ESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVV E N   S   HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGE
Sbjct  369  ESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGE  428

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC +LS++P VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLW 
Sbjct  429  SAVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWY  488

Query  240  L  238
            +
Sbjct  489  V  489



>gb|AAK55849.1|AF266465_1 aspartic protease [Manihot esculenta]
Length=159

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -2

Query  636  CTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYV  460
            CTF+G+RGVSM IESVV+E +  V+  LHDAMCS CEM V+WMQNQL +N T E IL+Y 
Sbjct  1    CTFDGSRGVSMTIESVVNENSQEVAGSLHDAMCSTCEMAVIWMQNQLKQNATLERILNYA  60

Query  459  NELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFT  280
            NELC RLPSPMGES VDCG LSTMP+VSF+IGGKVFDLSP +Y+LKVGEG AAQCISGFT
Sbjct  61   NELCERLPSPMGESAVDCGSLSTMPNVSFTIGGKVFDLSPEQYVLKVGEGEAAQCISGFT  120

Query  279  ALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            ALDVPPPRGPLWILGDVFMGR+HTVFDYG +RVGFAEAA
Sbjct  121  ALDVPPPRGPLWILGDVFMGRFHTVFDYGNLRVGFAEAA  159



>gb|KDO45246.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=509

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 162/205 (79%), Gaps = 2/205 (1%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIG +GVVS ECK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI
Sbjct  307  TEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGI  366

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ++VV+++N  + D   A+CSACEM VVW+QNQL + QT+E +LSY+NELC+ LP+PMGES
Sbjct  367  KTVVEKENVSAGD--SAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGES  424

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             +DC ++ TMP+VSF+IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWIL
Sbjct  425  IIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWIL  484

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG YHTVFD GK+R+GFAEAA
Sbjct  485  GDVFMGVYHTVFDSGKLRIGFAEAA  509



>ref|XP_010432806.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Camelina sativa]
Length=504

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 165/205 (80%), Gaps = 6/205 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +    K+CSQIG+C F+G   VSMGI
Sbjct  306  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQ----KVCSQIGVCAFDGTDSVSMGI  361

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVD+  G S  L+ AMCSAC+M  VWM+++L++N+TQE IL+Y  ELC+ +P+   +S
Sbjct  362  QSVVDD--GASGLLNQAMCSACQMAAVWMESELTQNKTQERILAYAAELCDHIPTQNQQS  419

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDC K+S+MP VSF+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWIL
Sbjct  420  AVDCEKVSSMPIVSFTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWIL  479

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  480  GDIFMGPYHTVFDYGKARVGFAKAA  504



>ref|XP_006286432.1| hypothetical protein CARUB_v10003637mg [Capsella rubella]
 gb|EOA19330.1| hypothetical protein CARUB_v10003637mg [Capsella rubella]
Length=503

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 166/205 (81%), Gaps = 7/205 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +    K+CSQIG+C ++G   VSMGI
Sbjct  306  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQ----KVCSQIGVCAYDGTHSVSMGI  361

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            ESVVD+ +G+   L+ AMCSACEM  VWM+++L++N+TQE IL+Y  ELC+ +P+   +S
Sbjct  362  ESVVDDASGL---LNQAMCSACEMAAVWMESELTQNKTQERILAYAAELCDHIPTQNQQS  418

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             V+C K+S+MP VSF+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWIL
Sbjct  419  AVNCEKVSSMPIVSFTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWIL  478

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  479  GDIFMGPYHTVFDYGKARVGFAKAA  503



>ref|NP_001190671.1| aspartic proteinase A3 [Arabidopsis thaliana]
 gb|AEE82391.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=504

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 167/205 (81%), Gaps = 6/205 (3%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            TMINHAIGA G+VS+ECKAVV+ YG+ M++ L+ +    K+CSQIG+C ++G + VSMGI
Sbjct  306  TMINHAIGAQGIVSRECKAVVDQYGKTMLNSLLAQ----KVCSQIGVCAYDGTQSVSMGI  361

Query  597  ESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGES  418
            +SVVD+  G S  L+ AMCSACEM  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S
Sbjct  362  QSVVDD--GTSGLLNQAMCSACEMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQS  419

Query  417  GVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  238
             VDCG++S+MP V+FSIGG+ FDL+P +YI K+GEG  +QC SGFTA+D+ PPRGPLWIL
Sbjct  420  AVDCGRVSSMPIVTFSIGGRSFDLTPQDYIFKIGEGVESQCTSGFTAMDIAPPRGPLWIL  479

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GD+FMG YHTVFDYGK RVGFA+AA
Sbjct  480  GDIFMGPYHTVFDYGKGRVGFAKAA  504



>gb|EMT17680.1| Phytepsin [Aegilops tauschii]
Length=446

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 166/233 (71%), Gaps = 29/233 (12%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGV----  610
            T IN  IGA GVVS+ECK +V  YGQ+++DLL+ E +PKK+CSQ+   T+N  +      
Sbjct  215  TEINEKIGAAGVVSQECKTIVSQYGQQILDLLLAETQPKKVCSQL-TDTWNIPKAFFHYA  273

Query  609  -----------------------SMGIESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQ  502
                                   S GI SVVD++   S  L  D MCSACEM VVWMQNQ
Sbjct  274  VIAARIVLLTSMAHFPIVHLCEHSAGIRSVVDDEPVKSNGLRTDPMCSACEMAVVWMQNQ  333

Query  501  LSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILK  322
            L++N+TQ+ IL YVN+LCNRLPSPMGES VDC  L +MP + F+IGGK F L P EYILK
Sbjct  334  LAQNKTQDLILDYVNQLCNRLPSPMGESAVDCASLGSMPDIEFTIGGKKFALKPEEYILK  393

Query  321  VGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  163
            VGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFA+AA
Sbjct  394  VGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRVGFAKAA  446



>ref|XP_008800325.1| PREDICTED: aspartic proteinase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008800326.1| PREDICTED: aspartic proteinase-like isoform X1 [Phoenix dactylifera]
Length=507

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA+GVVS ECK VV+ YG+ +++LLV + RP K+CS+IGLC F+G R V  GI
Sbjct  302  TQINHAIGAEGVVSMECKEVVKQYGELILELLVAQTRPDKVCSKIGLCIFDGARYVGTGI  361

Query  597  ESVVDEKNGVSADL-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVD++    + L  D +C+ACEM VVW++NQL EN+T+E IL+Y NELC RLPSP GE
Sbjct  362  DSVVDKQKEEDSSLNQDVLCTACEMAVVWIENQLRENKTKERILAYANELCERLPSPSGE  421

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V C ++++MP++SF+I  KVF L+P EY+LKV +G  + CISGF A DVPPPRGPLWI
Sbjct  422  STVSCDQIASMPNISFTIAEKVFSLTPEEYVLKVEQGYTSVCISGFMAFDVPPPRGPLWI  481

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG YHTVFD+G  R+GFA+A
Sbjct  482  LGDVFMGAYHTVFDFGNKRIGFAKA  506



>ref|XP_008800328.1| PREDICTED: aspartic proteinase-like isoform X2 [Phoenix dactylifera]
Length=507

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T INHAIGA+GVVS ECK VV+ YG+ +++LLV + RP K+CS+IGLC F+G R V  GI
Sbjct  302  TQINHAIGAEGVVSMECKEVVKQYGELILELLVAQTRPDKVCSKIGLCIFDGARYVGTGI  361

Query  597  ESVVDEKNGVSADL-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            +SVVD++    + L  D +C+ACEM VVW++NQL EN+T+E IL+Y NELC RLPSP GE
Sbjct  362  DSVVDKQKEEDSSLNQDVLCTACEMAVVWIENQLRENKTKERILAYANELCERLPSPSGE  421

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S V C ++++MP++SF+I  KVF L+P EY+LKV +G  + CISGF A DVPPPRGPLWI
Sbjct  422  STVSCDQIASMPNISFTIAEKVFSLTPEEYVLKVEQGYTSVCISGFMAFDVPPPRGPLWI  481

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEA  166
            LGDVFMG YHTVFD+G  R+GFA+A
Sbjct  482  LGDVFMGAYHTVFDFGNKRIGFAKA  506



>gb|AGE15495.1| preprosilpepsin 2 [Silybum marianum]
Length=509

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = -2

Query  777  TMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGI  598
            T IN AIGA+ V++++CK +V  YG+ ++ +L+ EA+P KICS + LCTF+G   VS  I
Sbjct  304  TQINQAIGANRVMNQQCKTLVSRYGKNIMQMLMSEAQPDKICSHMNLCTFDGAHDVSSII  363

Query  597  ESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  421
            ESVVD KN  S+  +HD MC+ CEM VVWMQ ++  N+ ++NI++YV ELC+ LPS  GE
Sbjct  364  ESVVDMKNDKSSGGVHDEMCTFCEMAVVWMQKEIKRNEIEDNIINYVTELCDHLPSSSGE  423

Query  420  SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  241
            S VDC  LS+MP+ +F+IGGK+F+L+P +YI K+GEG AAQCISGFT +DVPPPRGPLWI
Sbjct  424  SVVDCNSLSSMPNTAFTIGGKIFELTPEQYIFKLGEGEAAQCISGFTTMDVPPPRGPLWI  483

Query  240  LGDVFMGRYHTVFDYGKMRVGFAEAA  163
            LGD+FMG YHTVFDYGK+RVGFAEAA
Sbjct  484  LGDIFMGPYHTVFDYGKLRVGFAEAA  509



>ref|XP_010916100.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
 ref|XP_010916101.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
 ref|XP_010916102.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
Length=518

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 167/205 (81%), Gaps = 4/205 (2%)
 Frame = -2

Query  771  INHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIES  592
            +N  IGA GVVS++CKA+V  YG++++++L+ +  P KICS++GLC F+G  GVSMGI+S
Sbjct  313  VNQKIGAAGVVSQQCKAMVSQYGEKIMEMLMEKEEPAKICSRVGLCAFDGTHGVSMGIKS  372

Query  591  VVD-EKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESG  415
            VV+ +++G +  L + MC+ CEM VVWMQNQL +NQT E +L+Y+N+LC RLPSP GES 
Sbjct  373  VVNGKRDGSTGGLGNGMCTYCEMAVVWMQNQLVQNQTLEQVLNYINQLCERLPSPTGESA  432

Query  414  VDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAA-QCISGFTALDVPPPRGPLWIL  238
            VDC  L +MP+VSF+IGGK FDL P +YILKV  GS+A QCISGFTALDV  P+GPLWIL
Sbjct  433  VDCDSLPSMPTVSFTIGGKRFDLKPEQYILKVDVGSSATQCISGFTALDV--PQGPLWIL  490

Query  237  GDVFMGRYHTVFDYGKMRVGFAEAA  163
            GDVFMG YHTVFDYGK+RVGFAEAA
Sbjct  491  GDVFMGAYHTVFDYGKLRVGFAEAA  515



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730