BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003H08

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610364.1|  PREDICTED: uncharacterized protein LOC104104077    270   6e-88   Nicotiana tomentosiformis
ref|XP_009795967.1|  PREDICTED: uncharacterized protein LOC104242589    266   8e-87   Nicotiana sylvestris
emb|CDP10783.1|  unnamed protein product                                248   3e-79   Coffea canephora [robusta coffee]
ref|XP_004251523.1|  PREDICTED: uncharacterized protein LOC101250189    241   1e-76   Solanum lycopersicum
ref|XP_006351969.1|  PREDICTED: B-cell receptor-associated protei...    240   2e-76   Solanum tuberosum [potatoes]
ref|XP_010549208.1|  PREDICTED: B-cell receptor-associated protei...    233   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_003605958.1|  hypothetical protein MTR_4g049540                  232   4e-73   Medicago truncatula
gb|AFK33681.1|  unknown                                                 231   7e-73   Medicago truncatula
gb|ACJ84514.1|  unknown                                                 229   4e-72   Medicago truncatula
gb|KHN41234.1|  hypothetical protein glysoja_017278                     229   5e-72   Glycine soja [wild soybean]
ref|NP_001239654.1|  uncharacterized protein LOC100798727               228   6e-72   Glycine max [soybeans]
ref|XP_010252455.1|  PREDICTED: uncharacterized protein LOC104594039    228   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010244479.1|  PREDICTED: B-cell receptor-associated protei...    227   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010689493.1|  PREDICTED: B-cell receptor-associated protei...    226   8e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002270301.1|  PREDICTED: B-cell receptor-associated protei...    224   3e-70   Vitis vinifera
ref|XP_003539858.1|  PREDICTED: B-cell receptor-associated protei...    224   4e-70   
ref|XP_006403381.1|  hypothetical protein EUTSA_v10003268mg             224   6e-70   Eutrema salsugineum [saltwater cress]
gb|KHN21219.1|  hypothetical protein glysoja_006698                     224   6e-70   Glycine soja [wild soybean]
ref|XP_004506274.1|  PREDICTED: B-cell receptor-associated protei...    223   1e-69   Cicer arietinum [garbanzo]
ref|XP_009123682.1|  PREDICTED: uncharacterized protein LOC103848551    220   1e-68   Brassica rapa
emb|CBI23212.3|  unnamed protein product                                220   1e-68   Vitis vinifera
ref|XP_002262807.2|  PREDICTED: B-cell receptor-associated protei...    221   2e-68   
ref|XP_007132530.1|  hypothetical protein PHAVU_011G102200g             219   2e-68   Phaseolus vulgaris [French bean]
ref|XP_006281077.1|  hypothetical protein CARUB_v10027105mg             218   9e-68   Capsella rubella
ref|NP_568607.1|  B-cell receptor-associated 31-like protein            218   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863762.1|  hypothetical protein ARALYDRAFT_494776             218   1e-67   Arabidopsis lyrata subsp. lyrata
gb|AAM62748.1|  unknown                                                 218   2e-67   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09328.1|  unnamed protein product                                218   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540294.1|  PREDICTED: B-cell receptor-associated protei...    217   2e-67   Glycine max [soybeans]
ref|XP_006447584.1|  hypothetical protein CICLE_v10016648mg             217   2e-67   Citrus clementina [clementine]
ref|XP_010494193.1|  PREDICTED: B-cell receptor-associated protei...    216   4e-67   Camelina sativa [gold-of-pleasure]
emb|CDY68895.1|  BnaCnng60970D                                          216   6e-67   Brassica napus [oilseed rape]
gb|KFK32917.1|  hypothetical protein AALP_AA6G305900                    216   9e-67   Arabis alpina [alpine rockcress]
ref|XP_009587048.1|  PREDICTED: B-cell receptor-associated protei...    214   2e-66   Nicotiana tomentosiformis
ref|XP_007149980.1|  hypothetical protein PHAVU_005G115800g             214   3e-66   Phaseolus vulgaris [French bean]
ref|XP_010481979.1|  PREDICTED: B-cell receptor-associated protei...    213   6e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010442176.1|  PREDICTED: B-cell receptor-associated protei...    212   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_003543392.1|  PREDICTED: B-cell receptor-associated protei...    211   4e-65   Glycine max [soybeans]
ref|XP_002524828.1|  bcr-associated protein, bap, putative              208   5e-64   
ref|XP_006449764.1|  hypothetical protein CICLE_v10016599mg             208   6e-64   
ref|XP_007026129.1|  B-cell receptor-associated 31-like                 208   7e-64   
ref|XP_010046363.1|  PREDICTED: B-cell receptor-associated protei...    207   1e-63   Eucalyptus grandis [rose gum]
ref|XP_006383887.1|  hypothetical protein POPTR_0004s00930g             206   6e-63   Populus trichocarpa [western balsam poplar]
ref|XP_011046959.1|  PREDICTED: B-cell receptor-associated protei...    204   2e-62   Populus euphratica
ref|XP_009629450.1|  PREDICTED: uncharacterized protein LOC104119606    204   2e-62   Nicotiana tomentosiformis
gb|KDO78297.1|  hypothetical protein CISIN_1g021727mg                   204   3e-62   Citrus sinensis [apfelsine]
ref|XP_006467408.1|  PREDICTED: B-cell receptor-associated protei...    203   5e-62   
ref|XP_006389583.1|  hypothetical protein POPTR_0021s00340g             203   8e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006467407.1|  PREDICTED: B-cell receptor-associated protei...    203   1e-61   Citrus sinensis [apfelsine]
ref|XP_009797812.1|  PREDICTED: uncharacterized protein LOC104244159    202   1e-61   Nicotiana sylvestris
ref|XP_011096040.1|  PREDICTED: B-cell receptor-associated protei...    202   1e-61   Sesamum indicum [beniseed]
gb|KDO78296.1|  hypothetical protein CISIN_1g021727mg                   204   2e-61   Citrus sinensis [apfelsine]
gb|KJB68573.1|  hypothetical protein B456_010G251300                    201   7e-61   Gossypium raimondii
ref|XP_011008025.1|  PREDICTED: uncharacterized protein LOC105113519    200   8e-61   Populus euphratica
gb|KDP20721.1|  hypothetical protein JCGZ_21192                         199   2e-60   Jatropha curcas
ref|XP_010099186.1|  B-cell receptor-associated protein 31              199   3e-60   
ref|XP_004231615.1|  PREDICTED: B-cell receptor-associated protei...    199   3e-60   Solanum lycopersicum
ref|XP_007046390.1|  B-cell receptor-associated 31-like                 199   3e-60   Theobroma cacao [chocolate]
gb|KHG10853.1|  B-cell receptor-associated 31                           197   2e-59   Gossypium arboreum [tree cotton]
ref|XP_004233786.1|  PREDICTED: uncharacterized protein LOC101255462    196   4e-59   Solanum lycopersicum
gb|KHG15358.1|  B-cell receptor-associated 31                           196   7e-59   Gossypium arboreum [tree cotton]
ref|XP_006348141.1|  PREDICTED: B-cell receptor-associated protei...    196   7e-59   Solanum tuberosum [potatoes]
gb|KJB69262.1|  hypothetical protein B456_011G013000                    195   7e-59   Gossypium raimondii
gb|AFK47348.1|  unknown                                                 195   9e-59   Lotus japonicus
ref|XP_003534595.1|  PREDICTED: B-cell receptor-associated protei...    195   9e-59   Glycine max [soybeans]
gb|ACU14586.1|  unknown                                                 195   1e-58   Glycine max [soybeans]
gb|KFK40615.1|  hypothetical protein AALP_AA2G019200                    194   1e-58   Arabis alpina [alpine rockcress]
gb|EYU27763.1|  hypothetical protein MIMGU_mgv1a012919mg                194   2e-58   Erythranthe guttata [common monkey flower]
gb|ACU19065.1|  unknown                                                 193   2e-58   Glycine max [soybeans]
ref|XP_008440020.1|  PREDICTED: B-cell receptor-associated protei...    194   3e-58   Cucumis melo [Oriental melon]
ref|XP_004151895.1|  PREDICTED: uncharacterized protein LOC101218101    193   3e-58   Cucumis sativus [cucumbers]
gb|KEH36901.1|  B-cell receptor-associated-like protein                 194   4e-58   Medicago truncatula
ref|XP_006350475.1|  PREDICTED: B-cell receptor-associated protei...    194   4e-58   Solanum tuberosum [potatoes]
gb|AFK46642.1|  unknown                                                 193   5e-58   Medicago truncatula
ref|XP_004158560.1|  PREDICTED: uncharacterized LOC101218101            192   9e-58   
ref|NP_001236308.1|  uncharacterized protein LOC100526943               191   2e-57   Glycine max [soybeans]
ref|XP_008224696.1|  PREDICTED: B-cell receptor-associated protei...    191   3e-57   Prunus mume [ume]
ref|XP_002518447.1|  bcr-associated protein, bap, putative              191   3e-57   Ricinus communis
ref|XP_004486174.1|  PREDICTED: B-cell receptor-associated protei...    190   9e-57   
ref|XP_007212007.1|  hypothetical protein PRUPE_ppa011145mg             189   2e-56   Prunus persica
ref|XP_004134773.1|  PREDICTED: uncharacterized protein LOC101221743    189   3e-56   Cucumis sativus [cucumbers]
ref|XP_008229967.1|  PREDICTED: B-cell receptor-associated protei...    188   7e-56   Prunus mume [ume]
ref|XP_007215939.1|  hypothetical protein PRUPE_ppa011161mg             187   1e-55   Prunus persica
emb|CDP04423.1|  unnamed protein product                                187   1e-55   Coffea canephora [robusta coffee]
ref|XP_010458605.1|  PREDICTED: uncharacterized protein LOC104739838    187   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010493468.1|  PREDICTED: uncharacterized protein LOC104770706    187   2e-55   Camelina sativa [gold-of-pleasure]
gb|KFK35240.1|  hypothetical protein AALP_AA5G258500                    186   3e-55   Arabis alpina [alpine rockcress]
ref|XP_010476134.1|  PREDICTED: uncharacterized protein LOC104755448    185   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_008784370.1|  PREDICTED: B-cell receptor-associated protei...    185   8e-55   Phoenix dactylifera
ref|XP_010686812.1|  PREDICTED: B-cell receptor-associated protei...    184   2e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002889902.1|  hypothetical protein ARALYDRAFT_334480             184   2e-54   
ref|XP_006417293.1|  hypothetical protein EUTSA_v10008726mg             184   2e-54   Eutrema salsugineum [saltwater cress]
ref|XP_004293309.1|  PREDICTED: B-cell receptor-associated protei...    183   5e-54   Fragaria vesca subsp. vesca
ref|XP_008342021.1|  PREDICTED: B-cell receptor-associated protei...    183   6e-54   
gb|KHN44866.1|  hypothetical protein glysoja_040795                     182   6e-54   Glycine soja [wild soybean]
ref|NP_849648.4|  B-cell receptor-associated protein 31-like protein    182   7e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348138.1|  PREDICTED: B-cell receptor-associated protei...    182   8e-54   
emb|CDY34821.1|  BnaA09g47470D                                          182   2e-53   Brassica napus [oilseed rape]
ref|XP_009353295.1|  PREDICTED: B-cell receptor-associated protei...    181   5e-53   Pyrus x bretschneideri [bai li]
ref|XP_009118164.1|  PREDICTED: uncharacterized protein LOC103843216    180   7e-53   Brassica rapa
ref|XP_009347127.1|  PREDICTED: B-cell receptor-associated protei...    179   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_003596956.1|  hypothetical protein MTR_2g088060                  177   6e-52   Medicago truncatula
ref|XP_010533802.1|  PREDICTED: uncharacterized protein LOC104809492    176   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_009419329.1|  PREDICTED: B-cell receptor-associated protei...    176   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403539.1|  PREDICTED: uncharacterized protein LOC103987073    175   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007147709.1|  hypothetical protein PHAVU_006G148100g             174   1e-50   Phaseolus vulgaris [French bean]
gb|KHN36526.1|  ATP-dependent helicase rhp16                            186   1e-50   Glycine soja [wild soybean]
ref|XP_002320470.1|  hypothetical protein POPTR_0014s15290g             174   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_008780367.1|  PREDICTED: uncharacterized protein LOC103700158    174   2e-50   Phoenix dactylifera
ref|XP_011047243.1|  PREDICTED: B-cell receptor-associated protei...    173   3e-50   Populus euphratica
ref|XP_009390004.1|  PREDICTED: B-cell receptor-associated protei...    173   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010546686.1|  PREDICTED: uncharacterized protein LOC104818690    172   8e-50   Tarenaya hassleriana [spider flower]
ref|XP_008649481.1|  PREDICTED: uncharacterized protein LOC103630179    169   9e-49   Zea mays [maize]
ref|XP_006303826.1|  hypothetical protein CARUB_v10012392mg             169   1e-48   Capsella rubella
ref|XP_010926189.1|  PREDICTED: uncharacterized protein LOC105048548    168   2e-48   Elaeis guineensis
emb|CDY34616.1|  BnaC08g41750D                                          167   7e-48   Brassica napus [oilseed rape]
ref|XP_010916117.1|  PREDICTED: uncharacterized protein LOC105041025    166   1e-47   
ref|XP_010089483.1|  hypothetical protein L484_011937                   167   1e-47   
ref|XP_011086195.1|  PREDICTED: B-cell receptor-associated protei...    166   2e-47   Sesamum indicum [beniseed]
ref|NP_001055067.1|  Os05g0272900                                       166   3e-47   
ref|XP_006654198.1|  PREDICTED: B-cell receptor-associated protei...    165   5e-47   Oryza brachyantha
ref|XP_006647215.1|  PREDICTED: B-cell receptor-associated protei...    165   7e-47   Oryza brachyantha
gb|EMT11422.1|  hypothetical protein F775_31561                         164   7e-47   
dbj|BAK02060.1|  predicted protein                                      164   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004287957.1|  PREDICTED: B-cell receptor-associated protei...    163   3e-46   Fragaria vesca subsp. vesca
ref|NP_001046689.1|  Os02g0321800                                       163   4e-46   
ref|XP_008384089.1|  PREDICTED: B-cell receptor-associated protei...    162   9e-46   
ref|XP_010234160.1|  PREDICTED: uncharacterized protein LOC100839925    161   1e-45   Brachypodium distachyon [annual false brome]
gb|EAY85610.1|  hypothetical protein OsI_06982                          160   2e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_010057913.1|  PREDICTED: B-cell receptor-associated protei...    160   4e-45   Eucalyptus grandis [rose gum]
ref|NP_001170289.1|  LOC100384252                                       160   5e-45   Zea mays [maize]
ref|XP_009357471.1|  PREDICTED: uncharacterized protein LOC103948199    159   9e-45   Pyrus x bretschneideri [bai li]
ref|XP_009358864.1|  PREDICTED: B-cell receptor-associated protei...    157   5e-44   Pyrus x bretschneideri [bai li]
ref|XP_003580219.1|  PREDICTED: B-cell receptor-associated protei...    156   9e-44   Brachypodium distachyon [annual false brome]
ref|XP_004952370.1|  PREDICTED: B-cell receptor-associated protei...    155   3e-43   Setaria italica
ref|NP_001154328.1|  B-cell receptor-associated protein 31-like p...    155   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371075.1|  PREDICTED: B-cell receptor-associated protei...    155   4e-43   
ref|NP_001057612.2|  Os06g0367500                                       153   1e-42   
ref|XP_006847259.1|  hypothetical protein AMTR_s00015p00062110          152   5e-42   
dbj|BAJ86435.1|  predicted protein                                      149   6e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE75913.1|  unknown                                                 143   2e-38   Picea sitchensis
gb|KHG00718.1|  separin                                                 140   4e-38   Gossypium arboreum [tree cotton]
ref|XP_003563854.1|  PREDICTED: B-cell receptor-associated protei...    141   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_002453641.1|  hypothetical protein SORBIDRAFT_04g009770          140   2e-37   Sorghum bicolor [broomcorn]
ref|XP_007215894.1|  hypothetical protein PRUPE_ppa010667mg             137   4e-36   Prunus persica
ref|XP_006650891.1|  PREDICTED: B-cell receptor-associated protei...    135   1e-35   Oryza brachyantha
ref|XP_008229970.1|  PREDICTED: B-cell receptor-associated protei...    136   1e-35   Prunus mume [ume]
ref|NP_001051893.1|  Os03g0848400                                       135   1e-35   
gb|AAC17626.1|  Contains similarity to BAP31 protein gb|X81816 fr...    134   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb|EAY92582.1|  hypothetical protein OsI_14323                          133   6e-35   Oryza sativa Indica Group [Indian rice]
dbj|BAJ87002.1|  predicted protein                                      133   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN36491.1|  unknown                                                 130   1e-34   Zea mays [maize]
ref|XP_009779153.1|  PREDICTED: B-cell receptor-associated protei...    130   2e-34   Nicotiana sylvestris
ref|XP_010247234.1|  PREDICTED: B-cell receptor-associated protei...    130   9e-34   Nelumbo nucifera [Indian lotus]
gb|EMS49195.1|  hypothetical protein TRIUR3_29235                       129   2e-33   Triticum urartu
gb|EMT32966.1|  hypothetical protein F775_31670                         128   3e-33   
ref|XP_009381320.1|  PREDICTED: B-cell receptor-associated protei...    129   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006479253.1|  PREDICTED: B-cell receptor-associated protei...    129   5e-33   Citrus sinensis [apfelsine]
gb|KHG09837.1|  hypothetical protein F383_09194                         127   1e-32   Gossypium arboreum [tree cotton]
ref|XP_010927692.1|  PREDICTED: B-cell receptor-associated protei...    127   2e-32   Elaeis guineensis
gb|EAZ03537.1|  hypothetical protein OsI_25672                          127   2e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_006830526.1|  hypothetical protein AMTR_s00117p00045900          127   2e-32   Amborella trichopoda
ref|XP_002463520.1|  hypothetical protein SORBIDRAFT_01g001290          127   2e-32   Sorghum bicolor [broomcorn]
gb|ACG43219.1|  B-cell receptor-associated protein 31-like contai...    127   2e-32   Zea mays [maize]
ref|XP_010069636.1|  PREDICTED: B-cell receptor-associated protei...    126   5e-32   Eucalyptus grandis [rose gum]
ref|XP_009371858.1|  PREDICTED: B-cell receptor-associated protei...    125   7e-32   Pyrus x bretschneideri [bai li]
ref|NP_001141677.1|  uncharacterized protein LOC100273803 precursor     125   7e-32   
ref|XP_009802750.1|  PREDICTED: uncharacterized protein LOC104248228    123   7e-32   Nicotiana sylvestris
ref|XP_003562352.1|  PREDICTED: B-cell receptor-associated protei...    125   8e-32   Brachypodium distachyon [annual false brome]
ref|XP_008809940.1|  PREDICTED: B-cell receptor-associated protei...    125   9e-32   Phoenix dactylifera
ref|XP_006657620.1|  PREDICTED: B-cell receptor-associated protei...    125   1e-31   Oryza brachyantha
gb|KJB26033.1|  hypothetical protein B456_004G226500                    124   1e-31   Gossypium raimondii
gb|KJB10919.1|  hypothetical protein B456_001G232500                    124   2e-31   Gossypium raimondii
gb|KJB26032.1|  hypothetical protein B456_004G226500                    124   2e-31   Gossypium raimondii
ref|XP_009599718.1|  PREDICTED: uncharacterized protein LOC104095323    122   2e-31   Nicotiana tomentosiformis
ref|XP_009370674.1|  PREDICTED: B-cell receptor-associated protei...    124   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_003532279.1|  PREDICTED: B-cell receptor-associated protei...    124   4e-31   Glycine max [soybeans]
ref|XP_004981056.1|  PREDICTED: B-cell receptor-associated protei...    123   5e-31   Setaria italica
ref|XP_006365288.1|  PREDICTED: uncharacterized protein LOC102597522    121   6e-31   Solanum tuberosum [potatoes]
ref|XP_008372494.1|  PREDICTED: B-cell receptor-associated protei...    122   9e-31   Malus domestica [apple tree]
ref|XP_004248701.1|  PREDICTED: uncharacterized protein LOC101261860    120   1e-30   Solanum lycopersicum
ref|XP_008794596.1|  PREDICTED: B-cell receptor-associated protei...    122   1e-30   Phoenix dactylifera
ref|XP_008382607.1|  PREDICTED: B-cell receptor-associated protei...    122   2e-30   
gb|KDP26363.1|  hypothetical protein JCGZ_17521                         122   2e-30   Jatropha curcas
ref|XP_007049723.1|  B-cell receptor-associated protein 31-like         121   2e-30   Theobroma cacao [chocolate]
ref|XP_008802267.1|  PREDICTED: B-cell receptor-associated protei...    121   5e-30   Phoenix dactylifera
ref|XP_007140653.1|  hypothetical protein PHAVU_008G130500g             120   5e-30   Phaseolus vulgaris [French bean]
ref|XP_011095414.1|  PREDICTED: uncharacterized protein LOC105174881    119   5e-30   Sesamum indicum [beniseed]
ref|XP_009410623.1|  PREDICTED: B-cell receptor-associated protei...    120   8e-30   
ref|XP_008226862.1|  PREDICTED: uncharacterized protein LOC103326424    118   9e-30   Prunus mume [ume]
ref|XP_008380294.1|  PREDICTED: uncharacterized protein LOC103443257    117   1e-29   
gb|ACG37455.1|  B-cell receptor-associated protein 31-like contai...    119   1e-29   Zea mays [maize]
ref|XP_003552124.1|  PREDICTED: B-cell receptor-associated protei...    119   1e-29   Glycine max [soybeans]
ref|XP_007134124.1|  hypothetical protein PHAVU_010G021100g             119   2e-29   Phaseolus vulgaris [French bean]
ref|XP_002266257.2|  PREDICTED: B-cell receptor-associated protei...    119   2e-29   Vitis vinifera
ref|XP_006452411.1|  hypothetical protein CICLE_v10009874mg             116   2e-29   Citrus clementina [clementine]
ref|NP_001136567.1|  uncharacterized LOC100216689 precursor             119   2e-29   Zea mays [maize]
ref|XP_002303054.2|  hypothetical protein POPTR_0002s24670g             119   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008385961.1|  PREDICTED: uncharacterized protein LOC103448478    117   3e-29   
ref|XP_008460368.1|  PREDICTED: B-cell receptor-associated protei...    118   6e-29   Cucumis melo [Oriental melon]
ref|XP_011011172.1|  PREDICTED: uncharacterized protein LOC105115831    117   1e-28   Populus euphratica
ref|XP_010685051.1|  PREDICTED: B-cell receptor-associated protei...    117   1e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO62065.1|  hypothetical protein CISIN_1g045614mg                   114   2e-28   Citrus sinensis [apfelsine]
ref|XP_006281079.1|  hypothetical protein CARUB_v10027107mg             116   2e-28   Capsella rubella
gb|EYU27354.1|  hypothetical protein MIMGU_mgv1a015673mg                114   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_009361097.1|  PREDICTED: uncharacterized protein LOC103951454    114   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_004144386.1|  PREDICTED: uncharacterized protein LOC101213598    116   3e-28   Cucumis sativus [cucumbers]
gb|EMS58132.1|  hypothetical protein TRIUR3_00710                       115   4e-28   Triticum urartu
ref|XP_010099686.1|  hypothetical protein L484_025117                   115   5e-28   Morus notabilis
emb|CDP15777.1|  unnamed protein product                                112   2e-27   Coffea canephora [robusta coffee]
ref|XP_007216855.1|  hypothetical protein PRUPE_ppa021600mg             113   2e-27   
ref|XP_006452412.1|  hypothetical protein CICLE_v10009874mg             111   2e-27   
gb|KEH22623.1|  B-cell receptor-associated-like protein                 113   3e-27   Medicago truncatula
ref|XP_004491710.1|  PREDICTED: B-cell receptor-associated protei...    113   3e-27   Cicer arietinum [garbanzo]
ref|XP_002863915.1|  hypothetical protein ARALYDRAFT_494932             113   4e-27   
gb|KHN38264.1|  hypothetical protein glysoja_003929                     111   4e-27   Glycine soja [wild soybean]
ref|XP_010274041.1|  PREDICTED: B-cell receptor-associated protei...    113   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010552045.1|  PREDICTED: B-cell receptor-associated protei...    113   5e-27   Tarenaya hassleriana [spider flower]
ref|XP_002521067.1|  bcr-associated protein, bap, putative              114   8e-27   
gb|KHN11907.1|  hypothetical protein glysoja_019880                     109   1e-26   Glycine soja [wild soybean]
gb|KDP39157.1|  hypothetical protein JCGZ_00914                         107   4e-26   Jatropha curcas
ref|XP_004963921.1|  PREDICTED: B-cell receptor-associated protei...    108   4e-26   
gb|EYU40619.1|  hypothetical protein MIMGU_mgv1a013665mg                110   5e-26   Erythranthe guttata [common monkey flower]
ref|XP_009151666.1|  PREDICTED: uncharacterized protein LOC103874978    110   6e-26   Brassica rapa
emb|CDX86287.1|  BnaA06g30040D                                          110   7e-26   
ref|XP_004987306.1|  PREDICTED: uncharacterized protein LOC101775823    108   7e-26   Setaria italica
emb|CDX85356.1|  BnaC07g26670D                                          109   9e-26   
ref|NP_001143481.1|  hypothetical protein                               107   2e-25   Zea mays [maize]
emb|CDP03896.1|  unnamed protein product                                108   2e-25   Coffea canephora [robusta coffee]
ref|XP_004491413.1|  PREDICTED: uncharacterized protein LOC101509893    106   2e-25   Cicer arietinum [garbanzo]
ref|XP_009775442.1|  PREDICTED: uncharacterized protein LOC104225364    107   7e-25   Nicotiana sylvestris
ref|XP_008235454.1|  PREDICTED: B-cell receptor-associated protei...    107   7e-25   Prunus mume [ume]
ref|XP_004290194.1|  PREDICTED: B-cell receptor-associated protei...    106   1e-24   Fragaria vesca subsp. vesca
ref|XP_009610381.1|  PREDICTED: uncharacterized protein LOC104104089    106   1e-24   Nicotiana tomentosiformis
ref|XP_011089080.1|  PREDICTED: uncharacterized protein LOC105170143    106   1e-24   Sesamum indicum [beniseed]
ref|XP_002437063.1|  hypothetical protein SORBIDRAFT_10g020520          104   2e-24   Sorghum bicolor [broomcorn]
ref|XP_006452413.1|  hypothetical protein CICLE_v10009874mg             103   2e-24   
ref|XP_004295837.1|  PREDICTED: uncharacterized protein LOC101305253    103   4e-24   Fragaria vesca subsp. vesca
gb|KDO62066.1|  hypothetical protein CISIN_1g046403mg                   102   4e-24   Citrus sinensis [apfelsine]
ref|XP_008674143.1|  PREDICTED: B-cell receptor-associated protei...    106   4e-24   
ref|XP_006340009.1|  PREDICTED: B-cell receptor-associated protei...    105   5e-24   Solanum tuberosum [potatoes]
ref|XP_010913045.1|  PREDICTED: B-cell receptor-associated protei...    103   1e-23   Elaeis guineensis
ref|XP_004247073.1|  PREDICTED: uncharacterized protein LOC101251810    103   1e-23   Solanum lycopersicum
ref|XP_011024634.1|  PREDICTED: uncharacterized protein LOC105125752    102   6e-23   Populus euphratica
ref|XP_007201384.1|  hypothetical protein PRUPE_ppa012189mg             100   7e-23   
ref|XP_007020770.1|  F-box family protein with a domain of Unchar...    105   1e-22   
ref|XP_010464329.1|  PREDICTED: uncharacterized protein LOC104744901    101   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008455897.1|  PREDICTED: B-cell receptor-associated protei...  97.8    2e-22   Cucumis melo [Oriental melon]
ref|XP_009388739.1|  PREDICTED: uncharacterized protein LOC103975489  98.2    3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010493705.1|  PREDICTED: B-cell receptor-associated protei...  99.8    5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009129743.1|  PREDICTED: uncharacterized protein LOC103854553  99.0    1e-21   Brassica rapa
emb|CDY29829.1|  BnaC05g31610D                                        96.7    1e-21   Brassica napus [oilseed rape]
emb|CDY51050.1|  BnaA02g30380D                                        98.6    1e-21   Brassica napus [oilseed rape]
ref|XP_006298783.1|  hypothetical protein CARUB_v10014885mg           96.7    1e-21   Capsella rubella
gb|EPS57633.1|  hypothetical protein M569_17183                       98.2    1e-21   Genlisea aurea
ref|NP_199677.1|  B-cell receptor-associated protein 31-like protein  97.8    3e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66080.1|  BnaCnng49520D                                        97.4    3e-21   Brassica napus [oilseed rape]
ref|XP_009145629.1|  PREDICTED: uncharacterized protein LOC103869321  95.5    3e-21   Brassica rapa
ref|XP_006395148.1|  hypothetical protein EUTSA_v10004894mg           97.1    4e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006409380.1|  hypothetical protein EUTSA_v10022940mg           94.0    4e-21   
ref|XP_010488019.1|  PREDICTED: uncharacterized protein LOC104765923  94.7    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010508923.1|  PREDICTED: uncharacterized protein LOC104785412  94.7    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010466234.1|  PREDICTED: uncharacterized protein LOC104746450  94.7    7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010063029.1|  PREDICTED: uncharacterized protein LOC104450...  94.7    1e-20   Eucalyptus grandis [rose gum]
ref|XP_009795272.1|  PREDICTED: uncharacterized protein LOC104241998  96.7    2e-20   Nicotiana sylvestris
ref|XP_002317336.1|  hypothetical protein POPTR_0011s09140g           93.2    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009616881.1|  PREDICTED: uncharacterized protein LOC104109325  95.5    4e-20   
ref|XP_009778813.1|  PREDICTED: uncharacterized protein LOC104228107  91.7    5e-20   Nicotiana sylvestris
ref|NP_566662.1|  B-cell receptor-associated protein 31-like protein  92.0    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142754.1|  PREDICTED: uncharacterized protein LOC101213037  91.7    7e-20   
gb|KFK39354.1|  hypothetical protein AALP_AA3G233700                  91.7    7e-20   Arabis alpina [alpine rockcress]
ref|XP_006406381.1|  hypothetical protein EUTSA_v10021737mg           91.7    8e-20   Eutrema salsugineum [saltwater cress]
gb|AAM67164.1|  unknown                                               91.3    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63018.1|  hypothetical protein M569_11771                       91.7    1e-19   Genlisea aurea
gb|KFK38172.1|  hypothetical protein AALP_AA3G078300                  92.8    2e-19   Arabis alpina [alpine rockcress]
ref|XP_002884632.1|  hypothetical protein ARALYDRAFT_478041           92.4    3e-19   
ref|XP_007142305.1|  hypothetical protein PHAVU_008G269400g           91.3    3e-19   Phaseolus vulgaris [French bean]
ref|XP_011013138.1|  PREDICTED: uncharacterized protein LOC105117241  90.1    3e-19   Populus euphratica
ref|XP_008458888.1|  PREDICTED: uncharacterized protein LOC103498158  89.7    3e-19   Cucumis melo [Oriental melon]
gb|EMS47744.1|  hypothetical protein TRIUR3_06470                     92.0    5e-19   
ref|XP_002862714.1|  hypothetical protein ARALYDRAFT_497321           89.0    1e-18   
ref|XP_002885374.1|  hypothetical protein ARALYDRAFT_479569           89.0    1e-18   
gb|EMT23366.1|  hypothetical protein F775_19324                       91.3    1e-18   
ref|XP_010486262.1|  PREDICTED: B-cell receptor-associated protei...  89.4    3e-18   
ref|XP_010449720.1|  PREDICTED: B-cell receptor-associated protei...  89.4    3e-18   
gb|AFW70952.1|  hypothetical protein ZEAMMB73_233499                  86.7    8e-18   
ref|XP_010666200.1|  PREDICTED: uncharacterized protein LOC104883381  86.3    1e-17   
ref|NP_187375.1|  B-cell receptor-associated protein 31-like protein  87.0    2e-17   
ref|XP_010545515.1|  PREDICTED: uncharacterized protein LOC104817861  84.7    3e-17   
ref|XP_006407860.1|  hypothetical protein EUTSA_v10021483mg           86.3    3e-17   
emb|CBI29413.3|  unnamed protein product                              83.2    1e-16   
ref|XP_008467068.1|  PREDICTED: uncharacterized protein LOC103504505  82.8    2e-16   
gb|KDP22731.1|  hypothetical protein JCGZ_01833                       84.0    3e-16   
ref|XP_002529922.1|  bcr-associated protein, bap, putative            80.9    3e-15   
gb|ACU15885.1|  unknown                                               78.6    4e-15   
emb|CBI28815.3|  unnamed protein product                              75.9    3e-14   
gb|EMT13188.1|  hypothetical protein F775_28124                       76.6    6e-14   
ref|XP_007212356.1|  hypothetical protein PRUPE_ppa014571mg           71.2    1e-12   
ref|XP_003617596.1|  hypothetical protein MTR_5g093360                71.6    1e-12   
ref|XP_006443576.1|  hypothetical protein CICLE_v100221651mg          71.2    2e-12   
ref|XP_010096876.1|  hypothetical protein L484_008070                 67.4    2e-11   
ref|XP_006342256.1|  PREDICTED: uncharacterized protein LOC102584894  68.9    7e-11   
emb|CAN62540.1|  hypothetical protein VITISV_031161                   64.3    6e-10   
gb|EYU39202.1|  hypothetical protein MIMGU_mgv1a024213mg              64.7    9e-10   
ref|XP_004240151.1|  PREDICTED: uncharacterized protein LOC101249367  64.3    2e-09   
ref|XP_006375656.1|  hypothetical protein POPTR_0014s18880g           62.0    4e-09   
ref|XP_010466235.1|  PREDICTED: uncharacterized protein LOC104746451  59.7    2e-08   
ref|XP_006375655.1|  hypothetical protein POPTR_0014s18870g           59.7    2e-08   
emb|CDX71552.1|  BnaC04g17870D                                        57.0    5e-08   
ref|XP_010063030.1|  PREDICTED: uncharacterized protein LOC104450...  57.8    7e-08   
gb|KJB13716.1|  hypothetical protein B456_002G090900                  57.4    2e-07   
gb|AFW71006.1|  hypothetical protein ZEAMMB73_389553                  54.7    7e-07   
ref|XP_006443575.1|  hypothetical protein CICLE_v100221652mg          54.3    9e-07   
ref|XP_006479254.1|  PREDICTED: B-cell receptor-associated protei...  55.1    1e-06   
gb|KJB13713.1|  hypothetical protein B456_002G090600                  54.7    1e-06   
gb|AFW77085.1|  hypothetical protein ZEAMMB73_955327                  51.6    8e-06   
ref|NP_001175145.1|  Os07g0291200                                     52.4    1e-05   
ref|XP_008230042.1|  PREDICTED: uncharacterized protein LOC103329358  51.6    1e-05   
ref|XP_008646901.1|  PREDICTED: uncharacterized protein LOC103628485  50.4    3e-05   



>ref|XP_009610364.1| PREDICTED: uncharacterized protein LOC104104077 [Nicotiana tomentosiformis]
Length=219

 Score =   270 bits (689),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 173/194 (89%), Gaps = 3/194 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM++ILL LFKTPLRKL+I++LDR KRGRGPL+VKSVAATV V+MIYTVYS++E+QSRP 
Sbjct  15   EMSLILLFLFKTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVYSIRELQSRPT  74

Query  403  ESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN  224
            +++NPTDQ+LLA QILQA+LMGF LFL LM+DRLHHYIRELRLLRK MEAAKK DR  DN
Sbjct  75   DTVNPTDQILLAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRKTMEAAKKQDRALDN  134

Query  223  GKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  44
            GKNG   E ++LK+EI+S+++K+++LESE EAK +EVK+QK NS+S KGQSEKLLLEY +
Sbjct  135  GKNG---EASNLKDEISSLRNKVRQLESENEAKEKEVKSQKANSDSLKGQSEKLLLEYDR  191

Query  43   LLEENQHLRSQLHA  2
            LLEENQ+LRSQL +
Sbjct  192  LLEENQNLRSQLQS  205



>ref|XP_009795967.1| PREDICTED: uncharacterized protein LOC104242589 [Nicotiana sylvestris]
Length=219

 Score =   266 bits (681),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 172/194 (89%), Gaps = 3/194 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM++ILL LFKTPLRKL+I++LDR KRGRGPL+VKSVAATV V+MIYTVYS++E+QSRP 
Sbjct  15   EMSLILLFLFKTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVYSIRELQSRPT  74

Query  403  ESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN  224
            +++NPTDQ+LLA QILQA+LMGF LFL LM+DRLHHYIRELRLLRK MEA KK DR  DN
Sbjct  75   DTVNPTDQILLAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRKTMEAVKKQDRALDN  134

Query  223  GKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  44
            GKNG   E ++LK+EI+S+++K+++LES+ EAK +EVK+QK NS+S KGQSEKLLLEY +
Sbjct  135  GKNG---EASNLKDEISSLRNKVRQLESDNEAKEKEVKSQKANSDSLKGQSEKLLLEYDR  191

Query  43   LLEENQHLRSQLHA  2
            LLEENQ+LRSQL +
Sbjct  192  LLEENQNLRSQLQS  205



>emb|CDP10783.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   248 bits (632),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMAVILLLLFKTPLRKL I++LDR KRG GPLVVKSV ATV V+M Y+VY+++E+ SRP+
Sbjct  12   EMAVILLLLFKTPLRKLEIMALDRVKRGSGPLVVKSVGATVLVMMTYSVYTIRELNSRPV  71

Query  403  ESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN  224
            ES NPTDQVLLA ++L  SLMGF LFL+LMIDRLHHYIRELR+LRK MEAAKK  R  D 
Sbjct  72   ESFNPTDQVLLAYEVLDTSLMGFSLFLALMIDRLHHYIRELRILRKTMEAAKKQSREVDE  131

Query  223  GKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  44
            GK     EVN+LKEE+ +MK+ I  LESEC+AK +E+KA + NSES K QSE LLLEY +
Sbjct  132  GKKANGAEVNALKEEVTAMKTMINILESECKAKEKELKAAESNSESLKKQSEGLLLEYDR  191

Query  43   LLEENQHLRSQLHA  2
            LLE+NQ LRSQLH+
Sbjct  192  LLEDNQSLRSQLHS  205



>ref|XP_004251523.1| PREDICTED: uncharacterized protein LOC101250189 [Solanum lycopersicum]
Length=219

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 169/194 (87%), Gaps = 3/194 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM +IL+ LF+TPLRKL+I+SLDR KRG GPL+VKSVAATV V+MIYTVYS++E+QSRP 
Sbjct  15   EMGLILMFLFRTPLRKLIIMSLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQSRPA  74

Query  403  ESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN  224
            +S+NPTDQ+LLA QIL+A+LMGF LFL LMIDRLHHYIRELRLLRK MEA KK DR  DN
Sbjct  75   DSVNPTDQILLAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRKTMEAVKKQDRTLDN  134

Query  223  GKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  44
             KNG   E ++L++EI+S+++++K+LESE EAK +EV++Q+ NS+S KGQSEKLLLEY +
Sbjct  135  IKNG---EASTLRDEISSLRNRMKQLESESEAKEKEVQSQRANSDSLKGQSEKLLLEYDR  191

Query  43   LLEENQHLRSQLHA  2
            +LEENQ+LRSQL +
Sbjct  192  ILEENQNLRSQLQS  205



>ref|XP_006351969.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=219

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 169/194 (87%), Gaps = 3/194 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM +IL+ LF+TPLRKL+I++LDR KRG GPL+VKSVAATV V+MIYTVYS++E+QSRP 
Sbjct  15   EMGLILMFLFRTPLRKLIIMTLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQSRPA  74

Query  403  ESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN  224
            +S+NPTDQ+LLA QIL+A+LMGF LFL LMIDRLHHYIRELRLLR+ MEA KK DR  DN
Sbjct  75   DSVNPTDQILLAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRRTMEAVKKQDRTLDN  134

Query  223  GKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  44
             KNG   E ++L++EI+S+++K+K+LESE EAK EEV++Q+ NS+S KGQSEKLLLEY +
Sbjct  135  IKNG---EASTLRDEISSLRNKMKQLESESEAKEEEVQSQRANSDSLKGQSEKLLLEYDR  191

Query  43   LLEENQHLRSQLHA  2
            +LEENQ+LRSQL +
Sbjct  192  ILEENQNLRSQLQS  205



>ref|XP_010549208.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
 ref|XP_010549209.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=218

 Score =   233 bits (594),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 167/197 (85%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             E+A+I+ LLFKTPLRKL+I++LDR KRGRGP+VVK++A TVFV+++ +VYS+ +IQ   
Sbjct  11   AEVALIMTLLFKTPLRKLVIMTLDRIKRGRGPVVVKTIATTVFVVLLSSVYSILKIQRGS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +ES  ++PTDQ+L+A+ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RG
Sbjct  71   VESGVLSPTDQILMAKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKN   EEV +L EE+A++K+KIK+LESECE KG+E+K+ +  +E+ + Q++  LLE
Sbjct  131  FEDGKNASAEEVKALGEEVAALKAKIKRLESECETKGKELKSAQAETEALRKQADGFLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LR+QL +
Sbjct  191  YDRLLEDNQNLRNQLES  207



>ref|XP_003605958.1| hypothetical protein MTR_4g049540 [Medicago truncatula]
 gb|AES88155.1| B-cell receptor-associated-like protein [Medicago truncatula]
 gb|AFK41440.1| unknown [Medicago truncatula]
Length=221

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 159/197 (81%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GEM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R 
Sbjct  11   GEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEA KK  R 
Sbjct  71   VEAGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKNG  EE  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE  L+E
Sbjct  131  FEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LRSQL A
Sbjct  191  YDRLLEDNQNLRSQLEA  207



>gb|AFK33681.1| unknown [Medicago truncatula]
Length=221

 Score =   231 bits (589),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GEM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R 
Sbjct  11   GEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEA KK  R 
Sbjct  71   VEAGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKNG  EE  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE   LE
Sbjct  131  FEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFFLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LRSQL A
Sbjct  191  YDRLLEDNQNLRSQLEA  207



>gb|ACJ84514.1| unknown [Medicago truncatula]
Length=221

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GEM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R 
Sbjct  11   GEMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK  EA KK  R 
Sbjct  71   VEAGVLNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTTEAVKKQTRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKNG  EE  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE  L+E
Sbjct  131  FEDGKNGSTEEQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LRSQL A
Sbjct  191  YDRLLEDNQNLRSQLEA  207



>gb|KHN41234.1| hypothetical protein glysoja_017278 [Glycine soja]
Length=213

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 157/196 (80%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R L
Sbjct  12   EMILILTLVFKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTL  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR LRK MEA KK  R F
Sbjct  72   EAGIVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GKNG +EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY
Sbjct  132  EDGKNGNLEEHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEGFLMEY  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ LRSQL A
Sbjct  192  DRLLEDNQSLRSQLQA  207



>ref|NP_001239654.1| uncharacterized protein LOC100798727 [Glycine max]
 gb|ACU21248.1| unknown [Glycine max]
Length=213

 Score =   228 bits (582),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 157/196 (80%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R L
Sbjct  12   EMILILTLVFKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLVVVLASSLYSMAKIQQRTL  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E+  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR LRK MEA KK  R F
Sbjct  72   EAGIVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GKNG +EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY
Sbjct  132  EDGKNGNLEEHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEGFLMEY  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ LRSQL A
Sbjct  192  DRLLEDNQSLRSQLQA  207



>ref|XP_010252455.1| PREDICTED: uncharacterized protein LOC104594039 [Nelumbo nucifera]
Length=222

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 165/198 (83%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILL LFKTPLRKL+I+ LDR KRGRGP++VK+V  T+ V+++ +VYS+ +IQ+R 
Sbjct  11   AEMALILLFLFKTPLRKLIIMGLDRVKRGRGPVMVKTVCGTILVVLLSSVYSMTKIQNRS  70

Query  406  LES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++S   +NPTDQVL+A+ +L+ASLMGF LFL+LMIDRLHHYIRELRLLRK+MEA KK +R
Sbjct  71   MDSAGIVNPTDQVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLRKSMEAVKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            GF++GKNGG E+  +L+EE AS+++K+K+LES+ EAK +E KA + N+E+ K QSE  LL
Sbjct  131  GFEDGKNGGPEDTKALEEERASLRAKVKELESKFEAKTKETKAAEANAEALKKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLE+NQ LR+QL +
Sbjct  191  EYDRLLEDNQSLRNQLQS  208



>ref|XP_010244479.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=222

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 165/197 (84%), Gaps = 3/197 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+ILL LFKTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R +
Sbjct  12   EMALILLFLFKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVFVVLLSSVYSMMKIQKRSM  71

Query  403  ES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            ++   +NPTDQVL+A+ +L+ASLMGF LFL+LMIDRLHHYIRELRLLRK MEA KK +RG
Sbjct  72   DAAVVVNPTDQVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLRKGMEAIKKQNRG  131

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKNG  EE  +L+EE+A+++ K+K+LESECE + +E+K  + N+ + + QSE +LLE
Sbjct  132  FEDGKNGVAEETKALEEEMANLRGKVKQLESECEVQTKELKTAEANTVALRKQSEGILLE  191

Query  52   YGQLLEENQHLRSQLHA  2
            Y +L+E+NQ+LR+QL +
Sbjct  192  YDRLMEDNQNLRNQLQS  208



>ref|XP_010689493.1| PREDICTED: B-cell receptor-associated protein 31 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   226 bits (576),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 155/194 (80%), Gaps = 2/194 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMAVILLLLF+TPLRKL+I+ LDR KRGRGP+V+ +V  T+ VL++ T+ ++  IQ R +
Sbjct  12   EMAVILLLLFRTPLRKLVILGLDRMKRGRGPIVITTVGGTILVLLVTTISTIVNIQQRDI  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E  +INPTDQ+L  + +L ASLMGF+LFL LM+DRLHHYIRELRLLRK MEA KK +R F
Sbjct  72   EPGTINPTDQILFTRSLLDASLMGFILFLGLMMDRLHHYIRELRLLRKTMEAVKKQNRSF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            D+ KNG  EE+ +++EE+A++KS+IK +ESEC AK +E+KA +  SE+ K QSE LLLEY
Sbjct  132  DDAKNGSSEELKAMEEEVATLKSRIKTMESECVAKTDEIKASESKSEALKKQSEGLLLEY  191

Query  49   GQLLEENQHLRSQL  8
             +LLE+NQ LR QL
Sbjct  192  DRLLEDNQSLRGQL  205



>ref|XP_002270301.1| PREDICTED: B-cell receptor-associated protein 31-like [Vitis 
vinifera]
Length=214

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I+ LLFKTPLRKL++++LDR KRGRGP++ ++VA TVFV+++ +VYS+ +IQ+R 
Sbjct  11   AEMALIMTLLFKTPLRKLVVMALDRVKRGRGPIMAQTVATTVFVVLMSSVYSMMKIQNRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E   INPTDQVL+A+ +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRKAMEA KK +RG
Sbjct  71   VEPGLINPTDQVLMARHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKAMEAEKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKNG  EE  ++ EE++S++++IKKLESECE K +E +A + N+ + K QSE  LLE
Sbjct  131  FEDGKNGRAEEAKAMGEEMSSLRTQIKKLESECETKAKEAEAAEANTVALKKQSEGFLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ+L+SQL +
Sbjct  191  YDRLLEENQNLKSQLES  207



>ref|XP_003539858.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 155/197 (79%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +IL L+FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R 
Sbjct  11   SEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            LE+  +NPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R 
Sbjct  71   LEAGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKNG  EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+E
Sbjct  131  FEDGKNGNSEEHKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVEALKKQSEGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ LRSQL A
Sbjct  191  YDRLLEDNQSLRSQLQA  207



>ref|XP_006403381.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
 gb|ESQ44834.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
Length=218

 Score =   224 bits (570),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 163/197 (83%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV+++ +VYS+  IQ R 
Sbjct  11   AEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSVYSLLSIQRRS  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +  ++NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RG
Sbjct  71   EDGAALNPTDQVLASKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKN   EEV +L EEIA++KSKI KLESE E+KG+E+K  +  +E+ + Q++  L+E
Sbjct  131  FEDGKNTSGEEVKALVEEIAALKSKIGKLESESESKGKELKGARAETEALRKQADGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LR+QL +
Sbjct  191  YDRLLEDNQNLRNQLES  207



>gb|KHN21219.1| hypothetical protein glysoja_006698 [Glycine soja]
Length=221

 Score =   224 bits (570),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 155/197 (79%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +IL L+FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R 
Sbjct  11   SEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            LE+  +NPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R 
Sbjct  71   LEAGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKNG  EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+E
Sbjct  131  FEDGKNGNSEEHKALNEEITALKSKIKKLESECEAKGSQAKTLETEVEALKKQSEGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ LRSQL A
Sbjct  191  YDRLLEDNQSLRSQLQA  207



>ref|XP_004506274.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=221

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 155/196 (79%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM +IL L+FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +
Sbjct  12   EMLLILTLVFKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLVVVLSSSLYSMAKIQQRTI  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E+  INPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELRLLRK MEA KK  R F
Sbjct  72   EAGIINPTDQVLMSKHMLEASLMGFMLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRSF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GKNG  EE  +L EEI ++KSK+K LESECE+KG + K      E+ K QSE  L+EY
Sbjct  132  EDGKNGNTEEQKALAEEITTLKSKVKMLESECESKGNKEKTLHTEVEALKKQSEGFLMEY  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ+LRSQL  
Sbjct  192  DRLLEDNQNLRSQLET  207



>ref|XP_009123682.1| PREDICTED: uncharacterized protein LOC103848551 [Brassica rapa]
 emb|CDY02396.1| BnaA02g23050D [Brassica napus]
Length=218

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 161/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV++I +VYS+  IQ R 
Sbjct  11   AEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLISSVYSLLSIQRRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +R 
Sbjct  71   EDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKN   EEV +L EEIA +K+KIKKLESE E+KG+E+K+ +  +E+ +  ++  L+E
Sbjct  131  FEDGKNTNGEEVKALGEEIAVLKAKIKKLESESESKGKELKSAQAETEALRKSADGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LR+QL +
Sbjct  191  YDRLLEDNQNLRNQLES  207



>emb|CBI23212.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++LLFKTPLRKL+I+ LDR KRGRGP++VK+VAATV V++I +VYS+ +I+ R 
Sbjct  11   AEMAMIMVLLFKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSVYSMMKIRKRG  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            ++   +NPTDQVL+A+ +L+ SLMGF LFL+LMIDRLHHYIRELRL RK+MEA KK +RG
Sbjct  71   IDDDVVNPTDQVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRRKSMEAIKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GK GG  E+ +++EE+A++ +K+K+LESE E K +E KA + N+ + + QSE  LLE
Sbjct  131  FEDGKTGGSAEIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAVALRKQSEGFLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ+LR+QL +
Sbjct  191  YDRLLEENQNLRNQLQS  207



>ref|XP_002262807.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=248

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++LLFKTPLRKL+I+ LDR KRGRGP++VK+VAATV V++I +VYS+ +I+ R 
Sbjct  38   AEMAMIMVLLFKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSVYSMMKIRKRG  97

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            ++   +NPTDQVL+A+ +L+ SLMGF LFL+LMIDRLHHYIRELRL RK+MEA KK +RG
Sbjct  98   IDDDVVNPTDQVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRRKSMEAIKKQNRG  157

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GK GG  E+ +++EE+A++ +K+K+LESE E K +E KA + N+ + + QSE  LLE
Sbjct  158  FEDGKTGGSAEIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAVALRKQSEGFLLE  217

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ+LR+QL +
Sbjct  218  YDRLLEENQNLRNQLQS  234



>ref|XP_007132530.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
 gb|ESW04524.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
Length=212

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +IL L+FKT LRKL+IISLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R 
Sbjct  11   SEMLLILTLVFKTSLRKLVIISLDRVKRGRGPIVVSTVGATLVVVLSSSLYSMTKIQQRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            LE+  +NPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELRLLRK  E  KK  R 
Sbjct  71   LEAGILNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRLLRKTNEVIKKQSRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKNG  EE  +L  EIA++KSKIKKLESECE KG E K  +   E  K QSE  L+E
Sbjct  131  FEDGKNGNAEEQKTLT-EIATLKSKIKKLESECETKGNEAKTLETEVEVLKKQSEGFLME  189

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ LRSQL  
Sbjct  190  YDRLLEDNQSLRSQLQV  206



>ref|XP_006281077.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
 gb|EOA13975.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
Length=218

 Score =   218 bits (555),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+ILLLLFKTPLRKL+I++ D+ KRGRGP+VVK++  TVFV+++ +VYS+  IQ R  
Sbjct  12   EMALILLLLFKTPLRKLIILTFDKIKRGRGPVVVKTIGTTVFVVLLSSVYSLVNIQRRSE  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF
Sbjct  72   DGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GK    EEV +L EEI ++K+KIK LESE E+KG+E+K  K  +E+ + Q++  LLEY
Sbjct  132  EDGKTTSGEEVKALGEEIVALKTKIKTLESESESKGKELKGAKGETEALRKQADGFLLEY  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ+LR+QL +
Sbjct  192  DRLLEDNQNLRNQLES  207



>ref|NP_568607.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
 gb|AAK96684.1| Unknown protein [Arabidopsis thaliana]
 gb|ABD43004.1| At5g42570 [Arabidopsis thaliana]
 gb|AED94830.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
Length=218

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 160/197 (81%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R 
Sbjct  11   AEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RG
Sbjct  71   EDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GK    EEV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+E
Sbjct  131  FEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LR+QL +
Sbjct  191  YDRLLEDNQNLRNQLES  207



>ref|XP_002863762.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40021.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVF++++ ++YS+ +IQ R 
Sbjct  11   AEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGITVFIVLLSSIYSLVKIQRRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RG
Sbjct  71   EDGAVLNPTDQVLASKYLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKN   EEV ++ EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+E
Sbjct  131  FEDGKNTSGEEVKAIGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LR+QL +
Sbjct  191  YDRLLEDNQNLRNQLES  207



>gb|AAM62748.1| unknown [Arabidopsis thaliana]
Length=218

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 160/197 (81%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R 
Sbjct  11   AEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RG
Sbjct  71   EDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GK    EEV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + QS+  L+E
Sbjct  131  FEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQSDGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+N++LR+QL +
Sbjct  191  YDRLLEDNRNLRNQLES  207



>dbj|BAB09328.1| unnamed protein product [Arabidopsis thaliana]
Length=252

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 160/197 (81%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R 
Sbjct  11   AEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RG
Sbjct  71   EDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GK    EEV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+E
Sbjct  131  FEDGKTTSGEEVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LR+QL +
Sbjct  191  YDRLLEDNQNLRNQLES  207



>ref|XP_003540294.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 154/197 (78%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GEM VI   LFKTP RKL+II+LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +I+ R 
Sbjct  11   GEMFVIASFLFKTPARKLVIITLDRVKRGRGPVVVKTVAATLLVVLASSLYSIAKIRRRN  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            L++  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R 
Sbjct  71   LDAPVVNPTDQVLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GK+    E  +L EE A +K KI+KLESECE +  + KA +   E+ + QSE  L+E
Sbjct  131  FEDGKSVSAAEHKALLEENAMLKPKIEKLESECEVEASKAKALETEVEALRKQSEGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LL +NQ+LRSQL A
Sbjct  191  YDRLLADNQNLRSQLQA  207



>ref|XP_006447584.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 ref|XP_006469667.1| PREDICTED: B-cell receptor-associated protein 31-like [Citrus 
sinensis]
 gb|ESR60824.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 gb|KDO54706.1| hypothetical protein CISIN_1g027898mg [Citrus sinensis]
Length=217

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             +MA+I+ LLFKTPLRKL+I+SLDR KRGRGP+VVK+V  T+F++++ +VYS+ +IQ R 
Sbjct  11   SQMALIMTLLFKTPLRKLVIMSLDRVKRGRGPVVVKTVGGTLFIVLMSSVYSILKIQQRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            LE+  +NPTDQ+L+++ +L+ASLMGF+LFLSLM+DRLHHYIRELRLLRKAMEAAKK  R 
Sbjct  71   LETGALNPTDQILMSKHMLEASLMGFLLFLSLMMDRLHHYIRELRLLRKAMEAAKKQTRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKN  V+E   L ++IA++K+KIKKLESECE K +E  A K  +E+ K QSE  LLE
Sbjct  131  FEDGKNDNVDERKGLGDDIATLKTKIKKLESECEMKDKEANAAKAEAEALKKQSEGFLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LL +NQHLR+QL +
Sbjct  191  YDRLLADNQHLRNQLES  207



>ref|XP_010494193.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ +VYS+  I+ R  
Sbjct  12   EMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSVYSLINIRRRSE  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF
Sbjct  72   DGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GK    EEV +L EEIA++K+KIK +ESE E KG+E+K  K  +E+ + Q++  LLEY
Sbjct  132  EDGKTTSGEEVKALGEEIAALKAKIKTVESESEGKGKELKEAKGETEALRKQADGFLLEY  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ+LR+QL +
Sbjct  192  DRLLEDNQNLRNQLES  207



>emb|CDY68895.1| BnaCnng60970D [Brassica napus]
Length=218

 Score =   216 bits (550),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 160/197 (81%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV+++ +VYS+  IQ R 
Sbjct  11   AEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSVYSLLSIQRRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +R 
Sbjct  71   EDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKN   EEV +L  EIA +K+KIKKLESE E+KG+E+K+ +  +E+ +  ++  L+E
Sbjct  131  FEDGKNTNGEEVKALGGEIAVLKAKIKKLESESESKGKELKSAQAETEALRKSADGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LR+QL +
Sbjct  191  YDRLLEDNQNLRNQLES  207



>gb|KFK32917.1| hypothetical protein AALP_AA6G305900 [Arabis alpina]
Length=218

 Score =   216 bits (549),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  T+FV+++ ++YS+  IQ R 
Sbjct  11   AEMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLMSSLYSLLNIQRRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RG
Sbjct  71   EDGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GKN   EEV +L EEIA++K+K KKLES+ E+KG+E+K+ +  +E+ + Q++  LLE
Sbjct  131  FEDGKNTSGEEVKALGEEIAALKAKNKKLESDSESKGKELKSAQAETEALRKQADGFLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+L++QL +
Sbjct  191  YDRLLEDNQNLKNQLDS  207



>ref|XP_009587048.1| PREDICTED: B-cell receptor-associated protein 31 [Nicotiana tomentosiformis]
Length=222

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++ +FKTPLRKL+I+ LDR KRGRGP++VK+VA T+FV+M+ T+YS+  I++R 
Sbjct  11   AEMALIVIFVFKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTLFVVMLSTIYSIASIRTRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    I PTDQ+LLAQ +L+ASLMGF LFL+ MIDRLHHYIREL + RK MEA KK +R
Sbjct  71   MDEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRRKTMEAVKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
             F++GK+G  EE+ +L+EE ++++ KIK+LESE + K +E    + N+ + K QSE  LL
Sbjct  131  AFEDGKSGASEEIKTLEEEASALRGKIKQLESELQEKAKEASGAEANAVALKKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+LRSQL +
Sbjct  191  EYDRLLEENQNLRSQLQS  208



>ref|XP_007149980.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
 gb|ESW21974.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
Length=221

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 153/197 (78%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             +M VI+  LFKTP RKL+I++LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +IQ R 
Sbjct  11   AQMFVIVSFLFKTPARKLVILTLDRLKRGRGPVVVKTVAATLLVVLASSLYSIAKIQRRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            L++  +NPTDQVL+++  L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEAAKK  R 
Sbjct  71   LDASVVNPTDQVLVSKHTLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAAKKQSRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GK+    E  +L EEI+  K++++KLESECE K  + K  +   E+ + QSE  L+E
Sbjct  131  FEDGKSVSAAEHKALVEEISGFKAEVEKLESECEVKASKAKTLEAEVEALRKQSEGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LRSQL A
Sbjct  191  YDRLLEDNQNLRSQLQA  207



>ref|XP_010481979.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  T+FV+++ +VY +  I+ R  
Sbjct  12   EMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLLSSVYGLVNIRRRSE  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME+AKK +RGF
Sbjct  72   DGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMESAKKQNRGF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GK    EEV +L EEIA++K+KIK +ESE E KG+E+K  K  +E+ + Q++  LLEY
Sbjct  132  EDGKTKSGEEVKALGEEIAALKAKIKTVESESEGKGKELKEAKGETEALRKQADGFLLEY  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ+LR+QL +
Sbjct  192  DRLLEDNQNLRNQLES  207



>ref|XP_010442176.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+ILLLLFKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ +VYS+  I+ R  
Sbjct  12   EMALILLLLFKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSVYSLVNIRRRSE  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +   +NPTDQVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF
Sbjct  72   DGAVLNPTDQVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GK    EEV +L EEIA +K+KIK +ESE + KG+E+K  K  +E+ + Q+++ L EY
Sbjct  132  EDGKTTSGEEVKALGEEIAVLKAKIKTVESESDGKGKELKEAKGETEALRKQADEFLKEY  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ+LR+QL +
Sbjct  192  DRLLEDNQNLRNQLES  207



>ref|XP_003543392.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 152/197 (77%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM VI+  LFKTP RKL+I++LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +I+ R 
Sbjct  11   AEMFVIVSFLFKTPARKLVIVTLDRLKRGRGPVVVKTVAATLLVVLASSLYSIAKIRHRN  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            L++   NPTDQVL+ + +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R 
Sbjct  71   LDAPVANPTDQVLVYKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F+ GK+    E  +L EEIA +K KI+KLESECE +  + KA +   E+ + QSE  L+E
Sbjct  131  FEGGKSVSAAEHKALVEEIAMLKPKIEKLESECEMEASKAKALETEVEALRKQSEGFLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LL +NQ+LRSQ+ A
Sbjct  191  YDRLLADNQNLRSQVQA  207



>ref|XP_002524828.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF37548.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=209

 Score =   208 bits (530),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I+SLDR KRGRGP++VK+V  TVFV+++ +VYS+ +IQ+R +E  ++NPTDQVL+++ +L
Sbjct  18   IMSLDRVKRGRGPVMVKTVGGTVFVVLLSSVYSMVKIQNRTIEGGAVNPTDQVLMSKHML  77

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMGFVLFLSLMIDRLHHYIRELR+LRK MEAAKK  RGF++GKNG  +E  +L EE+
Sbjct  78   EASLMGFVLFLSLMIDRLHHYIRELRILRKTMEAAKKQSRGFEDGKNGSADEAKALGEEV  137

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             ++++KIK LES+ E K +E KA +   E+ + QSE  L+EYG+LLE+NQ+LR+QL +
Sbjct  138  KTLQNKIKYLESKFEEKAKEAKAAEAEVEALRKQSEVFLIEYGRLLEDNQNLRNQLES  195



>ref|XP_006449764.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
 gb|ESR63004.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
Length=223

 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 154/199 (77%), Gaps = 4/199 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R 
Sbjct  11   SEMALIIVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRW  70

Query  406  LES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHD  239
            ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   
Sbjct  71   IDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQS  130

Query  238  RGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLL  59
            RGF++GK  G EE+ +L++++ ++KSK+K+LESE E K +E  A + N+ + + QSE  L
Sbjct  131  RGFEDGKAAGSEEIKALEDQMTTLKSKLKELESELETKSKEANAAETNAVALRKQSEGFL  190

Query  58   LEYGQLLEENQHLRSQLHA  2
             EY +LLEENQ+LR+QL +
Sbjct  191  FEYDRLLEENQNLRNQLQS  209



>ref|XP_007026129.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY28751.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=221

 Score =   208 bits (530),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMAVI++L FKTPLRKL+I+ LDR KRGRGP++VK+VA TV V+M+ +VYS+ +IQ R +
Sbjct  12   EMAVIVVLSFKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVSVVMMSSVYSMMKIQKRWI  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +  + NPTDQVL+A+ +L+A+LMG  LFL+LMIDRLHHYIRELRL RK MEAAKK  RGF
Sbjct  72   DDGAANPTDQVLMAKHLLEATLMGASLFLALMIDRLHHYIRELRLRRKNMEAAKKQGRGF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++ K GG  EV +L+EE+ +++ K K+LES+ E K +E+ A + N+ + + QSE  LLEY
Sbjct  132  EDVKPGGSNEVKALEEEVTALREKFKQLESDLETKTKEMNAAEANAVALRKQSEGFLLEY  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLEENQ+LR+QL +
Sbjct  192  DRLLEENQNLRNQLQS  207



>ref|XP_010046363.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW88772.1| hypothetical protein EUGRSUZ_A01117 [Eucalyptus grandis]
Length=221

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 157/197 (80%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+IL LLFKTPLRKL+I++LDR KRGRGP++VK+V  T+ V++  ++YS+ +IQ R 
Sbjct  11   AEMALILTLLFKTPLRKLVIMALDRVKRGRGPVMVKTVGVTLLVVLASSLYSMVKIQRRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E+  +NPTDQVL+++ +L+ASLMGFVLFLSLM+DRLHHYIRELRLLRK MEAAKK  RG
Sbjct  71   VEAGLLNPTDQVLMSKHMLEASLMGFVLFLSLMLDRLHHYIRELRLLRKTMEAAKKQSRG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             D GKNG  EEV  LKEEIA++++K+ KLE+E   K +E K  +  +E+ K QSE LLLE
Sbjct  131  IDEGKNGSAEEVKGLKEEIATLRTKLNKLENEYGTKDKEAKTAEAEAEALKKQSEGLLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LL +NQ LRSQL +
Sbjct  191  YDRLLADNQSLRSQLES  207



>ref|XP_006383887.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
 gb|ERP61684.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
Length=219

 Score =   206 bits (523),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 157/198 (79%), Gaps = 6/198 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILL +FK+PLRK LI+SLDR KRGRGP++VK+VA TVF+++I +VYS+ +IQ R 
Sbjct  11   SEMAMILLFVFKSPLRKFLIMSLDRLKRGRGPVMVKTVAGTVFLVLISSVYSMVKIQKRG  70

Query  406  LES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    +NPTDQVL+A+ +L+A+LMG +LFLSLMIDRLHHYIRELR+ RK+MEA KK +R
Sbjct  71   IDVGGVVNPTDQVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRRKSMEAVKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
             F++GK   VEE  +L+ E+++++ K+K+L+SE E K +EV   + N+ +   QSE  LL
Sbjct  131  SFEDGK---VEETKALETEVSTLQEKLKQLQSELEVKSKEVNTSEANAAALSKQSEGFLL  187

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+LRSQL +
Sbjct  188  EYDRLLEENQNLRSQLQS  205



>ref|XP_011046959.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=219

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 157/198 (79%), Gaps = 6/198 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILL +FK+P+RK LI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R 
Sbjct  11   SEMAMILLFVFKSPIRKFLIMSLDRLKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRG  70

Query  406  LES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    +NPTDQVL+A+ +L+A+LMG +LFLSLMIDRLHHYIRELR+ RK+MEA KK +R
Sbjct  71   IDVGGVVNPTDQVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRRKSMEAVKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
             F++GK   VEE  +L+ E+++++ K+K+L+SE E K +EV   + N+ +   QSE  LL
Sbjct  131  SFEDGK---VEETKALETEVSTLQEKLKQLQSELEVKTKEVNTSEANAIALSKQSEGFLL  187

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+LRSQL +
Sbjct  188  EYDRLLEENQNLRSQLQS  205



>ref|XP_009629450.1| PREDICTED: uncharacterized protein LOC104119606 [Nicotiana tomentosiformis]
Length=221

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++ +FKTPLRKL+I+ LDR KRGRGP+VVK++  T+FV+M+ T+YSV  I+ R 
Sbjct  11   AEMALIVMFVFKTPLRKLVIMGLDRIKRGRGPIVVKTIGGTIFVVMLSTIYSVVSIRKRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++   +I PTDQ+L+AQ +L+ASLMGF LFL+LM+DRLHHYIRELR+ RK+MEA  K +R
Sbjct  71   IDEDGNITPTDQILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRIRRKSMEAVNKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            GF++GKNG  +++ SL+EE ++++ KIKKLE   E K  E    + NS + K QSE   L
Sbjct  131  GFEDGKNGACDDMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSVALKKQSENFGL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            E   LLE+NQ+LR+QL A
Sbjct  191  ENDSLLEDNQNLRAQLQA  208



>gb|KDO78297.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=223

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R 
Sbjct  11   SEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRW  70

Query  406  LES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHD  239
            ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   
Sbjct  71   IDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQS  130

Query  238  RGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLL  59
            RGF++GK    EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L
Sbjct  131  RGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFL  190

Query  58   LEYGQLLEENQHLRSQLHA  2
             EY +LLEENQ+LR+QL +
Sbjct  191  FEYDRLLEENQNLRNQLQS  209



>ref|XP_006467408.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X2 [Citrus sinensis]
Length=223

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R 
Sbjct  11   SEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRW  70

Query  406  LES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHD  239
            ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   
Sbjct  71   IDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQS  130

Query  238  RGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLL  59
            RGF++GK    EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L
Sbjct  131  RGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFL  190

Query  58   LEYGQLLEENQHLRSQLHA  2
             EY +LLEENQ+LR+QL +
Sbjct  191  FEYDRLLEENQNLRNQLQS  209



>ref|XP_006389583.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
 gb|ABK95443.1| unknown [Populus trichocarpa]
 gb|ERP48497.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
Length=219

 Score =   203 bits (516),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 155/198 (78%), Gaps = 6/198 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILL +FKTPLRKLLI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R 
Sbjct  11   SEMAMILLFVFKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++   ++NPTDQVLLA+ +L+A+LMG +LFL LMIDRLHHYIRELR+ RK ME  KK +R
Sbjct  71   IDDGGAVNPTDQVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRMRRKTMEDVKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
             F++GK   VEE  +L+ E ++++ K+K+LESE E K +EV   + N+ +   QSE  LL
Sbjct  131  SFEDGK---VEETKALEAEASTLREKLKQLESELEIKTKEVNTSEANAVALSKQSEGFLL  187

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+LRSQL +
Sbjct  188  EYDRLLEENQNLRSQLQS  205



>ref|XP_006467407.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
Length=242

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R 
Sbjct  11   SEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRW  70

Query  406  LES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHD  239
            ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   
Sbjct  71   IDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQS  130

Query  238  RGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLL  59
            RGF++GK    EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L
Sbjct  131  RGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFL  190

Query  58   LEYGQLLEENQHLRSQLHA  2
             EY +LLEENQ+LR+QL +
Sbjct  191  FEYDRLLEENQNLRNQLQS  209



>ref|XP_009797812.1| PREDICTED: uncharacterized protein LOC104244159 [Nicotiana sylvestris]
Length=220

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I+L +FKTPLRK++I+ LDR KRGRGP+VVK++  T+F++M+ T+YSV  I+ R 
Sbjct  11   AEMALIVLFVFKTPLRKVVIMGLDRIKRGRGPIVVKTIGGTIFMVMLSTIYSVVSIRKRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++   +I PTDQ+L+AQ +L+ASLMGF LFL+LM+DRLHHYIRELR+ RK+MEA  K +R
Sbjct  71   IDEDGNITPTDQILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRMRRKSMEAVNKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            GF++GKNG  +++ SL+EE ++++ KIKKLE   E K  E    + NS + K QSE   L
Sbjct  131  GFEDGKNGASDDMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSVALKKQSENFRL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            E   LLE+NQ+LR+QL A
Sbjct  191  ENDYLLEDNQNLRAQLQA  208



>ref|XP_011096040.1| PREDICTED: B-cell receptor-associated protein 31 [Sesamum indicum]
Length=221

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 148/197 (75%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +I++ +FKTPLRKL+I+ LDR KRGRGP+VVK+VAAT+FV+M+ +VY+   IQ R 
Sbjct  11   AEMTLIVVFVFKTPLRKLVIMGLDRVKRGRGPVVVKTVAATIFVVMMASVYNAVAIQRRW  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            ++    NPTDQ+L A  IL+ASLMGF LFL+LMIDRLHHYIRELR+ RK MEA KK  R 
Sbjct  71   IQDGEANPTDQILFANHILEASLMGFALFLALMIDRLHHYIRELRIRRKTMEAVKKQSRV  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++ K    EE+ +L+EE  +++ +IK LE++ E K +E  + + N+ + K QSE  LLE
Sbjct  131  FEDSKPPATEEIKALEEETIALRGRIKDLETQLEEKNKESGSAEANAMALKKQSEGFLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ+LRSQL +
Sbjct  191  YDRLLEENQNLRSQLQS  207



>gb|KDO78296.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=308

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++LLFKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R 
Sbjct  11   SEMALIMVLLFKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRW  70

Query  406  LES----INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHD  239
            ++     +NPTDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   
Sbjct  71   IDDEGAVVNPTDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQS  130

Query  238  RGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLL  59
            RGF++GK    EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L
Sbjct  131  RGFEDGKAASSEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFL  190

Query  58   LEYGQLLEENQHLRSQLHA  2
             EY +LLEENQ+LR+QL +
Sbjct  191  FEYDRLLEENQNLRNQLQS  209



>gb|KJB68573.1| hypothetical protein B456_010G251300 [Gossypium raimondii]
Length=222

 Score =   201 bits (510),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMAVI++L FKTP RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ +VYS+ EIQ R 
Sbjct  11   SEMAVIMVLSFKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSVYSMMEIQKRW  70

Query  406  LESINP---TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++   P   TDQVL+ + +L+A+LMG  +FL+LMIDRLHHYIRELR+ RK M+A KK  +
Sbjct  71   VDDDGPVSSTDQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRRKTMDAVKKQGQ  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            G D+ K  G ++V SL+EE+ +++ K+K+LES+ EAK +++ A + N+ + + QSE LLL
Sbjct  131  GSDDKKPDGFDKVKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTVALRKQSEGLLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEEN+ LR QL +
Sbjct  191  EYDRLLEENESLRGQLQS  208



>ref|XP_011008025.1| PREDICTED: uncharacterized protein LOC105113519 [Populus euphratica]
Length=219

 Score =   200 bits (509),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 155/198 (78%), Gaps = 6/198 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILL +FKTPLRKLLI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R 
Sbjct  11   SEMAMILLFVFKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++   ++NPTDQVLLA+ +L+A+LMG +LFL LMIDRLHHYIRELR+ RK ME  KK +R
Sbjct  71   IDDGGAVNPTDQVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRVRRKTMEDVKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
             F++GK   VEE  +L+ E ++++ K+++LESE E K +EV   + N+ +   QSE  LL
Sbjct  131  SFEDGK---VEETKALEAEASTLREKLQQLESELEIKTKEVNTSEANAIALSKQSEGFLL  187

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+LRSQL +
Sbjct  188  EYDRLLEENQNLRSQLQS  205



>gb|KDP20721.1| hypothetical protein JCGZ_21192 [Jatropha curcas]
Length=206

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            ++ LDR KRGRGP+VVK+VA TV V++I +VYS+ +IQ R ++  ++NPTDQVL++  +L
Sbjct  18   LMVLDRVKRGRGPIVVKTVAGTVLVVLISSVYSMMKIQKRWIDEGAVNPTDQVLMSGHLL  77

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            QA+LMGF LFL+LMIDRLHHYIRELR+ RK+MEA KK  R F++GK   VEE  +++EEI
Sbjct  78   QATLMGFCLFLALMIDRLHHYIRELRMRRKSMEAIKKQSRAFEDGK---VEESKAMEEEI  134

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             ++++K+K LES+ E K +E  A + N+ + K Q+E  LLEY +L EENQ+LR+QL +
Sbjct  135  TTLRAKLKHLESDLEMKTKEAHASEANAVALKKQAEGFLLEYDRLHEENQNLRNQLQS  192



>ref|XP_010099186.1| B-cell receptor-associated protein 31 [Morus notabilis]
 gb|EXB77058.1| B-cell receptor-associated protein 31 [Morus notabilis]
Length=209

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 155/194 (80%), Gaps = 2/194 (1%)
 Frame = -1

Query  580  MAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE  401
            MAVI+L+ FKTPLRKL+I++LDR KRGRGP+VVK+V+AT  VL+  +VYS+ +IQ R ++
Sbjct  1    MAVIILMSFKTPLRKLVIMALDRVKRGRGPVVVKTVSATAAVLLASSVYSMVKIQKRWID  60

Query  400  --SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  227
              + NPTDQV++A+ +L+A+LMG  LFL LMIDRLHHYIRELR+ RK +EA KK ++ F+
Sbjct  61   DGASNPTDQVIMAKHLLEATLMGSSLFLVLMIDRLHHYIRELRIRRKTLEAVKKQNQAFE  120

Query  226  NGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYG  47
            +GK GG +E+ + +EE+A++++ +K+LESE E K +++ A + N+ + + QSE  LLEY 
Sbjct  121  DGKTGGSDEIKAKEEEMATLRTTLKQLESELETKTKDIHAAEANAVALQKQSEGFLLEYD  180

Query  46   QLLEENQHLRSQLH  5
            +LLEENQ+LR+QL 
Sbjct  181  RLLEENQNLRNQLQ  194



>ref|XP_004231615.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
lycopersicum]
Length=222

 Score =   199 bits (506),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++ +FKTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+M+ T+YSV  I +R 
Sbjct  11   AEMALIIIFVFKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMMSTIYSVASIHTRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    I PTDQ+LLAQ +L+ASLMGF LFL+ MIDRLHHYIREL + RK MEA KK +R
Sbjct  71   VDEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRRKTMEAVKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
             F++GKNG  EE+ +L+ E ++++ KI++LE E E K +E  + + N+ + K QSE  LL
Sbjct  131  AFEDGKNGASEEIKTLEGEASALREKIRQLELELEEKAKEASSAEANAGALKKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+LRSQL +
Sbjct  191  EYDRLLEENQNLRSQLQS  208



>ref|XP_007046390.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY02222.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=219

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 144/178 (81%), Gaps = 4/178 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            I++LDR KRGRGP+V+ +VAAT+ V++  T+YS+ +IQ R +++  +NPTDQVL+++ +L
Sbjct  30   IMALDRVKRGRGPVVLTTVAATLMVVLASTLYSMLKIQRRTIDAAALNPTDQVLMSKHML  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMGFVLFL+LMIDRLHHYIRELR LRK+ME AKK  +G+++ KN G  E+ +L EE 
Sbjct  90   EASLMGFVLFLALMIDRLHHYIRELRFLRKSMETAKKQSQGYEDRKNAG--ELKALGEET  147

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
              +K+KIKKLESECE K +EV+A +  +E+ + QSE LLLEY +LLE+NQ+L++QL +
Sbjct  148  VILKTKIKKLESECETKSKEVEAAQAEAEALRKQSEGLLLEYDRLLEDNQNLQNQLES  205



>gb|KHG10853.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=219

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 156/196 (80%), Gaps = 4/196 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMAVI++L FKTPLRKL ++ LDR KRGRGPL+VK+VAAT+ V+MI +VYS+  IQ R +
Sbjct  12   EMAVIMVLSFKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSVYSMMMIQKRWI  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +  S NPT+Q+L+ + +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK+MEA KK   G 
Sbjct  72   DDGSANPTEQILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRRKSMEAIKKQ--GP  129

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GK+GG ++V +L+ E+ ++++K+K+LES+ E K +E+ A   N+ + + QSE  LLEY
Sbjct  130  EDGKSGGSDKVKALEGEVTTLQAKLKQLESDLETKTKEMDAADANAVALRKQSEGFLLEY  189

Query  49   GQLLEENQHLRSQLHA  2
             +LLEENQ+LR+QL +
Sbjct  190  DRLLEENQNLRNQLES  205



>ref|XP_004233786.1| PREDICTED: uncharacterized protein LOC101255462 [Solanum lycopersicum]
Length=222

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 148/198 (75%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             E+AVILLL+FKTPLRKL+I+ LDR KRGRGP+VVK+   T+FV+M+ ++YSV  I  R 
Sbjct  11   AEVAVILLLIFKTPLRKLIIMGLDRVKRGRGPIVVKTTGGTIFVVMLSSIYSVVSIHKRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++   ++ PTDQ+L+AQ +L+ASLMGF LFL LMIDRLHHYIRELR+ RK+MEA  K +R
Sbjct  71   IDEDGNVTPTDQILMAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKSMEAVNKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            GF++GKNG  +++ SL+EE  +++ KIKKLE+  E K +E    + N  + K QSE  L 
Sbjct  131  GFEDGKNGASDDMKSLEEEAGALRLKIKKLEATVEEKAKESSDAEANVVALKKQSEHFLR  190

Query  55   EYGQLLEENQHLRSQLHA  2
            E   L EENQ+LR+QL +
Sbjct  191  ENDSLHEENQNLRAQLQS  208



>gb|KHG15358.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=222

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMAVI++L FKTP RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ +VYS+ EIQ R 
Sbjct  11   SEMAVIMVLSFKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSVYSMMEIQKRW  70

Query  406  LESINP---TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            +    P   TDQVL+ + +L+A+LMG  +FL+LMIDRLHHYIRELR+ RK M+A KK  +
Sbjct  71   VGDDGPVSSTDQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRRKTMDAVKKQGQ  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            G ++ K  G +++ SL+EE+ +++ K+K+LES+ EAK +++ A + N+ + + QSE LLL
Sbjct  131  GSNDKKPDGFDKIKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTVALRKQSEGLLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEEN+ LR QL +
Sbjct  191  EYDRLLEENESLRVQLQS  208



>ref|XP_006348141.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+ILLL+FKTPLRKL+I+ LDR KRGRGP+VVK+   T+F++M+ ++YSV  I  R 
Sbjct  11   AEMALILLLIFKTPLRKLVIMGLDRVKRGRGPIVVKTTGGTIFIVMLSSIYSVVSIHKRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++   ++ PTDQ+L+AQ +L+ASLMGF LFL+LMIDRLHHYIRELR+ RK+MEA  K +R
Sbjct  71   IDEDGNVTPTDQILMAQHLLEASLMGFSLFLALMIDRLHHYIRELRMRRKSMEAVNKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            GF++GKNG  +++ SL+EE ++++ KIKKLE+  E K +E    + N  + K QSE  L 
Sbjct  131  GFEDGKNGASDDMKSLEEEASALRLKIKKLEATVEEKAKESSDAEANVVALKKQSEHFLR  190

Query  55   EYGQLLEENQHLRSQLHA  2
            E   L E+NQ+LR+Q+ +
Sbjct  191  ENDSLHEDNQNLRAQVQS  208



>gb|KJB69262.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
 gb|KJB69263.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
Length=219

 Score =   195 bits (496),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 156/196 (80%), Gaps = 4/196 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMAVI++L FKTPLRKL ++ LDR KRGRGPL+VK+VAAT+ V+MI +VYS+  IQ R +
Sbjct  12   EMAVIMVLSFKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSVYSMMTIQKRWI  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +  S NPT+Q+L+ + +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK+MEA KK   G 
Sbjct  72   DDGSANPTEQILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRRKSMEAIKKQ--GP  129

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GK+ G ++V +L+ E+ ++++K+K+LES+ E K +E+ A + N+ + + QSE  LLEY
Sbjct  130  EDGKSSGSDKVKALEGEVTTLQAKLKQLESDLETKTKEMDAAEANAVALRKQSEGFLLEY  189

Query  49   GQLLEENQHLRSQLHA  2
             +LLEENQ+LR+QL +
Sbjct  190  DRLLEENQNLRNQLES  205



>gb|AFK47348.1| unknown [Lotus japonicus]
Length=222

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQVLLAQQI  359
            I+ LDR KRGRGPL+V++V ATV V+++ ++YS+  IQ R +E    +NPTDQVL+A+ +
Sbjct  30   IMGLDRLKRGRGPLMVRTVGATVLVVLLSSLYSMFNIQKRGIEDGGVVNPTDQVLMAKHL  89

Query  358  LQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEE  179
            L+A+LMG VLFL+LMIDRLHHYIRELR+ RK MEA KK  RG D+GK    EE+ +++EE
Sbjct  90   LEATLMGAVLFLALMIDRLHHYIRELRVRRKTMEAVKKQSRGSDDGKAAHSEEIRAMEEE  149

Query  178  IASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
               ++++I +LESE ++K +EV   + N  + + QSE  LLEY +LLEENQ+LR++L +
Sbjct  150  TTKLRAEINRLESELKSKTKEVDGAEANVSALRKQSEGFLLEYDRLLEENQNLRNELQS  208



>ref|XP_003534595.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN40872.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQVLLAQQI  359
            I+ LDR KRGRGPL+VK+VA TV V+   +VYS+  IQ R +E    +NPTDQVL+A+ +
Sbjct  30   IMGLDRLKRGRGPLMVKTVAGTVLVVFFSSVYSMVNIQKRGIEEGAIVNPTDQVLMAKHL  89

Query  358  LQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEE  179
            L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    EE+ +++EE
Sbjct  90   LEATLMGAILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANSEEIKAVEEE  149

Query  178  IASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             A +++++ +LESE ++K ++V A + N  + + QSE  LLEY +LLEENQ+LR+QL +
Sbjct  150  RARLRAELSRLESELQSKTKDVDAAEANVAALRKQSEGFLLEYDRLLEENQNLRNQLQS  208



>gb|ACU14586.1| unknown [Glycine max]
Length=225

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQVLLAQQI  359
            I+ LDR KRGRGPL+VK+VA TV V+   +VYS+  IQ R +E    +NPTDQVL+A+ +
Sbjct  30   IMGLDRLKRGRGPLMVKTVAGTVLVVFFSSVYSMVNIQKRGIEEGAVVNPTDQVLMAKHL  89

Query  358  LQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEE  179
            L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    EE+ +++EE
Sbjct  90   LEATLMGAILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANSEEIKAVEEE  149

Query  178  IASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             A +++++ +LESE ++K ++V A + N  + + QSE  LLEY +LLEENQ+LR+QL +
Sbjct  150  RARLRAELSRLESELQSKTKDVDAAEANVAALRKQSEGFLLEYDRLLEENQNLRNQLQS  208



>gb|KFK40615.1| hypothetical protein AALP_AA2G019200 [Arabis alpina]
Length=221

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 136/178 (76%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL--ESINPTDQVLLAQQIL  356
            I+ LDR+KRGRGP+VVK+V+ T+FV+ + +VYS+ +IQ R     S+NPTD+V++A+ +L
Sbjct  30   IMGLDRSKRGRGPMVVKTVSVTIFVVFVSSVYSMMKIQKRWFVEGSVNPTDEVIMAKHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +++LMG VLFL LMIDRLHHY+RELR+ RK+MEA KK   GF++GK G  +E+  L++E+
Sbjct  90   ESTLMGGVLFLGLMIDRLHHYMRELRVRRKSMEAIKKQTVGFESGKVGASDEIKKLEDEV  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             ++  K K LESE E   +EV++++ NS + + QSE  L+E+ +LLEENQ LR QLH+
Sbjct  150  KALLEKEKHLESELETMTKEVRSEESNSVALQKQSEGFLIEFNRLLEENQKLRDQLHS  207



>gb|EYU27763.1| hypothetical protein MIMGU_mgv1a012919mg [Erythranthe guttata]
Length=236

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 153/214 (71%), Gaps = 23/214 (11%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+I++ +FKTP+RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ TVY+V +IQ R +
Sbjct  12   EMALIVVFVFKTPVRKLVIMGLDRVKRGRGPIVVKTVAGTVFVVMMATVYNVVKIQRRWI  71

Query  403  ESI--NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            + +  NPTDQVLLA+ +L+ASLMGF LFL+LMIDRLHHYIRELR+ RK MEA KK +R F
Sbjct  72   QDVEVNPTDQVLLAKHLLEASLMGFSLFLALMIDRLHHYIRELRIRRKNMEAVKKQNRIF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLE------------------SECEAKGEEVKAQ  104
            ++GK     E+  L+EE  S++ +IK+LE                  ++ E K +E  + 
Sbjct  132  EDGKPL---EIKLLEEEKISLRGRIKQLEAQLEDKTTSLHDRINQLGTQLEEKTKEASSS  188

Query  103  KDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            + N+ + K QSE  LLEY +LLEENQHLRSQL  
Sbjct  189  ETNAIALKKQSEGFLLEYDRLLEENQHLRSQLQT  222



>gb|ACU19065.1| unknown [Glycine max]
Length=200

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +IL L+FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R 
Sbjct  11   SEMLLILTLVFKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            LE+  +NPTDQVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R 
Sbjct  71   LEAGIVNPTDQVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKG  77
            F++GKNG  EE  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K 
Sbjct  131  FEDGKNGNSEEHKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVEALKS  182



>ref|XP_008440020.1| PREDICTED: B-cell receptor-associated protein 29 [Cucumis melo]
Length=221

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 152/197 (77%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +ILL  FKTPLRKL+I+++DR KRGRGP++VK+VA TV ++++ +VYS+  IQ R 
Sbjct  11   SEMVLILLFSFKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSVYSMVTIQKRW  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            ++  +INPTDQVL+ + +L+A+LMG  LFL+LMIDRLHHY+RELRL RK MEA KK  R 
Sbjct  71   IDDGAINPTDQVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRRKGMEAIKKQSRA  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             ++GK    EE+ +L+EE  ++++K+K+LESE ++K ++V A + N  + + QSE LLLE
Sbjct  131  LEDGKVSKSEEIKALEEERTTLETKLKQLESELDSKTKDVTASEANVVALRKQSEGLLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ+LR QL +
Sbjct  191  YDRLLEENQNLRGQLQS  207



>ref|XP_004151895.1| PREDICTED: uncharacterized protein LOC101218101 [Cucumis sativus]
 gb|KGN63240.1| hypothetical protein Csa_2G416790 [Cucumis sativus]
Length=210

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 153/196 (78%), Gaps = 5/196 (3%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            +MA+IL LLF+TPLRKL+I +LDR KRG+GP+VV+++A TVFV+++ +VYS+ +I +R +
Sbjct  12   QMALILTLLFRTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSVYSMLKIHNRMV  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E+  +NPTDQVL++  +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRK ME AKK  R  
Sbjct  72   EAGEVNPTDQVLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKTMEVAKKQIRA-  130

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
               ++   E++ +L EE  +M++KI KLESE E K +E    +  +++ + QSE+ LLEY
Sbjct  131  --SEDASAEKLKALGEEATTMRNKITKLESEVEVKTKEANDAEAETDALRKQSEEYLLEY  188

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ+LR+QL +
Sbjct  189  DRLLEDNQNLRNQLES  204



>gb|KEH36901.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTDQVLLAQQI  359
            I++LDR KRGRGP++VK+VA TV V++  +VYS+ +IQ R +E   S+NPTDQVL+A+ +
Sbjct  30   IMALDRLKRGRGPVMVKTVAGTVLVVLSSSVYSMMKIQQRGIEDGASVNPTDQVLMAKHL  89

Query  358  LQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEE  179
            L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  RG ++ K G  +E  ++++E
Sbjct  90   LEATLMGAILFLALMIDRLHHYIRELRIRRKSMEAVKKQMRGAEDAKAGTSDETKTMEQE  149

Query  178  IASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             A +++++ +LESE ++K +EV A + +  + + QSE  LLEY +LLEENQ+LR+QL +
Sbjct  150  AAKLRAEVGRLESELQSKDKEVGAAEASVSALRKQSEGFLLEYDRLLEENQNLRNQLQS  208



>ref|XP_006350475.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++ +FKTPLRKL+I+ LDR KRGRGP+++K+VA TVFV+M+ T+YSV  I +R 
Sbjct  11   AEMALIIIFVFKTPLRKLVIMGLDRVKRGRGPIIMKTVAGTVFVVMMSTIYSVASIHTRW  70

Query  406  LE---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    I PTDQ+LLAQ +L+ASLMGF LFL+ MID+LHHYIREL + RK MEA KK +R
Sbjct  71   VDEGGDITPTDQILLAQHLLEASLMGFSLFLAFMIDKLHHYIRELSIRRKTMEAVKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
             F++GK+G  EE+ +L+ E ++++ KI++LE E E K +E  + + N+ + K QSE  LL
Sbjct  131  AFEDGKSGASEEIKTLEGEASALREKIRQLELELEEKAKEASSAEANAGALKKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+LRSQL +
Sbjct  191  EYDRLLEENQNLRSQLQS  208



>gb|AFK46642.1| unknown [Medicago truncatula]
Length=222

 Score =   193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTDQVLLAQQI  359
            I++LDR KRGRGP++VK+VA TV V++  +VYS+ +IQ R +E   S+NPTDQVL+A+ +
Sbjct  30   IMALDRLKRGRGPVMVKTVAGTVLVVLSSSVYSMMKIQQRGIEDGASVNPTDQVLMAKHL  89

Query  358  LQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEE  179
            L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  RG ++ K G  +E  ++++E
Sbjct  90   LEATLMGAILFLALMIDRLHHYIRELRIRRKSMEAVKKQMRGAEDAKAGTSDETKTMEQE  149

Query  178  IASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             A +++++ +LESE ++K +EV A +    + + QSE  LLEY +LLEENQ+LR+QL +
Sbjct  150  AAKLRAEVGRLESELQSKDKEVGAAEAGVSALRKQSEGFLLEYDRLLEENQNLRNQLQS  208



>ref|XP_004158560.1| PREDICTED: uncharacterized LOC101218101 [Cucumis sativus]
Length=210

 Score =   192 bits (488),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 153/196 (78%), Gaps = 5/196 (3%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            +MA+IL LLF+TPLRKL+I +LDR KRG+GP+VV+++A TVFV+++ +VYS+ +I +R +
Sbjct  12   QMALILTLLFRTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSVYSMLKIHNRMV  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E+  +NPTDQVL++  +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRK ME AKK  R  
Sbjct  72   EAGEVNPTDQVLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKTMEVAKKQIRA-  130

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
               ++   E++ +L E+  +M++KI KLESE E K +E    +  +++ + QSE+ LLEY
Sbjct  131  --SEDASAEKLKALGEDATTMRNKITKLESEVEVKTKEANDAEAETDALRKQSEEYLLEY  188

Query  49   GQLLEENQHLRSQLHA  2
             +LLE+NQ+LR+QL +
Sbjct  189  DRLLEDNQNLRNQLES  204



>ref|NP_001236308.1| uncharacterized protein LOC100526943 [Glycine max]
 gb|ACU15966.1| unknown [Glycine max]
 gb|KHN33010.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPTDQVLLAQQI  359
            I+ LDR KRGRGPL+VK+VA TV V+++ +VYS+ +IQ R ++    +NPTDQVL+A+ +
Sbjct  30   IMGLDRLKRGRGPLMVKTVAGTVLVVLLSSVYSMLKIQKRGIQEGAVVNPTDQVLMAKHL  89

Query  358  LQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEE  179
            L+A+LM  VLFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    EE+ S++EE
Sbjct  90   LEATLMVAVLFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANSEEIKSVEEE  149

Query  178  IASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             A +++++ +LESE ++K ++V   + N  + + QSE  LLEY +LLEENQ+LR+QL +
Sbjct  150  RARLRAELSRLESELQSKTKDVDGAEANIAALRKQSEGFLLEYDRLLEENQNLRNQLQS  208



>ref|XP_008224696.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=222

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+IL  LF+TP RKL+I+ LD+ KRGRGP+VVK+VA TV V ++ +VYS+ +I++  
Sbjct  11   SEMALILAFLFRTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSVYSIIKIKNSR  70

Query  406  LES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    ++PTDQVL+ + +L+A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +R
Sbjct  71   IDKAAIVSPTDQVLMVKHLLEATLMGCFLFLALMIDRLHHYIRELRIRRKSMEAIKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            G ++GK   ++E+ +L+ EIA++++++K+LESE E K ++V   + N  + + QSE  LL
Sbjct  131  GSEDGKASSLDEIKALENEIATLRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+L++QL +
Sbjct  191  EYDRLLEENQNLKNQLKS  208



>ref|XP_002518447.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF43834.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=218

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 153/196 (78%), Gaps = 5/196 (3%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+IL+L+FKTP RKL+++ LDR KRG GP++VK+VA T+ V++I +VYS+ +IQ R +
Sbjct  12   EMALILILVFKTPFRKLVLMGLDRVKRGSGPIIVKTVAGTILVVLISSVYSMMKIQKRGI  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +   +NPTDQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  R  
Sbjct  72   DEGFVNPTDQVLMAKHLLEATLMGAMLFLALMIDRLHHYIRELRMRRKSMEAVKKQSRVA  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GK    EE  +L EE+ ++++++K+LESE E K +E  A + N+ + + QSE  LLEY
Sbjct  132  EDGK---AEENKALGEEMTTLRARLKQLESELEVKTKEAHASETNAVALRKQSEGFLLEY  188

Query  49   GQLLEENQHLRSQLHA  2
             +LLEENQ+LR+QL +
Sbjct  189  DRLLEENQNLRNQLQS  204



>ref|XP_004486174.1| PREDICTED: B-cell receptor-associated protein 29-like [Cicer 
arietinum]
Length=222

 Score =   190 bits (482),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 135/179 (75%), Gaps = 3/179 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTDQVLLAQQI  359
            I++LDR KRGRGPL+VK++A T+ V++  ++YS+ +IQ R +E   ++NPTDQVL+A+ +
Sbjct  30   IMALDRLKRGRGPLMVKTIAGTLLVVLSSSIYSMLKIQKRGIEDAAAVNPTDQVLMAKHL  89

Query  358  LQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEE  179
            L+A+LMG VLFL+LM+DRLHHYIRELR+ RK+MEA KK  RG ++ K    E+  +++EE
Sbjct  90   LEATLMGAVLFLALMVDRLHHYIRELRIRRKSMEAVKKQMRGSEDAKAATSEDTKAMEEE  149

Query  178  IASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             A +++ + +LESE ++K +EV   + N  + + QSE  LLEY +LLEENQ LR+QL +
Sbjct  150  AAKLRAAVNRLESELQSKNKEVGVSEANVNALRKQSEGFLLEYDRLLEENQSLRNQLQS  208



>ref|XP_007212007.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
 gb|EMJ13206.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
Length=222

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+IL  LF+TP RKL+I+ LD+ KRGRGP+VVK+VA TV V ++ +VYS+ +I++  
Sbjct  11   SEMALILAFLFRTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSVYSIIKIKNSR  70

Query  406  LES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    ++PTDQVL+ + +L+A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +R
Sbjct  71   IDKAAIVSPTDQVLMVKHLLEATLMGCSLFLALMIDRLHHYIRELRIRRKSMEAIKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            G ++GK   ++E+ +L+ EIA+ ++++K+LESE E K ++V   + N  + + QSE  LL
Sbjct  131  GSEDGKASSLDEIKALENEIATSRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+L++QL +
Sbjct  191  EYDRLLEENQNLKNQLKS  208



>ref|XP_004134773.1| PREDICTED: uncharacterized protein LOC101221743 [Cucumis sativus]
 ref|XP_004170033.1| PREDICTED: uncharacterized protein LOC101228301 [Cucumis sativus]
 gb|KGN49093.1| hypothetical protein Csa_6G513570 [Cucumis sativus]
Length=221

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 150/197 (76%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +ILL  FKTPLRKL+I+++DR KRGRGP++VK+VA TV ++++ +VYS+  IQ R 
Sbjct  11   SEMVLILLFSFKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSVYSMVTIQKRW  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            ++  +INPTDQVL+ + +L+A+LMG  LFL+LMIDRLHHY+RELRL RK MEA KK  R 
Sbjct  71   IDDGAINPTDQVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRRKGMEAIKKQSRA  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             ++GK    EE+ +L+EE  ++++K+K+LES  ++K +++   + N  + + QSE LLLE
Sbjct  131  VEDGKVSKSEEIKALEEERTTLETKLKQLESVLDSKTKDITTSEANVVALRKQSEGLLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ+LR QL +
Sbjct  191  YDRLLEENQNLRGQLQS  207



>ref|XP_008229967.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=221

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 154/197 (78%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GEM +IL LLFK+PLRKL+I++LD+ KRG+GP++VK+VA TVFV+++  VY++ +I++R 
Sbjct  11   GEMFLILTLLFKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGVYTLVDIKNRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +ES  +NPTD+VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAM+AAKK  + 
Sbjct  71   IESGMLNPTDEVLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLRKAMDAAKKQSQS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
                KNG  E++ +L +E  ++++KIK LESE E K ++ KA     E+ + QSE LL+E
Sbjct  131  IQEEKNGSSEQLKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVEALRKQSEGLLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LL +NQ+LRSQL +
Sbjct  191  YDRLLADNQNLRSQLTS  207



>ref|XP_007215939.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
 gb|EMJ17138.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
Length=221

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 154/197 (78%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GEM +IL LLFK+PLRKL+I++LD+ KRG+GP++VK+VA TVFV+++  VY++ +I++R 
Sbjct  11   GEMFLILTLLFKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGVYNLVDIKNRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +ES  +NPTD+VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAM+AAKK  + 
Sbjct  71   IESGVLNPTDEVLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLRKAMDAAKKQSQS  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
                KNG  E++ +L +E  ++++KIK LESE E K ++ KA     E+ + QSE LL+E
Sbjct  131  IQEEKNGSSEQLKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVEALRKQSEGLLME  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LL +NQ+LRSQL +
Sbjct  191  YDRLLADNQNLRSQLTS  207



>emb|CDP04423.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 146/197 (74%), Gaps = 5/197 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I++ +FKTPLRKL+I+ +DR KRGRGP VVK+VA T+ V+M+ + Y+   I +R 
Sbjct  11   AEMALIVIFVFKTPLRKLVIMGIDRVKRGRGPTVVKAVAGTLSVVMMSSGYNAVAIHNRW  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             +   INPTDQ+L A  +L+ASLMGF LFL+ MIDRLHHYIRELR+ RK+MEA KK +R 
Sbjct  71   SQDADINPTDQILFANYLLEASLMGFSLFLAFMIDRLHHYIRELRIRRKSMEAGKKQNRI  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             D+GKNG   +  +L+EE A++++K+K LE+E + K +E  + + N  + K QSE  LLE
Sbjct  131  SDDGKNG---DFKALEEESAALRAKVKNLEAELDEKTKEASSAEANKLALKKQSEGFLLE  187

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ LRSQL +
Sbjct  188  YDRLLEENQSLRSQLQS  204



>ref|XP_010458605.1| PREDICTED: uncharacterized protein LOC104739838 [Camelina sativa]
Length=221

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I+SLDRAKRGRGP+V+++V+ATV VL + +VY++  IQ R +E  ++NPTD+V++A+ +L
Sbjct  30   IMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIEDGAVNPTDEVIMAKHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++E+ +LKEEI
Sbjct  90   ESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLDEIKNLKEEI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ LR QLH 
Sbjct  150  TSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQGLRDQLHT  207



>ref|XP_010493468.1| PREDICTED: uncharacterized protein LOC104770706 [Camelina sativa]
Length=221

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I+SLDRAKRGRGP+V+++V+ATV VL + +VY++  IQ R +E  ++NPTD+V++A+ +L
Sbjct  30   IMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIEDGAVNPTDEVIMAKHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++E+ +LKEEI
Sbjct  90   ESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLDEIKNLKEEI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ LR QLH 
Sbjct  150  MSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQDLRDQLHT  207



>gb|KFK35240.1| hypothetical protein AALP_AA5G258500 [Arabis alpina]
Length=221

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 148/197 (75%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             E+ VI+ L FKTP+RKLLI+SLDRAKRGRGP+V+++++ TV V+++ +VYS+  IQ R 
Sbjct  11   SEVVVIMALSFKTPIRKLLIMSLDRAKRGRGPVVIQTISVTVLVVLVASVYSMMNIQKRW  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E  ++NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK   G
Sbjct  71   IEDGAMNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGAG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             +  K   ++EV +LKEEI S++ + K+L SE E + +E++ +K ++ + + QSE  L+E
Sbjct  131  LEGVKAKALDEVKNLKEEIMSLQERQKQLASEIETRSKEIRTEKTSAIALQKQSEGFLIE  190

Query  52   YGQLLEENQHLRSQLHA  2
            + +LLEENQ LR QLH 
Sbjct  191  FNRLLEENQELRDQLHT  207



>ref|XP_010476134.1| PREDICTED: uncharacterized protein LOC104755448 [Camelina sativa]
Length=221

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I+SLDRAKRGRGP+V+++V+ TV VL + +VY++  IQ R +E  ++NPTD+V++A+ +L
Sbjct  30   IMSLDRAKRGRGPVVIQTVSVTVIVLFVASVYNMMAIQKRWIEDGAVNPTDEVIMAKHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++E+ +LKEEI
Sbjct  90   ESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLDEIKNLKEEI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ LR QLH 
Sbjct  150  MSLRKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQGLRDQLHT  207



>ref|XP_008784370.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=221

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I+ LDR KRGRGP++VK+VAAT+ +++  +VYS+ +I+S   E  S+ PTDQVL+++ +L
Sbjct  30   ILGLDRLKRGRGPVMVKTVAATLLIVLASSVYSIAKIRSHSTEIGSLTPTDQVLMSRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL+L+IDRLHHYIRELR LRK MEA  K +R  +  K GG +E+ S  ++I
Sbjct  90   EASLMGYSLFLALIIDRLHHYIRELRGLRKNMEAVMKQNRALEETKGGGSDELKSQDKDI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             ++  +IK L+ E EA+ +E KA + N+ + + QSE  LLEY +LLE+NQ+LR+QL +
Sbjct  150  TNLNEEIKHLKLELEARTKEAKAAEANTTALRKQSEGFLLEYDRLLEDNQNLRNQLQS  207



>ref|XP_010686812.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 147/201 (73%), Gaps = 11/201 (5%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GE A+I+LLLFK+PLRKL+I  LD+ KRGRGP+VVK+V+AT+ +  I T+YS  +IQ R 
Sbjct  11   GEAAMIMLLLFKSPLRKLVIAVLDKIKRGRGPIVVKTVSATISIFFISTLYSTLKIQRRG  70

Query  406  L------ESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
            +      +++NPTDQVL ++ +L+ASLMGF+LFLSLMIDRLHHYIRELRL RK MEA KK
Sbjct  71   IGEDGAPDALNPTDQVLFSKHLLEASLMGFILFLSLMIDRLHHYIRELRLRRKTMEAVKK  130

Query  244  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  65
            +D      K  G EE+ + ++++ + K+ I++LES+ E+K +E    +   E+ + QSE 
Sbjct  131  ND-----VKCAGPEEIKAREQQVETFKAMIRQLESDLESKVKEASTSEATVEALRKQSEG  185

Query  64   LLLEYGQLLEENQHLRSQLHA  2
            LLLEY +LL ENQ  R+QLH 
Sbjct  186  LLLEYDRLLAENQEFRNQLHT  206



>ref|XP_002889902.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66161.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
Length=221

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 150/196 (77%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+ VI+ L FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +
Sbjct  12   EVVVIMALSFKTPMRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMAIQKRWI  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E   +NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     
Sbjct  72   EDGVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALL  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            +  K  G++EV +L EEI S++ + ++L+SE EA+ +E++ ++ ++ + + QSE  L+E+
Sbjct  132  EGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTERTSAVALQKQSEGFLIEF  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLEENQ LR QLHA
Sbjct  192  NRLLEENQVLRDQLHA  207



>ref|XP_006417293.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
 gb|ESQ35646.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
Length=221

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 150/197 (76%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             E+AVI+ L FKTP+RKLLI+SLDRAKRGRGP+V+++++ATV V+++ +VYS+ +IQ R 
Sbjct  11   SEVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVIQTISATVCVVLVASVYSMMKIQKRG  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E  ++NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK    
Sbjct  71   IEDGAMNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKMMEVIKKEGAV  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             +  K    +EV +LKEE+ S++ + K+L SE EA+ +E++ +K ++ + + QSE  L+E
Sbjct  131  LEGVKARASDEVKNLKEEVVSLQERQKQLVSEIEARSKEIRTEKTSAVALEKQSEGFLIE  190

Query  52   YGQLLEENQHLRSQLHA  2
            + +LLEENQ LR QLH 
Sbjct  191  FNRLLEENQDLRDQLHT  207



>ref|XP_004293309.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 150/197 (76%), Gaps = 3/197 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+IL  LF+TPLRKL+I+ LD+ KRGRGP+VVK+ A TVFV+++ ++Y + +I+    
Sbjct  12   EMALILACLFRTPLRKLVIVGLDQIKRGRGPVVVKTAAGTVFVVLLTSLYGMVKIKRSGA  71

Query  403  ESI---NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +++   +PTDQ+L+ + +L+ +LMGF LFL LMIDR+HHYIRELR+ RK MEA KK +RG
Sbjct  72   DAVGILSPTDQILMFKHLLEVTLMGFFLFLVLMIDRIHHYIRELRVRRKTMEAIKKQNRG  131

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             ++GK GG++EV +L+ E+++ + +IK+LES  E   +E  A + + ++ + QSE  LLE
Sbjct  132  SEDGKAGGLDEVKALENEMSTSRLRIKQLESNIETTTKEAHAAEASVDALRKQSEGFLLE  191

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ+L++QL +
Sbjct  192  YDRLLEENQNLKNQLQS  208



>ref|XP_008342021.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342022.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342023.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342024.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
Length=221

 Score =   183 bits (464),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 138/178 (78%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            I++LD+ KRG+GP++VK+VA TVF++++  VY++ +I++R  ES  +NPTD+VL++ ++L
Sbjct  30   ILALDKMKRGKGPVMVKTVAGTVFIVLLANVYNLVDIKNRTNESGVLNPTDEVLMSMKML  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            + SLMGF LFLSLM+DRLHHYIRELR LRKAMEAAK+ ++   + KNG  E++ +L +E 
Sbjct  90   ENSLMGFFLFLSLMMDRLHHYIRELRFLRKAMEAAKRQNQSSQDDKNGSSEQLKTLVQEN  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             ++++KI+ LESE E K ++ KA     E+ + QSE LL+EY +LL +NQ+LRSQL +
Sbjct  150  ETLRTKIETLESEYETKAKKAKAAGSEVEALRKQSEGLLMEYDRLLADNQNLRSQLTS  207



>gb|KHN44866.1| hypothetical protein glysoja_040795 [Glycine soja]
Length=217

 Score =   182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GEM VI   LFKTP RKL+II+LDR KR       K+VAAT+ V++  ++YS+ +I+ R 
Sbjct  11   GEMFVIASFLFKTPARKLVIITLDRVKRVVV----KTVAATLLVVLASSLYSIAKIRRRN  66

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            L++  +NPTDQVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R 
Sbjct  67   LDAPVVNPTDQVLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRS  126

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F++GK+    E  +L EE A +K KI+KLESECE +  + KA +   E+ + QSE  L+E
Sbjct  127  FEDGKSVSAAEHKALLEENAMLKPKIEKLESECEVEASKAKALETEVEALRKQSEGFLME  186

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LL +NQ+LRSQL A
Sbjct  187  YDRLLADNQNLRSQLQA  203



>ref|NP_849648.4| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AAM98189.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28811.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=221

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 149/196 (76%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+ VI+ L FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +
Sbjct  12   EVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWI  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E   +NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     
Sbjct  72   EDGVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALL  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            +  K  G++EV +L EEI S++ + ++L+SE EA+ +E++ +K ++ + + QSE  L+E+
Sbjct  132  EGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAVALQKQSEGFLIEF  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLEENQ LR QLH 
Sbjct  192  NRLLEENQVLRDQLHT  207



>ref|XP_008348138.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=221

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 136/178 (76%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            I++LD+ K+G+GP++VK+VA TVF +++  VY++ +I++R +ES  +NPTD+VL++ ++L
Sbjct  30   ILALDKMKQGKGPVMVKTVAGTVFAVLMADVYNLVDIKNRTIESGVLNPTDEVLMSVKML  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            + SLMGF LFLSLMIDRLHHYIRELR LRKAMEA K+ ++     KNG  +++ ++ +E 
Sbjct  90   EISLMGFFLFLSLMIDRLHHYIRELRFLRKAMEAVKRQNQSSQEEKNGSSKQLKTIVQEN  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             ++++KIK LESE E K ++ +A     E+ + QSE LL+EY +LL +NQ+LRSQL +
Sbjct  150  ETLRTKIKTLESEYETKEKKAEAAGSEVEALRKQSEGLLMEYDRLLADNQNLRSQLTS  207



>emb|CDY34821.1| BnaA09g47470D [Brassica napus]
Length=221

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 150/197 (76%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             E+AVIL L FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VYS+ +IQ R 
Sbjct  11   AEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYSMMKIQKRW  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E  ++NPTD+V++++ +L+++LMG  LFL LMIDRLHHY+RELR+ RK MEA KK    
Sbjct  71   VEEGAMNPTDEVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRRKTMEAIKKEGSV  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             +  K    +EV SLK+EI +++ + K+L +E EAK +E++ ++ +  + + QSE  L+E
Sbjct  131  LEGEKARASDEVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGIALQKQSEGFLIE  190

Query  52   YGQLLEENQHLRSQLHA  2
            + +L EENQ LR+QLH 
Sbjct  191  FNRLSEENQDLRNQLHT  207



>ref|XP_009353295.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009353296.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 134/178 (75%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            I++LD+ KRG+GP++VK+VA TVF +++  V+++ +I++R +ES  + PTD++L++ ++L
Sbjct  30   ILALDKMKRGKGPVMVKTVAGTVFAVLMADVFNLVDIKNRTIESGVLKPTDEILMSMKML  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            + SLMGF LFLSLM DRLHHYIRELR LRKAMEAAK+ ++     KNG  E++ ++ +E 
Sbjct  90   EISLMGFFLFLSLMTDRLHHYIRELRFLRKAMEAAKRQNQSSQEEKNGSSEQLKTIVQEN  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             ++++KIK LE E E K ++ KA     E+ K QSE LL+EY +LL +NQ+L+SQL +
Sbjct  150  ETLRTKIKTLEFEYETKEKKAKAAGSEVEALKKQSEGLLMEYDRLLADNQNLQSQLTS  207



>ref|XP_009118164.1| PREDICTED: uncharacterized protein LOC103843216 [Brassica rapa]
Length=221

 Score =   180 bits (456),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 149/197 (76%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             E+AVIL L FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VY + +IQ R 
Sbjct  11   AEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYGMMKIQKRW  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +E  ++NPTD+V++++ +L+++LMG  LFL LMIDRLHHY+RELR+ RK MEA KK    
Sbjct  71   VEEGAMNPTDEVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRRKTMEAIKKEGSV  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             +  K    +EV SLK+EI +++ + K+L +E EAK +E++ ++ +  + + QSE  L+E
Sbjct  131  LEGEKARASDEVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGIALQKQSEGFLIE  190

Query  52   YGQLLEENQHLRSQLHA  2
            + +L EENQ LR+QLH 
Sbjct  191  FNRLSEENQDLRNQLHT  207



>ref|XP_009347127.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 131/176 (74%), Gaps = 2/176 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            I++LD+ KRG+GP++VK+VA TVF +++  V+++ +I++R +ES  + PTD++L++ ++L
Sbjct  30   ILALDKMKRGKGPVMVKTVAGTVFAVLMADVFNLVDIKNRTIESGVLKPTDEILMSMKML  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            + SLMGF LFLSLM DRLHHYIRELR LRKAMEAAK+ ++     KNG  E++ ++ +E 
Sbjct  90   EISLMGFFLFLSLMTDRLHHYIRELRFLRKAMEAAKRQNQSSQEEKNGSPEQLKTIVQEN  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
             ++K+KIK LESE E   ++ K      E+ + QSE LL+EY +L  +NQ+LRSQL
Sbjct  150  ETLKTKIKTLESEYETNAKKAKVAGSEVEALRKQSEGLLMEYDRLQADNQNLRSQL  205



>ref|XP_003596956.1| hypothetical protein MTR_2g088060 [Medicago truncatula]
 gb|ABN08523.1| Prefoldin [Medicago truncatula]
 gb|AES67207.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 143/197 (73%), Gaps = 3/197 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM +I+  LFKTPLR L+II+L++ KRGRGP++VK+V  TV  ++   +Y++ +IQ R +
Sbjct  12   EMLMIMSFLFKTPLRNLVIITLNKVKRGRGPVIVKTVVGTVVTMLGSALYNIFKIQRRSI  71

Query  403  E---SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            E   +++ TDQVLL+  +LQASL+GFVLFLSLMIDRLHHYIRELRLLR A+E  KK +R 
Sbjct  72   EGFATVDSTDQVLLSNHVLQASLLGFVLFLSLMIDRLHHYIRELRLLRNAVETGKKQNRC  131

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
            F N  N    E  SLKEEI +++ KI+KLESECE KG  VK+ +   E+FK QSE  L+E
Sbjct  132  FQNNTNIKAMEHTSLKEEIGALRFKIEKLESECEVKGSRVKSLEIEVEAFKKQSEGFLME  191

Query  52   YGQLLEENQHLRSQLHA  2
            Y  LL +NQ+LR  L  
Sbjct  192  YDGLLIDNQNLRKLLEC  208



>ref|XP_010533802.1| PREDICTED: uncharacterized protein LOC104809492 [Tarenaya hassleriana]
Length=221

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 153/195 (78%), Gaps = 2/195 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+AVI+ L FKTP+RKLLI+SLDRAKRGRGP+VVK+V ATV V+M  +VYSV +IQ R +
Sbjct  12   EVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVVKTVVATVCVVMASSVYSVMKIQKRWI  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +  ++NPTD+VL+ + +L+++LMG  LFL LMIDRLHHY+RELR+ RK+MEA KK   GF
Sbjct  72   DEGTVNPTDEVLMTRNLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKSMEAIKKQGLGF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GK    +E+ S++E+I S++    +LESE +AK +E ++++ N+ + + QSE  LLE+
Sbjct  132  EDGKAVASDELKSMEEQIRSLQEIKNQLESELDAKAKEARSEESNAVALRKQSEGFLLEF  191

Query  49   GQLLEENQHLRSQLH  5
             +LLEENQ LR+QLH
Sbjct  192  NRLLEENQDLRNQLH  206



>ref|XP_009419329.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=210

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 130/178 (73%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I+ LDR KRGRGP++VK+VA TV +++  ++YS+ +I+SR  E  +  PTDQVL+++ +L
Sbjct  30   ILGLDRFKRGRGPVMVKTVAGTVVIVLASSLYSMAKIRSRSAEFGAFTPTDQVLMSRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL L+IDRLHHYIRELR LRK+MEA  K +R  +  K GG +E+ +   EI
Sbjct  90   EASLMGYSLFLVLIIDRLHHYIRELRGLRKSMEAVMKQNRVLEETKCGGSDEIKTRDREI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            A +  +IK L+ E E + +E +A + N  + K QS+ LL+EY +LLE+NQ++ +QLH+
Sbjct  150  ACLNEQIKHLKFESEERIKEARAAEANVMALKKQSDDLLIEYDRLLEDNQNILNQLHS  207



>ref|XP_009403539.1| PREDICTED: uncharacterized protein LOC103987073 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            ++ LDR KRGRGP++VK+VA TV V++  ++YS+ +I S   E  ++ PTDQVL+++ +L
Sbjct  30   VVGLDRLKRGRGPVMVKTVAGTVLVVLASSLYSIAKISSGSAELGALTPTDQVLMSRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL+L+IDRLHHY+RELR LRK+MEA  K +R  +  K GG  EV +L   I
Sbjct  90   EASLMGYSLFLALIIDRLHHYVRELRGLRKSMEAVLKQNRVLEEAKTGGSSEVKALDGMI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            AS+  +IK+L+SE E + +E KA +  + + K QSE LLLEY +LLE+NQ+LR+QL++
Sbjct  150  ASLNEQIKQLKSESEDRLQEAKAAEARAAALKKQSEDLLLEYDRLLEDNQNLRNQLNS  207



>ref|XP_007147709.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
 gb|ESW19703.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
Length=222

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPTDQVLLAQQI  359
            I+ LDR KRGRGPL+VK+VA T+ V+++ +VYS+ +IQ   +E   S+NPTDQVL+A+ +
Sbjct  30   IMGLDRLKRGRGPLIVKTVAGTILVVLLSSVYSMIKIQKHEIEDGGSVNPTDQVLMAKHL  89

Query  358  LQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEE  179
            L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    EE+ +++EE
Sbjct  90   LEATLMGGILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGSEDGKFTFSEEMKAVEEE  149

Query  178  IASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             A +++++++LESE ++K ++    + N  + + QSE  LLEY +LLEENQ+LRSQL +
Sbjct  150  RARLRAELRRLESELQSKTKDADIAEANVSALRKQSEGFLLEYDRLLEENQNLRSQLQS  208



>gb|KHN36526.1| ATP-dependent helicase rhp16 [Glycine soja]
Length=1121

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = -1

Query  493   PLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQASLMGFVLFLS  320
             P+VVK+VAAT+ V++  ++YS+ +I+ R L++   NPTDQVL+ + +L+ASLMGFVLFLS
Sbjct  942   PVVVKTVAATLLVVLASSLYSIAKIRHRNLDAPVANPTDQVLVYKHMLEASLMGFVLFLS  1001

Query  319   LMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLES  140
             LMIDRLHHYIRELRLLRKAMEAAKK  R F+ GK+    E  +L EEIA +K KI+KLES
Sbjct  1002  LMIDRLHHYIRELRLLRKAMEAAKKQSRSFEGGKSVSAAEHKALVEEIAMLKPKIEKLES  1061

Query  139   ECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             ECE +  + KA +   E+ + QSE  L+EY +LL +NQ+LRSQ+ A
Sbjct  1062  ECEMEASKAKALETEVEALRKQSEGFLMEYDRLLADNQNLRSQVQA  1107



>ref|XP_002320470.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
 gb|ABK92570.1| unknown [Populus trichocarpa]
 gb|EEE98785.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
Length=218

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 156/196 (80%), Gaps = 5/196 (3%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM VIL L+F+ PLRK +I+ LDR KRGRGP+VVK+VA T+ VL++  VYS+  +Q+R +
Sbjct  12   EMGVILTLIFRNPLRKFVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNVYSIGNMQNRKM  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E+  +NPT++VL+A Q+LQASL+GF+LFLSLMIDRLHHYIRELRLLRKAMEAAKK +R F
Sbjct  72   EAGALNPTEEVLMAMQLLQASLLGFLLFLSLMIDRLHHYIRELRLLRKAMEAAKKQNRSF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GKNG   E   L EE+ +++SK+KKLESE EAK +E +A +  +E+ + QSE  LL+Y
Sbjct  132  EDGKNG---EGKGLGEEVETLRSKVKKLESEYEAKVKEAEAAEAKAEALRKQSEGSLLQY  188

Query  49   GQLLEENQHLRSQLHA  2
              LLE+NQ LR+QL +
Sbjct  189  DHLLEDNQSLRNQLDS  204



>ref|XP_008780367.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
 ref|XP_008780411.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
Length=221

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -1

Query  526  ISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQ  353
            + LD  KRGRGP++VK+VA TV +++  +VYS+ EI+ R  E  S+ PTDQVL++Q +L+
Sbjct  31   LGLDHLKRGRGPVMVKTVAGTVLLVLASSVYSMVEIRGRFTEIGSLTPTDQVLMSQNLLE  90

Query  352  ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIA  173
            ASLMG+ LFL+L+IDRLHHYIRELR LRK+MEA  K +R  +  KNGG +E+ S  +E+ 
Sbjct  91   ASLMGYSLFLALIIDRLHHYIRELRRLRKSMEAVMKQNRALEETKNGGSDELKSRDKEVT  150

Query  172  SMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            ++  +IK+L+ E EA+ +E KA + ++ + K QSE  LLEY  LLE+N++LR+QL +
Sbjct  151  NLNEQIKQLKLELEARTKEAKAAEASATALKKQSEGFLLEYDHLLEDNKNLRNQLQS  207



>ref|XP_011047243.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=218

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 156/196 (80%), Gaps = 5/196 (3%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM VIL L+F+ PLRKL+I+ LDR KRGRGP+VVK+VA T+ VL++  VY++  IQ+R +
Sbjct  12   EMGVILTLIFRNPLRKLVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNVYTIGNIQNRKM  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E+  +NPTD+VL+A  +LQASL+GF+LFLSLMIDRLHHYIRELRLLRKAMEAAKK +R F
Sbjct  72   EAGALNPTDEVLMAMLLLQASLLGFLLFLSLMIDRLHHYIRELRLLRKAMEAAKKQNRSF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            ++GKNG   E   L EE+ +++SK+KKLESE EAK +E +A +  +E+ + QSE  LL+Y
Sbjct  132  EDGKNG---EGKGLGEEVEALRSKVKKLESEYEAKVKEAEAAEAKAEALRKQSEGSLLQY  188

Query  49   GQLLEENQHLRSQLHA  2
              LLE+NQ LR+QL +
Sbjct  189  DHLLEDNQSLRNQLDS  204



>ref|XP_009390004.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390005.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             E+AV+ +LLF TPLRKL ++ LDR KRGRGPLVV+++AAT  V++  ++YS+ +I SR 
Sbjct  11   AEVAVVGVLLFNTPLRKLALLGLDRLKRGRGPLVVRTIAATGLVVLGSSLYSMSKIWSRS  70

Query  406  --LESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
              + ++ PTDQVL ++  L+ASLMG+ LFL+L+IDRLHHYIRE R LRK+MEAA K +R 
Sbjct  71   DQIGALTPTDQVLHSRHFLEASLMGYSLFLALIIDRLHHYIREWRGLRKSMEAATKQNRL  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             +  K+G  +E+   +E+I S+  +I++L+   E + +EVK  + N+ + + QSE LLLE
Sbjct  131  LEEAKSGKSDEIKGREEKITSLNEEIQQLKLASEERMKEVKTAEANAIALRKQSEGLLLE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLE+NQ+LRSQL +
Sbjct  191  YDRLLEDNQNLRSQLQS  207



>ref|XP_010546686.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
 ref|XP_010546696.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
Length=221

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 151/196 (77%), Gaps = 2/196 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+AVI+ L FKTP+RKLLI+SLDRAKRGRGP+VVK+VAATV V+M  +VYS+ +IQ R +
Sbjct  12   EVAVIMALSFKTPIRKLLIMSLDRAKRGRGPVVVKTVAATVCVVMASSVYSMMKIQKRWI  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +  ++NPTD+VL+ + +L+++LMG  LFL LM DRLHHY+RELR+ RK+MEA KK   GF
Sbjct  72   DEGTVNPTDEVLMKKNLLESTLMGGFLFLGLMTDRLHHYMRELRVRRKSMEAIKKQGLGF  131

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            + GK G  +E+  ++E+I +++   K+LESE EAK +E   ++  + + + QSE  LLE+
Sbjct  132  NGGKPGNSDEIKGMEEQIRTLQEIQKQLESELEAKTKEANGEESGAVALRQQSEGFLLEF  191

Query  49   GQLLEENQHLRSQLHA  2
             +LLEENQ LR+QL++
Sbjct  192  NRLLEENQELRNQLNS  207



>ref|XP_008649481.1| PREDICTED: uncharacterized protein LOC103630179 [Zea mays]
 gb|AFW77553.1| hypothetical protein ZEAMMB73_124915 [Zea mays]
Length=221

 Score =   169 bits (429),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQVLLAQQIL  356
            ++++DRAKRGRGP++ K++A T+ ++++   YSV +I+ R   L  + PTDQVL ++ +L
Sbjct  30   LLAIDRAKRGRGPVMAKTIAGTMLLVLVSAFYSVAKIRRREGELGQLTPTDQVLASRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL L+IDRLHHYIRELR+LRK MEA  +  R  +  K+G  +E+   ++E+
Sbjct  90   EASLMGYSLFLGLIIDRLHHYIRELRMLRKDMEAVTEQGRTLEAAKSGSTDEIQGYQKEV  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            AS+K ++++L+++ + K E +K  + NS + + QSE LL EY +L+ EN+ LR QL +
Sbjct  150  ASLKEQVQELQNQSQKKTERLKTAEANSVALQKQSEGLLAEYDRLIAENRDLRDQLQS  207



>ref|XP_006303826.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
 gb|EOA36724.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
Length=221

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 137/178 (77%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I+SLDRAKRGRGP+V+++V+ATV VL++ +VY++  IQ R +E  ++NPTD+V++A+ +L
Sbjct  30   IMSLDRAKRGRGPVVIQTVSATVIVLLVASVYNMMGIQKRWIEDGAVNPTDEVIMAKHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +++LMG +LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++E+ +LKEEI
Sbjct  90   ESTLMGGLLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLDEIKTLKEEI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             S++ + ++L+SE EAK +E++ +K ++ + + QSE  L+E+ +LLEENQ LR QLH 
Sbjct  150  MSLRKRQEQLDSELEAKSKEIRTEKTSAVALQKQSEGFLIEFNRLLEENQDLREQLHT  207



>ref|XP_010926189.1| PREDICTED: uncharacterized protein LOC105048548 [Elaeis guineensis]
Length=221

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            I+ LDR KRGRGP++VK+VA TV V++  +VYS+ +I+ R  E+  + PTDQVL++Q +L
Sbjct  30   ILGLDRLKRGRGPVMVKTVAGTVLVVLASSVYSMLKIRDRSAETGFLTPTDQVLMSQNLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL+L+IDRLHHYIRELR LRK+MEA  K +R  +  KNGG +++ S  +E 
Sbjct  90   EASLMGYSLFLALIIDRLHHYIRELRGLRKSMEAVMKQNRALEETKNGGSDDLKSRDKET  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
              +  +IK+L+ E +A  +E KA + N+ +   QSE LL EY +LLE+N++LR+QL +
Sbjct  150  TDLNEQIKQLKLELDAISKEAKAAEANATALGKQSEGLLQEYDRLLEDNKNLRNQLQS  207



>emb|CDY34616.1| BnaC08g41750D [Brassica napus]
Length=224

 Score =   167 bits (423),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 146/200 (73%), Gaps = 5/200 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             E+AVIL L FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VYS+ +IQ R 
Sbjct  11   AEVAVILALSFKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYSMMKIQKRW  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSL---MIDRLHHYIRELRLLRKAMEAAKKH  242
            +E  + NPTD+V++++ +L+++LMG   F S+   MIDRLHHY+RELR+ RK ME  KK 
Sbjct  71   VEEGATNPTDEVIMSKHLLESTLMGKSSFASVAAEMIDRLHHYMRELRMRRKTMEVIKKE  130

Query  241  DRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKL  62
                +  K    +EV SLK+EI +++ + K+L +E EA  +E++ ++ +  + + QSE  
Sbjct  131  GSVLEGEKARASDEVKSLKQEITALQERQKQLAAEMEAMSKEIRTEETSGIALQKQSEGF  190

Query  61   LLEYGQLLEENQHLRSQLHA  2
            L+E+ +L EENQ LR+QLH 
Sbjct  191  LIEFNRLSEENQDLRNQLHT  210



>ref|XP_010916117.1| PREDICTED: uncharacterized protein LOC105041025 [Elaeis guineensis]
Length=221

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 130/178 (73%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I+ LDR KRGRGP++VK+VA TV +++  +VYS+ +I+S   E  S+ PTDQVL+++ +L
Sbjct  30   ILGLDRLKRGRGPVMVKTVAGTVLIVLASSVYSMAKIRSHSTEIGSLTPTDQVLMSRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL+L+IDRLHHYIRELR LRK MEA  K +R  +  K+GG +E+    +EI
Sbjct  90   EASLMGYSLFLALIIDRLHHYIRELRGLRKNMEAVMKQNRALEETKSGGSDELKLRDKEI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
              +  +IK+L  + E+  +E KA + N+ + + QSE  LLEY +LLE+NQ+LR+QL +
Sbjct  150  TYLNEQIKQLNLKLESSTKEAKAAEANATALRKQSEGFLLEYDRLLEDNQNLRNQLQS  207



>ref|XP_010089483.1| hypothetical protein L484_011937 [Morus notabilis]
 gb|EXB37876.1| hypothetical protein L484_011937 [Morus notabilis]
Length=253

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 152/226 (67%), Gaps = 34/226 (15%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM +IL L+FKTPLR+L++++LD+ KRGRGP++VK++A TVF+L + +V S   IQ+   
Sbjct  12   EMVLILTLIFKTPLRQLVLMALDKVKRGRGPVMVKTIAITVFLLFVVSVCSFVNIQNHIT  71

Query  403  ES---INPTDQVLLAQQILQASLMGFVL-----FLSLMID--------------------  308
            E+   INPTDQVL+A+ +L+ASLMGF L     F +L ++                    
Sbjct  72   EAGGGINPTDQVLMAKHLLEASLMGFQLEIIMNFPNLYVEGSHLGFASITAIMKDYAIIA  131

Query  307  ------RLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKL  146
                  RLHHYIRELR+LRK MEAAKK +RG +NGKNG   E+ + +++IA +K+ IKKL
Sbjct  132  SVYKNYRLHHYIRELRILRKTMEAAKKQNRGHENGKNGNAAELKASEQDIAQLKATIKKL  191

Query  145  ESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            ESEC+ K EE +A +  +E+ K QSE  L+EY  LL ENQ+LR+QL
Sbjct  192  ESECKTKTEEAEAAEGKAEALKKQSEGFLMEYDHLLAENQNLRNQL  237



>ref|XP_011086195.1| PREDICTED: B-cell receptor-associated protein 31-like [Sesamum 
indicum]
Length=221

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 140/197 (71%), Gaps = 2/197 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+I+L +FK PLRK +I+ LDR KRG GP+VV++V  TVFV+M+ T+Y+   I+ R 
Sbjct  11   AEMALIVLFIFKNPLRKTVIMGLDRIKRGSGPIVVQTVGGTVFVVMLATLYNAVAIKRRQ  70

Query  406  LE--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +   + + TDQ+L A+ +L ASLMGF LFL L IDRLHHYIRELR+ RK++EA KK ++ 
Sbjct  71   MRDATTDSTDQILCARHLLGASLMGFSLFLVLTIDRLHHYIRELRIWRKSIEALKKQNQA  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             ++ K    +++  ++EE A+++ +IK+LE++ E K +E      ++ + K QS+  L+E
Sbjct  131  LEDEKPAVSKQIKVMEEEKATLQERIKELETQLEEKSKEASRAGASAVALKKQSDGFLIE  190

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ LRSQL +
Sbjct  191  YERLLEENQKLRSQLQS  207



>ref|NP_001055067.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|AAT85231.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16981.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|EAY97334.1| hypothetical protein OsI_19258 [Oryza sativa Indica Group]
 dbj|BAG97944.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63061.1| hypothetical protein OsJ_17869 [Oryza sativa Japonica Group]
Length=221

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            ++++DRAKRGRGP++VK+VAAT+ V++  + YS+ +I+ R   L  + PTDQVL ++ +L
Sbjct  30   LLAIDRAKRGRGPVMVKTVAATMLVVLGSSGYSIAKIRRRVGDLGQLTPTDQVLASRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL L+IDRLHHYIRELR ++K MEA  K  R  +  K+G VEE+   ++EI
Sbjct  90   EASLMGYSLFLGLIIDRLHHYIRELRTMKKNMEAVTKQSRTLEEAKHGSVEEIQQYQKEI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            + +  ++++ +   E K EE+K  + N+ + + QSE LL EY +L+ EN+  R+QL +
Sbjct  150  SRLNEQVQEFKRLSETKTEELKTAEANTLALQKQSEGLLTEYERLIAENEEFRNQLQS  207



>ref|XP_006654198.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=221

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            +++LDRAKRGRGP++V++VAAT+ V++  + YS+ +I+ R   L  + PTDQVL ++ +L
Sbjct  30   LLALDRAKRGRGPVMVRTVAATMIVVLGSSGYSIAKIRRRVGDLGQLTPTDQVLASRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL ++IDRLHHYIRELR ++K MEA  K  R  +  K+G VE +   ++EI
Sbjct  90   EASLMGYSLFLGIIIDRLHHYIRELRTMKKNMEAVTKQSRVLEEAKHGSVEGIQQYQKEI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            +S+  ++++L+   E K EE+K  + N+ + + QSE LL EY +L+ EN+  RSQL +
Sbjct  150  SSLNEQVQELKRLSEKKTEELKTAEANALALQKQSEGLLTEYERLIAENEQFRSQLQS  207



>ref|XP_006647215.1| PREDICTED: B-cell receptor-associated protein 29-like [Oryza 
brachyantha]
Length=225

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 124/188 (66%), Gaps = 12/188 (6%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-----------SINPT  386
            ++ +D  KRGR  P+ VK+VA  V  L+  T+YS+ EI  R              S++PT
Sbjct  30   VLGIDCLKRGRRAPVAVKTVAGVVTALLTSTLYSMAEISGRAGGDPESGGGGGGASLSPT  89

Query  385  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  206
            DQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++  +  K+G +
Sbjct  90   DQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVSKHNKMLEEAKHGSI  149

Query  205  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  26
            EE    +EEIA++   +KKL+ + + K EE    +D + + + QSE LLLEY +LLE+NQ
Sbjct  150  EETKKYQEEIAALNEDMKKLKLQVQEKTEEAHIAEDKALAIRKQSESLLLEYDRLLEDNQ  209

Query  25   HLRSQLHA  2
            HLR QLH+
Sbjct  210  HLREQLHS  217



>gb|EMT11422.1| hypothetical protein F775_31561 [Aegilops tauschii]
Length=222

 Score =   164 bits (416),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SINPTDQVL  374
            ++ LDR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R  +       +++PTDQVL
Sbjct  30   MLGLDRLKRGRRAPVAVKTVAGVVITLLASTLYSMAEISGRAGDPEAGGGAALSPTDQVL  89

Query  373  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  194
             ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  + GK+G  +E+ 
Sbjct  90   FSRHLLEASLMGYTLFLALVIDRLHQYIRELRGLKKNVEAVSKQNKTLEEGKHGRSQEIA  149

Query  193  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRS  14
              +EE+A++  ++KKL+ + + K EEV   +D + + + QSE LLLEY +LLE+NQHLR 
Sbjct  150  KYQEEVATLNEEMKKLKLQVQEKTEEVHVAEDKALAIQKQSESLLLEYDRLLEDNQHLRE  209

Query  13   QLHA  2
            QL +
Sbjct  210  QLQS  213



>dbj|BAK02060.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 128/184 (70%), Gaps = 8/184 (4%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SINPTDQVL  374
            ++ LDR KRGR  P+ VK+VA  VF L+  T+YS+ EI  R  +       +++PTDQVL
Sbjct  30   MLGLDRLKRGRRAPVAVKTVAGVVFTLLASTLYSMAEISGRAGDPEGGGGAALSPTDQVL  89

Query  373  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  194
             ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  + GK+G  +E+ 
Sbjct  90   FSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVSKQNKMLEEGKHGRSQEIA  149

Query  193  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRS  14
              +EE+A++  ++KKL+ + + K +EV   +D + + + QSE LLLEY +LLE+NQHLR 
Sbjct  150  KYQEEVATLNEEMKKLKLQVQEKTKEVHVAQDKTLAIQKQSESLLLEYDRLLEDNQHLRE  209

Query  13   QLHA  2
            QL +
Sbjct  210  QLQS  213



>ref|XP_004287957.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 146/195 (75%), Gaps = 5/195 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             +MA+IL LLFK+PLRKL+I+ LD+ KRG+GP+VVK+V  TV  ++   +Y++ E++SR 
Sbjct  11   SQMALILTLLFKSPLRKLVILGLDKLKRGKGPVVVKTVGGTVAAVLCANIYNLNELKSRT  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             E+  +NPTD+VL++ ++L+ SLMGF LFLSLMIDRLHHYIRELR LRKAMEAAKK ++ 
Sbjct  71   NEAGMLNPTDEVLMSMKLLEISLMGFFLFLSLMIDRLHHYIRELRFLRKAMEAAKKQNQP  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
                K+ G +   +L +E  ++++K+K LESE E K ++ KA     ++ K QSE LLLE
Sbjct  131  TQEEKSEGHK---TLVQENETLRAKVKNLESEHETKEKKAKATGAEVQALKKQSEGLLLE  187

Query  52   YGQLLEENQHLRSQL  8
            Y +LLEENQHLR QL
Sbjct  188  YDRLLEENQHLRDQL  202



>ref|NP_001046689.1| Os02g0321800 [Oryza sativa Japonica Group]
 dbj|BAD28852.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08603.1| Os02g0321800 [Oryza sativa Japonica Group]
 gb|EAZ22804.1| hypothetical protein OsJ_06479 [Oryza sativa Japonica Group]
 dbj|BAG92174.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 123/188 (65%), Gaps = 12/188 (6%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-----------SINPT  386
            ++ +DR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R              S++PT
Sbjct  30   VMGIDRLKRGRRAPVAVKTVAGVVLALLASTLYSMAEISGRAGGDPESGGGGGGASLSPT  89

Query  385  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  206
            DQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++  +  K+G  
Sbjct  90   DQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVTKHNKMLEEAKHGRS  149

Query  205  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  26
            EE    +EEI ++   +KKL+ + + K EEV   +D + + + QSE LLLEY +LLE+NQ
Sbjct  150  EETKKYQEEIGALNEDMKKLKLQVQEKTEEVHVAEDKALAIRKQSESLLLEYDRLLEDNQ  209

Query  25   HLRSQLHA  2
            HLR QL +
Sbjct  210  HLREQLQS  217



>ref|XP_008384089.1| PREDICTED: B-cell receptor-associated protein 29-like [Malus 
domestica]
Length=222

 Score =   162 bits (409),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 148/198 (75%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +IL  LF+TP RKL+I+ LD+ KRGRGP+VVK+VAATVFV+++  VYS+ +I+   
Sbjct  11   SEMVLILAFLFRTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVLMTNVYSIVKIRGSR  70

Query  406  LES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    ++PTDQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK MEA KK +R
Sbjct  71   IDKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKGMEALKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            G ++GK+  ++++  L+ E+A++ +++K+LESE E K ++V   + +  + + QSE  LL
Sbjct  131  GSEDGKSSSLDKMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSILALRKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+L+  L +
Sbjct  191  EYDRLLEENQNLKXXLQS  208



>ref|XP_010234160.1| PREDICTED: uncharacterized protein LOC100839925 [Brachypodium 
distachyon]
Length=222

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 125/184 (68%), Gaps = 8/184 (4%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SINPTDQVL  374
            ++ LDR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R  +       +++PTDQVL
Sbjct  30   VLGLDRLKRGRRAPVAVKTVAGVVLTLLASTLYSMAEISGRTGDPESGGGGALSPTDQVL  89

Query  373  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  194
             ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  +  K+G  EE  
Sbjct  90   FSRHLLEASLMGYSLFLALIIDRLHQYIRELRGLKKNVEAVSKQNKMLEETKHGRNEETI  149

Query  193  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRS  14
              +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LLLEY +LLE+NQHLR 
Sbjct  150  KYQEEIATLNEEMKKLKLQVQEKTEEVHVAEDKALAIRKQSENLLLEYDRLLEDNQHLRE  209

Query  13   QLHA  2
            QL +
Sbjct  210  QLQS  213



>gb|EAY85610.1| hypothetical protein OsI_06982 [Oryza sativa Indica Group]
Length=227

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 123/189 (65%), Gaps = 13/189 (7%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRP------------LESINP  389
            ++ +DR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R               S++P
Sbjct  30   VMGIDRLKRGRRAPVAVKTVAGVVLALLASTLYSMAEISGRAGGDPESGGGGGGGASLSP  89

Query  388  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  209
            TDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++  +  K+G 
Sbjct  90   TDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVIKHNKMLEEAKHGR  149

Query  208  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  29
             EE    +EEI ++   +KKL+ + + K EEV   +D + + + QSE LLLEY +LLE+N
Sbjct  150  SEETKKYQEEIGALNEDMKKLKLQVQEKTEEVHVAEDKALAIRKQSESLLLEYDRLLEDN  209

Query  28   QHLRSQLHA  2
            QHLR QL +
Sbjct  210  QHLREQLQS  218



>ref|XP_010057913.1| PREDICTED: B-cell receptor-associated protein 31-like [Eucalyptus 
grandis]
 gb|KCW75271.1| hypothetical protein EUGRSUZ_E04024 [Eucalyptus grandis]
Length=223

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE----SINPTDQVLLAQQ  362
            I+ LDR KRG GP+VV +VAATV V++   VYS+ +I+ R  E    + NPTDQVL+A+ 
Sbjct  30   IVGLDRVKRGHGPVVVTTVAATVCVVLGSGVYSMVKIRRRGAEDGGGAANPTDQVLMAKH  89

Query  361  ILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKE  182
            +L+ +LMG  LFL+LMIDRLHHYIRELRL RK+MEA KK  R F++GKNG +EE+ +L+E
Sbjct  90   LLECTLMGATLFLALMIDRLHHYIRELRLRRKSMEAVKKQTRAFEDGKNGNLEELKNLEE  149

Query  181  EIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            E   ++ K+K+LES+ + + ++V A + NS + + QSE  LLEY +LLEENQ+LR+QL +
Sbjct  150  ETRVLREKVKQLESDLDTRTKDVHAAEANSVALRKQSEGFLLEYDRLLEENQNLRNQLQS  209



>ref|NP_001170289.1| LOC100384252 [Zea mays]
 gb|ACG36076.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|AFW71005.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=220

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 122/180 (68%), Gaps = 6/180 (3%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES-----INPTDQVLLA  368
            ++ +DR KRGR  P+VVK+VA  +  L+  T+YS+ +I     +S       PTDQVL +
Sbjct  30   VLVIDRLKRGRHAPVVVKTVAGVILALLASTLYSMTQIAGSTSDSDSGGGPTPTDQVLFS  89

Query  367  QQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSL  188
            + +L+A LMG+ LFL+L+IDRLH YIR+LR  +K +EA +KH++  +  K+G  EE    
Sbjct  90   RHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKMLEEAKHGNSEEAKKY  149

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LL EY +LLE+NQHLR+QL
Sbjct  150  QEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTEYDRLLEDNQHLRTQL  209



>ref|XP_009357471.1| PREDICTED: uncharacterized protein LOC103948199 [Pyrus x bretschneideri]
Length=222

 Score =   159 bits (402),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 148/198 (75%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +IL  LF+TP RKL+I+ LD+ KRGRGP+VVK+VAATV V+++  VYS+ +I+   
Sbjct  11   SEMVLILAFLFRTPFRKLVILGLDQIKRGRGPVVVKTVAATVLVVLMTNVYSIVKIRGSR  70

Query  406  LES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    ++PTDQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK MEA KK +R
Sbjct  71   IDKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKGMEALKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            G ++GK+  ++++  L+ E+A++ +++K+LESE E K ++V   + +  + + QSE  LL
Sbjct  131  GSEDGKSSSLDKMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSVLALRKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ+ +++L +
Sbjct  191  EYDRLLEENQNFKNRLQS  208



>ref|XP_009358864.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=222

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EM +IL  LFKTP RKL+I+ LD+ KRGRGP+VVK+VAATVFV+++  VYS+ +I++  
Sbjct  11   SEMVMILAFLFKTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVVMTNVYSIVKIRASR  70

Query  406  LES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ++    ++PTDQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +R
Sbjct  71   IDKAAVLSPTDQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKSMEALKKQNR  130

Query  235  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  56
            G ++GK+  ++++   + E+A++++++K+LESE E K ++V   + N  + + QSE  LL
Sbjct  131  GSEDGKSSILDQMKVSENEMATLRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLL  190

Query  55   EYGQLLEENQHLRSQLHA  2
            EY +LLEENQ L++QL +
Sbjct  191  EYDRLLEENQKLKNQLKS  208



>ref|XP_003580219.1| PREDICTED: B-cell receptor-associated protein 31-like [Brachypodium 
distachyon]
Length=221

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            ++++DR+KRGRGP++ ++VAAT+F+++  + YS+ +I+ R      + PTDQVL ++ +L
Sbjct  30   LLAVDRSKRGRGPIMARTVAATMFMVLGSSGYSIAKIRRREGDFAQLTPTDQVLASRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL L+IDRLHHYIR++R ++K+MEA  K  +  +  K  G EE+   +++I
Sbjct  90   EASLMGYSLFLGLVIDRLHHYIRQIRTMKKSMEAVTKQSKTLEEAKLQGAEEIQGYQKKI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            +S+  +++ ++ + E K EE+K  + N+ + + QSE LL EY +L+ EN+ LR++L +
Sbjct  150  SSLNEQVQAVKHQYETKTEELKTAEANTLALRKQSEGLLTEYERLIAENEELRNKLQS  207



>ref|XP_004952370.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=219

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 118/182 (65%), Gaps = 6/182 (3%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES-----INPTDQVLLA  368
            ++ LDR KRGR  P+ VK+VA     L+  T+YS+ EI  R  +      + PTDQVL +
Sbjct  30   VLGLDRLKRGRRAPVAVKTVAGVFLALLASTLYSMAEISGRASDPDSGGGLTPTDQVLFS  89

Query  367  QQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSL  188
            + +L+ASLMG+ LFL L+IDRLH YIR+LR  +K +EA  KH+   +  K G  EE    
Sbjct  90   RHLLEASLMGYTLFLMLVIDRLHQYIRDLRGFKKNLEAVSKHNNMLEEAKVGISEETKKY  149

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            +EEIA++  ++ KL+ + + K EEV   +D + + + QSE LL+EY +LLE+NQHLR QL
Sbjct  150  QEEIANLNKEMNKLKLQVQEKTEEVHVAEDKALAIQKQSEGLLIEYDRLLEDNQHLRIQL  209

Query  7    HA  2
             +
Sbjct  210  QS  211



>ref|NP_001154328.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AEE28812.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=220

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 145/196 (74%), Gaps = 3/196 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+ VI+ L FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +
Sbjct  12   EVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWI  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E   +NPTD+V++A+ +L+++LM  VL L L+   LHHY+RELR+ RK ME  KK     
Sbjct  72   EDGVVNPTDEVIMAKHLLESTLMVRVLELCLL-LWLHHYMRELRIRRKNMEVIKKEGALL  130

Query  229  DNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY  50
            +  K  G++EV +L EEI S++ + ++L+SE EA+ +E++ +K ++ + + QSE  L+E+
Sbjct  131  EGVKARGLDEVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAVALQKQSEGFLIEF  190

Query  49   GQLLEENQHLRSQLHA  2
             +LLEENQ LR QLH 
Sbjct  191  NRLLEENQVLRDQLHT  206



>ref|XP_008371075.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=222

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EM +IL  LFKTP RKL+I+ LD+ KRGRGP+VV +VAATVFV+++  VY   +I++  +
Sbjct  12   EMVMILAFLFKTPFRKLVILGLDQIKRGRGPVVVATVAATVFVVLMTNVYGXVKIRASRI  71

Query  403  ES---INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +    ++PTDQVLL + +L A+LMG  LFL+LMIDRLHHYIRELR  RK+MEA KK +RG
Sbjct  72   DKAAVLSPTDQVLLIKHLLDATLMGCSLFLALMIDRLHHYIRELRJRRKSMEALKKQNRG  131

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  53
             ++GK+  ++++   + E+A++++++K+LES+ E K ++V   + N  + + QSE  LLE
Sbjct  132  SEDGKSSILDQMKVSENEMATLRARLKQLESDIETKTKDVHTAESNVLALRKQSEGFLLE  191

Query  52   YGQLLEENQHLRSQLHA  2
            Y +LLEENQ L++QL +
Sbjct  192  YDRLLEENQKLKNQLKS  208



>ref|NP_001057612.2| Os06g0367500 [Oryza sativa Japonica Group]
 dbj|BAD69146.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF19526.2| Os06g0367500 [Oryza sativa Japonica Group]
Length=199

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 127/183 (69%), Gaps = 9/183 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--------SINPTDQVL  374
            ++ LDR KRGRGP++V++VAATV V++  +V+S+ +I+ R           ++ PTDQVL
Sbjct  1    MLGLDRLKRGRGPVMVRTVAATVLVVLASSVHSMNKIRGRAAGELDGAGAGTLTPTDQVL  60

Query  373  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-NGGVEEV  197
            LA+ +L+ASLMG+ LFL+L+IDRLH+YIRE+R L++ +EAA K ++  D  K  G  +E 
Sbjct  61   LARHLLEASLMGYSLFLALVIDRLHNYIREVRGLKRNLEAASKLNKTLDEAKLIGSSDES  120

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
             + +++IAS+  +IKK++ + + K  E K  +  + + + QSE L++EY  L+E+N+HL 
Sbjct  121  KTYQKDIASLNEEIKKMKRQLKEKANEAKDAEAKALAAQKQSEGLMIEYNHLVEDNKHLH  180

Query  16   SQL  8
             QL
Sbjct  181  DQL  183



>ref|XP_006847259.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
 gb|ERN08840.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
Length=219

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 129/178 (72%), Gaps = 3/178 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQVLLAQQIL  356
            ++ LDR KRGRGP VVK++A TVFV+++ +V SV +IQ R   + SI PTDQVL+++ +L
Sbjct  30   LLGLDRVKRGRGPAVVKTLATTVFVVLVSSVNSVMKIQRRASAVGSITPTDQVLMSKHML  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +AS+MG+ LFL+LMIDR+HH++ ELR+LRK + ++ +      +G N       +L+E+I
Sbjct  90   EASMMGYALFLTLMIDRMHHHMTELRILRKQIRSSGEGKSAGGSGDNSNSNR-RALEEDI  148

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            A+++ K+K+L+ E EAK  E K  + N+ + + QSE  LLEY +LLE+NQ+LRSQL +
Sbjct  149  AALQEKVKELQLESEAKDREAKTAETNAMALRKQSEGFLLEYDRLLEDNQNLRSQLQS  206



>dbj|BAJ86435.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=221

 Score =   149 bits (376),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            ++++D +KRGRGP++ ++VAAT+ V++  + YS+ +I+ R  E   + PTDQVL ++ +L
Sbjct  30   LLAVDCSKRGRGPVMARTVAATMLVVLGSSGYSIAKIRRREGEFAQLTPTDQVLASRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            +ASLMG+ LFL L+IDRLHHYIR+LR ++K MEA  K  R  +  K G  EE+   +++I
Sbjct  90   EASLMGYSLFLGLIIDRLHHYIRQLRAMKKNMEAVTKQSRVLEETKLGDSEEIQRYQKKI  149

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             S+  +++ L+ + E++ EE+K  + N+ + + QSE LL EY +L+ EN+ LR++L  
Sbjct  150  DSLNEQVQALKHQSESQTEELKTAEINNLALRKQSEGLLTEYERLIAENEELRNKLQT  207



>gb|ADE75913.1| unknown [Picea sitchensis]
Length=228

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 118/179 (66%), Gaps = 8/179 (4%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            LD+ K G+G  +VK++  T+ V++  ++ S+ +IQ+R ++  +I PTDQ+L+   +L+AS
Sbjct  34   LDQTKTGKGSAIVKTLGGTMLVILASSITSILKIQTRSVKMGTIAPTDQILMRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD------NGKNGGVEEVNSLK  185
            LMGF LFL+++IDRLHHYIREL  LR  ME+ +K  +           +  G  E+  LK
Sbjct  94   LMGFALFLAIIIDRLHHYIRELSGLRMNMESLRKQAKSSQEEYFRLKEEKEGSNEMTLLK  153

Query  184  EEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            +EIA +K K++KL  E + K  E +  + N+ + + QSE  LLEY +LLE+NQ+LRSQL
Sbjct  154  DEIADLKQKLQKLTLESKEKEREAEVAESNALALRKQSEGFLLEYDRLLEDNQNLRSQL  212



>gb|KHG00718.1| separin [Gossypium arboreum]
 gb|KJB67240.1| hypothetical protein B456_010G182000 [Gossypium raimondii]
Length=160

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 121/152 (80%), Gaps = 4/152 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMAVI++L FKTPLRKL+++ LDRAKRGRGP++VK+V  TV V+M+  ++S+  ++ R 
Sbjct  11   AEMAVIIVLCFKTPLRKLVLMVLDRAKRGRGPVIVKTVGGTVSVVMLSYIFSMMMLKKRW  70

Query  406  LESINP--TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            +   N   TD++L+A+ +L+ +LMG +LFLSL+ID+LHHYI+ELR+ RK ME AKK  +G
Sbjct  71   IVDGNASLTDEILMAKNLLETTLMGGLLFLSLIIDKLHHYIKELRIRRKTMETAKKQGQG  130

Query  232  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESE  137
            F++   GG ++V +L+EEIA+++++IK+LES+
Sbjct  131  FEDA--GGSDKVTALEEEIATLRARIKQLESD  160



>ref|XP_003563854.1| PREDICTED: B-cell receptor-associated protein 29 [Brachypodium 
distachyon]
Length=226

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 123/183 (67%), Gaps = 7/183 (4%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLL  371
            +++LDR KRG+GP++V++VAATV V++  +++S+ +I             ++ PTDQVLL
Sbjct  30   MLALDRLKRGKGPVMVRTVAATVLVVLASSLHSMAKIHGHASGGELDAPGALTPTDQVLL  89

Query  370  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS  191
            A+ +L+ASLMG+ LFL+L+IDRLH YIRE+R L+K +EA  K ++  +  K    +    
Sbjct  90   ARHLLEASLMGYSLFLALIIDRLHRYIREMRGLKKNLEAVSKQNKTLEEVKLVTSDGSKP  149

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
             +++IAS+  +IKKL  + + K +EVK  +  + + + QSE L+L+Y +LLE+ +HL  Q
Sbjct  150  YQKDIASLNEEIKKLRLQLKEKADEVKDAEARAVAAQTQSEGLMLKYDRLLEDKKHLHDQ  209

Query  10   LHA  2
            L +
Sbjct  210  LQS  212



>ref|XP_002453641.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
 gb|EES06617.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
Length=222

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 122/182 (67%), Gaps = 8/182 (4%)
 Frame = -1

Query  529  IISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESI-------NPTDQVL  374
            ++ +DR KRGR  P+VVK+VA  V  L+  T+YS+ +I     +S         PTDQVL
Sbjct  30   VLVVDRLKRGRHAPVVVKTVAGVVLALLASTLYSMSQISGGASDSDSGSGGGPTPTDQVL  89

Query  373  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  194
             ++ +L+A LMG+ LFL+L+IDRLH YIR+LR+ +K +EA +KH++  +  K+G  E+  
Sbjct  90   FSRHLLEACLMGYSLFLALVIDRLHQYIRDLRVFKKDLEAVRKHNKMLEETKHGNSEDAK  149

Query  193  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRS  14
              +EEIA +  ++KKL+ + + K EEV   +D + + + QSE LL+EY +LLE+NQHLR 
Sbjct  150  KYQEEIAILNKEMKKLKLQVQEKIEEVHVAEDKALTIQKQSEGLLIEYDRLLEDNQHLRD  209

Query  13   QL  8
            QL
Sbjct  210  QL  211



>ref|XP_007215894.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
 gb|EMJ17093.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
Length=241

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 129/198 (65%), Gaps = 6/198 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAK--RGRGPLVVKSVAATVFVLMIYTVYSVQEI--  419
             EM +I+ LLF  P+ K  I+ LD  K  +G+G L+VK V  T+F++++   YSV  I  
Sbjct  22   SEMVLIMTLLFDAPMTKTAILELDSLKLNQGKGLLIVKIVTGTLFLVLMANFYSVLRITM  81

Query  418  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
            ++R  E   +NPT++VL +  ILQ SL+G VLFL LMID LHHYIR L  L  AMEAAK 
Sbjct  82   KNRTNEGGGLNPTEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIRGLPSLVMAMEAAKT  141

Query  244  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  65
             ++ F   K   V+++N++ +E  ++++K+K LESEC+++  E    +  +E+ + +SE+
Sbjct  142  QNQSFRKEKTESVQKLNTMVQEKDTLRTKLKYLESECKSEANEANKARAEAEALRQESEE  201

Query  64   LLLEYGQLLEENQHLRSQ  11
             L EY +LL +NQ+ R+Q
Sbjct  202  FLKEYDRLLADNQNFRNQ  219



>ref|XP_006650891.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=217

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 120/181 (66%), Gaps = 9/181 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +++AK+G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VEQAKQGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNSL  188
            L+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   +     E+  L
Sbjct  94   LIGFTLFLAFVIDRLHHYLRKLVTLRKAANTSREEVEKLQMENRSFHEKEEKSSGEIKKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            ++EIA +   +KKL+SE E   +     + +  + + QSE+LLLEY +LLE+NQ L+SQL
Sbjct  154  QQEIAKLNESMKKLKSESEDHEKAALEAEAHVNALQKQSEELLLEYDRLLEDNQILQSQL  213

Query  7    H  5
            H
Sbjct  214  H  214



>ref|XP_008229970.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=241

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 129/198 (65%), Gaps = 6/198 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAK--RGRGPLVVKSVAATVFVLMIYTVYSV--QEI  419
             EM +I+ LLF TP+ K  I  LD  K  +G+G L+VK V  T+F++++   YS+    +
Sbjct  22   SEMVLIMTLLFDTPVTKTAISELDSLKLNQGKGLLLVKIVTGTLFLVVMANFYSLLRMNM  81

Query  418  QSRPLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
            ++R  E   +NPT++VL +  ILQ SL+G VLFL LMID LHHYI+ L  L  AMEAAK 
Sbjct  82   KNRTNEGSGLNPTEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIKGLPSLVMAMEAAKT  141

Query  244  HDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEK  65
             ++ F   K G V+++N++ +E  ++++K+K LESECE++  E    +  +E+ + +SE 
Sbjct  142  QNQSFRKEKTGSVQKLNTMVQEKDTLRTKLKYLESECESEANEANKARAEAEALRQESEG  201

Query  64   LLLEYGQLLEENQHLRSQ  11
             L EY +LL +NQ+ R+Q
Sbjct  202  FLKEYDRLLADNQNFRNQ  219



>ref|NP_001051893.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|AAO37960.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99895.1| B-cell receptor-associated protein 31-like containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13807.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|EAZ29303.1| hypothetical protein OsJ_13364 [Oryza sativa Japonica Group]
 dbj|BAG90494.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87435.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 119/181 (66%), Gaps = 9/181 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +++AK G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VEQAKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-------DRGFDNGKNGGVEEVNSL  188
            L+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   +     E+  L
Sbjct  94   LIGFTLFLAFVIDRLHHYLRKLITLRKAANTSREEVEKLQMENRLFREKEEKSSSEIKKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
             +EIA +   +KKL+SE E    +V   + +  + + QSE+LLLEY +LLE+NQ L+SQL
Sbjct  154  HQEIAKLNESMKKLKSESEDHERKVLEAEAHVNALQKQSEELLLEYDRLLEDNQILQSQL  213

Query  7    H  5
            H
Sbjct  214  H  214



>gb|AAC17626.1| Contains similarity to BAP31 protein gb|X81816 from Mus musculus 
[Arabidopsis thaliana]
 gb|ACB88825.1| At1g11905 [Arabidopsis thaliana]
Length=228

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+ VI+ L FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +
Sbjct  12   EVVVIMALSFKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWI  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            E   +NPTD+V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     
Sbjct  72   EDGVVNPTDEVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALL  131

Query  229  DNGKNGGVEEVNSLKEEIAS  170
            +  K  G++EV +L EEI S
Sbjct  132  EGVKARGLDEVKNLMEEITS  151



>gb|EAY92582.1| hypothetical protein OsI_14323 [Oryza sativa Indica Group]
Length=217

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 118/181 (65%), Gaps = 9/181 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +++AK G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VEQAKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNSL  188
            L+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   +     E+  L
Sbjct  94   LIGFTLFLAFVIDRLHHYLRKLITLRKAANTSREEVEKLQMENRLFREKEEKSSSEIKKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
             +EIA +   +KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ L+SQL
Sbjct  154  HQEIAKLNESMKKLKSESEDHERKALEAEAHVNALQKQSEELLLEYDRLLEDNQILQSQL  213

Query  7    H  5
            H
Sbjct  214  H  214



>dbj|BAJ87002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 122/181 (67%), Gaps = 7/181 (4%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLL  371
            +++LDR KRG+ P++V++VAATV V++  +++S+ +I             +++PTDQVLL
Sbjct  30   MLALDRLKRGQAPVMVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPGALSPTDQVLL  89

Query  370  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS  191
            A+ +L+ASLMG++LFL+L+IDRLH YIRE+R L+K +EA  K ++  +  ++G  +E   
Sbjct  90   ARHLLEASLMGYILFLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEARSGKSDESKP  149

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
               ++AS+  +IKKL+ + + K +E K  +  + + + QSE L  +Y  LLE+N+HL  Q
Sbjct  150  HHNDMASLNEEIKKLKLQLKEKAQEAKDAEAKAVAAQTQSEGLARKYDSLLEDNKHLHEQ  209

Query  10   L  8
            L
Sbjct  210  L  210



>gb|ACN36491.1| unknown [Zea mays]
Length=157

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -1

Query  394  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  215
             PTDQVL ++ +L+A LMG+ LFL+L+IDRLH YIR+LR  +K +EA +KH++  +  K+
Sbjct  18   TPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKMLEEAKH  77

Query  214  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  35
            G  EE    +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LL EY +LLE
Sbjct  78   GNSEEAKKYQEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTEYDRLLE  137

Query  34   ENQHLRSQL  8
            +NQHLR+QL
Sbjct  138  DNQHLRTQL  146



>ref|XP_009779153.1| PREDICTED: B-cell receptor-associated protein 31-like, partial 
[Nicotiana sylvestris]
Length=150

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -1

Query  340  GFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKS  161
            GF LFL+ MIDRLHHYIREL + RK MEA +K +R F++GK+G  EE+ +L+EE ++++ 
Sbjct  24   GFSLFLAFMIDRLHHYIRELSMRRKTMEAVRKQNRAFEDGKSGASEEIKTLEEEASALRG  83

Query  160  KIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            KIK+LESE + K +E    + N+ + K QSE  LLEY +LLEENQ+LRSQL +
Sbjct  84   KIKQLESELQVKAKEASGAEANAVALKKQSEGFLLEYDRLLEENQNLRSQLQS  136



>ref|XP_010247234.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 116/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            +LD+ K G+GP  VK++A T+ V++  ++ S+ +IQ+R   L ++ P DQVL    +L+A
Sbjct  33   ALDQLKTGKGPATVKTIAGTMSVILASSITSLLKIQNRGTKLGTVTPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEVNS  191
            SLMG+ LFL  +IDRLHHY+++L  LR     +K       K        +    EE+  
Sbjct  93   SLMGYSLFLGFVIDRLHHYLQKLGGLRTTARYSKQEVEKLHKDHLQLKEKEVKASEEIKL  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            L+EEI+S+K  IKKL+ ECE K ++V++ + +  + + Q+E LLLEY +LLE+NQ+L++Q
Sbjct  153  LQEEISSLKENIKKLKLECEEKDKQVQSAEAHVTALQKQAEDLLLEYDRLLEDNQNLQAQ  212



>gb|EMS49195.1| hypothetical protein TRIUR3_29235 [Triticum urartu]
Length=183

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 111/167 (66%), Gaps = 7/167 (4%)
 Frame = -1

Query  487  VVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLLAQQILQASLMGFVL  329
            +V++VAATV V++  +++S+ +I             +++PTDQVLLA+ +L+ASLMG++L
Sbjct  1    MVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPGALSPTDQVLLARHLLEASLMGYIL  60

Query  328  FLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKK  149
            FL+L+IDRLH YIRE+R L+K +EA  K ++  +  K+G  +E      +IAS+  +IKK
Sbjct  61   FLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAKSGRSDESKPHHNDIASLNEEIKK  120

Query  148  LESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            L+ + + K EE K  +  + + + QSE L  +Y +LLE+N+HL  QL
Sbjct  121  LKRQLKEKAEEAKDAEAKALAAQTQSEGLARKYDRLLEDNKHLHDQL  167



>gb|EMT32966.1| hypothetical protein F775_31670 [Aegilops tauschii]
Length=183

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 110/167 (66%), Gaps = 7/167 (4%)
 Frame = -1

Query  487  VVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLLAQQILQASLMGFVL  329
            +V++VAATV V++  +++S+ +I             +++PTDQVLLA+ +L+ASLMG++L
Sbjct  1    MVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPAALSPTDQVLLARHLLEASLMGYIL  60

Query  328  FLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKK  149
            FL+L+IDRLH YIRE+R L+K +EA  K ++  +  K G  +E      +IAS+  +IKK
Sbjct  61   FLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAKPGRSDESKPHHNDIASLNEEIKK  120

Query  148  LESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            L+ + + K EE K  +  + + + QSE L  +Y +LLE+N+HL  QL
Sbjct  121  LKRQLKEKAEEAKDAEAKALAAQTQSEGLARKYDRLLEDNKHLHEQL  167



>ref|XP_009381320.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381321.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381322.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381323.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            LD+ K G+GP  VK++A T+ V++  +V S+ +IQ+R   L ++ P DQVL    +++AS
Sbjct  34   LDQLKTGKGPATVKTLACTMSVILASSVASILKIQNRGAKLGTVTPMDQVLWRTHLVEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+L+IDRLHHY+R+L  LR+        +E  KK  + F   +   + E+  L
Sbjct  94   LIGYTLFLALVIDRLHHYLRKLINLRRTANSSQEEVENLKKEQQRFKEKEETSLNEIKKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
             EE+AS+K +++KL+SE     +  +  + +  + + QSE+LLLEY +LLE+NQ L++Q
Sbjct  154  HEEVASLKERLQKLKSESAEHEKRAETAEAHVTALQKQSEELLLEYDRLLEDNQILQTQ  212



>ref|XP_006479253.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
 gb|KDO65964.1| hypothetical protein CISIN_1g027820mg [Citrus sinensis]
Length=218

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 118/182 (65%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+FV+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  197
            +ASL+GF LFL  +IDR+HHY+ +L  LR       + +E  +K      + +    +E+
Sbjct  91   EASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEEKASKEL  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+EEI+++   +KKL+SECE K ++++    +  + + QS  LLLEY +LLE+NQ+L+
Sbjct  151  KRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
             Q
Sbjct  211  KQ  212



>gb|KHG09837.1| hypothetical protein F383_09194 [Gossypium arboreum]
Length=218

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 120/182 (66%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I S+D+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSIDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEV  197
            +ASL+GF LFL  +IDR+HHYI++L  LR  + ++K+     +  +       +   +E+
Sbjct  91   EASLIGFTLFLGFIIDRMHHYIKKLIGLRSRVGSSKEEAERIEKERIQLKEKDDKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKEEI+++   +KKL+SE E K +++K  + +  S + QS  LLLEY +LLE+NQ+L+
Sbjct  151  KLLKEEISTLSENLKKLKSESEEKDKKIKTAEAHVASLQKQSADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  NQ  212



>ref|XP_010927692.1| PREDICTED: B-cell receptor-associated protein 31-like [Elaeis 
guineensis]
Length=218

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 114/179 (64%), Gaps = 9/179 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            LD+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKSGKGPATVKTLACTLAVILVSSVTSILKIQNRGVKLGTVTPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+L+IDRLHHY R+L  LRK        +E  KK   GF   +    +E+  L
Sbjct  94   LIGYTLFLALVIDRLHHYHRKLITLRKIVGTSSEEVEKLKKEHHGFKEKEEKSSDEIKEL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            + E++++  K++KL+ E E + +     +    + + QSE+LLLEY +LLE+NQ L++Q
Sbjct  154  QMEVSNLTEKLQKLKCEFEEQEKRAITAEAYVTALQKQSEELLLEYDRLLEDNQILQTQ  212



>gb|EAZ03537.1| hypothetical protein OsI_25672 [Oryza sativa Indica Group]
 gb|EAZ39454.1| hypothetical protein OsJ_23885 [Oryza sativa Japonica Group]
Length=214

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            +++AK G+GP  VK++A T+ V+ + +V S+  IQ+R   L +++P DQVL    +L+AS
Sbjct  34   VEQAKDGKGPAAVKTLACTLLVIFMSSVASILRIQNRGIKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD---NGKNGGVEEVNSLKEEI  176
            L+G++LFL+ +IDRLHHY R+L +L+K    +++          GK    +EV  L+ E+
Sbjct  94   LIGYILFLAFVIDRLHHYHRKLTILKKTANTSREEVEKLQIELQGKEDKSKEVKKLRAEL  153

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            AS+  K+KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ L++Q+
Sbjct  154  ASLSEKMKKLKSESEEHERQRLEAEAHVNALQKQSEELLLEYDRLLEDNQILQTQV  209



>ref|XP_006830526.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
 gb|ERM97942.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
Length=220

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 117/179 (65%), Gaps = 9/179 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            LD+ K GRGP  VK++A T+ V+M  ++ S+ +IQ+R L+  ++ P DQVL    +L+AS
Sbjct  34   LDQLKMGRGPATVKTLACTMAVIMASSITSILKIQNRGLKIGTVTPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN-------GKNGGVEEVNSL  188
            L+G+ LFL+L+IDR+H+Y+ +L   +K +  +K+  + F          +    EE+ +L
Sbjct  94   LIGYSLFLALVIDRMHNYLSKLSGSKKTLGNSKQQAKKFQEEYALLKEKQEKASEEIRAL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            KEEI+S+  +++KL+ E + K +  +A + N  + + QSE LLLEY +LLE+NQ L+SQ
Sbjct  154  KEEISSLTERLQKLKLESDEKEKRAQAAEANVIALQKQSEDLLLEYDRLLEDNQILQSQ  212



>ref|XP_002463520.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
 gb|EER90518.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
Length=217

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 112/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSSETKKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            + EIA +   +KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ L++QL
Sbjct  154  QREIAKLNESMKKLKSETEEHERKASVAEAHVNALQKQSEELLLEYDRLLEDNQILQTQL  213



>gb|ACG43219.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|ACG44967.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 tpg|DAA52496.1| TPA: b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +D+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSSETKRL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            + EIA +   +KKL+SE E    +    + + ++ + QSE+LLLEY +LLE+NQ L++QL
Sbjct  154  QREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLLEYDRLLEDNQILQTQL  213



>ref|XP_010069636.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW58050.1| hypothetical protein EUGRSUZ_H00780 [Eucalyptus grandis]
Length=218

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            SL++ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLEQLKMGKGPATVKTIAGTMSVILLSSFMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEVNS  191
            SLMGF LFL  +IDR+HHY+++L  LR       + +E+ +K        +   ++E+  
Sbjct  93   SLMGFTLFLGFVIDRVHHYLQKLITLRSKEGVSKEEVESLRKEQLELKEKEGKSLKEIKQ  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            L++EI++M   +KKL+ ECE K ++V+  + +  + + QS  LLLEY +LLE+NQ+L+SQ
Sbjct  153  LQKEISNMLEGLKKLKLECEEKDKKVETAESHVAALQKQSADLLLEYDRLLEDNQNLQSQ  212



>ref|XP_009371858.1| PREDICTED: B-cell receptor-associated protein 31 [Pyrus x bretschneideri]
Length=219

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  +K++A T+ V++I    S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQIKMGKGPATIKTIAGTMSVILISDFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+ +L  LR ++ A+K+  DR           +N   +E+
Sbjct  91   EASLMGFTLFLGFVIDRMHHYLSKLIGLRSSVGASKEELDRLQKEKIQLKEKENKSSQEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+++I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KELQDKISTLTEDLKKLKLECAEKDKSIETAESHVASLQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  TQ  212



>ref|NP_001141677.1| uncharacterized protein LOC100273803 precursor [Zea mays]
 gb|ACF86841.1| unknown [Zea mays]
Length=217

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSGVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSSETKRL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            + EIA +   +KKL+SE E    +    + + ++ + QSE+LLLEY +LLE+NQ L++QL
Sbjct  154  QREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLLEYDRLLEDNQILQTQL  213



>ref|XP_009802750.1| PREDICTED: uncharacterized protein LOC104248228 [Nicotiana sylvestris]
Length=145

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+AV+L+L+F+TPLRK ++++LDR+K+GRGP++VKS   T+FV+++  +++V  IQ+R  
Sbjct  12   EVAVVLILVFRTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSILFNVTIIQNRAT  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
            ES  +NPTDQVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +EA KK
Sbjct  72   ESGTVNPTDQVLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLRKTLEAEKK  126



>ref|XP_003562352.1| PREDICTED: B-cell receptor-associated protein 31 [Brachypodium 
distachyon]
Length=217

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQA  350
            ++++ K G+GP  VK++A T+ V+ + +V S+ +IQ+R L+  +++P DQVL    +L+A
Sbjct  33   TVEQVKTGKGPATVKTLACTLSVIFMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNS  191
            SL+G+ LFL+ +IDRLHHY+++L  LRK    +++        +R F   +     E+  
Sbjct  93   SLIGYTLFLAFVIDRLHHYLQKLITLRKTANTSREEVEKLQMENRSFREKEEKSSSEIKK  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            L+++IA +   +KK++SE +    +    + +  + + QSE+LLLEY +LLE+NQ L+SQ
Sbjct  153  LQQDIAKLTEGMKKMKSESDDNERKALEAEAHVNALQKQSEELLLEYDRLLEDNQILQSQ  212

Query  10   LH  5
            LH
Sbjct  213  LH  214



>ref|XP_008809940.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=218

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 117/180 (65%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            LD+ K G+GP  VK++A T+ VL+  ++ S+ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKTGKGPATVKTLACTLSVLLASSITSILKIQNRGVKLGTVTPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-------FDNGKNGGVEEVNSL  188
            L+G+ LFL L+IDRLHHY+R++  L+K +  +K+           F + ++    E++ L
Sbjct  94   LIGYTLFLGLVIDRLHHYLRKMVSLKKTVGTSKEEVEKLKKEHHYFKDKEDKVSSEIHKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            + E+ S+  K++KL++ECE + +   + + +  S + QSE+LLLEY +LLE+NQ L+ QL
Sbjct  154  QGEVGSLTEKLQKLKTECEQQEKRAVSAEAHVVSLQKQSEELLLEYDRLLEDNQILQGQL  213



>ref|XP_006657620.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=214

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            +++AK G+GP  VK++A T+ V+ + +V S+  IQ+R   L +++P DQVL    +L+AS
Sbjct  34   VEQAKDGKGPAAVKTLACTLLVIFMSSVTSILRIQNRGAKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN---GKNGGVEEVNSLKEEI  176
            L+G++LFL+ +IDRLHHY R+L +L+K    +++      N   GK    +E+  L+ E+
Sbjct  94   LIGYILFLAFVIDRLHHYHRKLTILKKTANTSREEVEKLQNELQGKEDNSKEIKKLRGEL  153

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            A++  K+KKL+ E E         + +  + + QSE+LLLEY +LLE+NQ L++Q+
Sbjct  154  ATLSEKMKKLKFESEEHERRRLEAEAHVNALQKQSEELLLEYDRLLEDNQILQTQV  209



>gb|KJB26033.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=202

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+  +++ +  S+ +IQ++   L +++P DQVL    +L
Sbjct  17   IKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAKLGTMSPMDQVLWRTHLL  76

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAM-----EAAKKHD--RGFDNGKNGGVEEV  197
            +ASL+GF LFL  +IDR+HHYI++L  LR ++     E  + H+  +      +    E+
Sbjct  77   EASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEKDDKASLEI  136

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKEEI+++   +KKL+SE E K  +++  + +  S + QS  LLLEY +LLE+NQ+L+
Sbjct  137  KKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRLLEDNQNLQ  196

Query  16   SQ  11
            +Q
Sbjct  197  NQ  198



>gb|KJB10919.1| hypothetical protein B456_001G232500 [Gossypium raimondii]
Length=218

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 119/182 (65%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I S+D+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSIDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEV  197
            +ASL+GF LFL  +IDR+HHYI++L  LR  + ++K      +  +       +   +E+
Sbjct  91   EASLIGFTLFLGFIIDRMHHYIKKLIGLRSRVGSSKDEAERIEKERIQLKEKDDKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKEEI+++   +KKL+SE E K ++++  + +  S + QS  LLLEY +LLE+NQ+L+
Sbjct  151  KLLKEEISTLSENLKKLKSESEEKDKKIEIAEAHVASLQKQSADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  NQ  212



>gb|KJB26032.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=216

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+  +++ +  S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAM-----EAAKKHD--RGFDNGKNGGVEEV  197
            +ASL+GF LFL  +IDR+HHYI++L  LR ++     E  + H+  +      +    E+
Sbjct  91   EASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEKDDKASLEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKEEI+++   +KKL+SE E K  +++  + +  S + QS  LLLEY +LLE+NQ+L+
Sbjct  151  KKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  NQ  212



>ref|XP_009599718.1| PREDICTED: uncharacterized protein LOC104095323 [Nicotiana tomentosiformis]
Length=145

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+AV+L+L+F+TPLRK ++++LDR+K+GRGP++VKS   T+FV+++  +++V  IQ+R  
Sbjct  12   EVAVVLILVFRTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSILFNVTIIQNRAT  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
            +S  +NPTDQVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +EA KK
Sbjct  72   DSGTVNPTDQVLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLRKTLEAEKK  126



>ref|XP_009370674.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009334907.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=218

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 114/182 (63%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V++I +  S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKGPATVKTIAGTMSVILISSFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+ +L  LR ++ A+K       K        +    +EV
Sbjct  91   EASLMGFTLFLGFIIDRMHHYLSKLIGLRSSVGASKEELDRLQKETMQLKKQEEKASQEV  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+ +I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KQLQAKISTLTEDLKKLKLECAEKDKSIETAECHVASLQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  NQ  212



>ref|XP_003532279.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN10978.1| hypothetical protein glysoja_026713 [Glycine soja]
Length=218

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 115/182 (63%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVLWRSHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR HHY+++L  LR       + +E  KK             +E+
Sbjct  91   EASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEELENLKKETVQLKEKDEKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKEE++ +   ++K++SE E K ++V+  + +  S + Q+  LLLEY +LLEENQ+L+
Sbjct  151  KQLKEELSCLSKSLEKIKSESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLEENQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  AQ  212



>ref|XP_004981056.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=217

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  S++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLTVILMSDVASILKIQNRGLKLGSVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  ++     +     E+  L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENQSLREKEGNSSGEMKKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            + EIA +   +KKL+ E E    +  A + +  + + QSE+LLLEY +LLE+NQ L++QL
Sbjct  154  QREIAKLNESMKKLKFENEEHERKASAAEAHVNALQKQSEELLLEYDRLLEDNQILQTQL  213



>ref|XP_006365288.1| PREDICTED: uncharacterized protein LOC102597522 [Solanum tuberosum]
Length=147

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            E+ VIL L+F+TPLRK ++++LD++K+GRGP++VKS   T+FV+++  +++V  +Q+R  
Sbjct  13   EVVVILTLIFRTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSILFNVTLMQNRAT  72

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  230
            +S  +NPTDQVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +E  KK ++  
Sbjct  73   DSGTVNPTDQVLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLLRKTLEGEKKTNQSR  132

Query  229  DNGKNGG  209
            D  +N  
Sbjct  133  DQVENAA  139



>ref|XP_008372494.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=219

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  +K++A T+ V++I    S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQIKMGKGPATIKTIAGTMSVILISDFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKNGGVEEV  197
            +ASL+GF LFL  +IDR+HHY+ +L  LR ++ A+K+  DR           ++   +E+
Sbjct  91   EASLLGFTLFLGFIIDRMHHYLSKLIGLRSSVGASKEELDRLQKEKIQLKEKEDKSSQEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+++I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KQLQDKISTLTEDLKKLKLECAEKDKSIETAESHVASLQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  TQ  212



>ref|XP_004248701.1| PREDICTED: uncharacterized protein LOC101261860 [Solanum lycopersicum]
Length=147

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            +++LD++K+GRGP++VKS   T+FV+++  +++V  +Q+R  +S  +NPTDQVLLA  +L
Sbjct  31   LMALDKSKQGRGPVIVKSAGGTLFVVLVSILFNVTLMQNRATDSGTVNPTDQVLLANHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  227
            +ASL+GF LFL+L+IDRLH+YI+ELRLLRK ME  KK ++  D
Sbjct  91   EASLLGFTLFLALVIDRLHYYIKELRLLRKTMEGEKKMNQNRD  133



>ref|XP_008794596.1| PREDICTED: B-cell receptor-associated protein 31 [Phoenix dactylifera]
Length=218

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 117/180 (65%), Gaps = 11/180 (6%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            LD+ K G+GP  VK++A T+ V+++ +V ++ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKSGKGPATVKTLACTLSVILVSSVATILKIQNRGVKLGTVTPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK--------KHDRGFDNGKNGGVEEVNS  191
            L+G+ LFL+L+IDRLHHY+++L  LRK +  ++        +H R F   +    +E+  
Sbjct  94   LIGYSLFLALVIDRLHHYLQKLINLRKTVGTSREEVEKLKMEHHR-FKEKEEKSSDEIKK  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            L+ E++++  K++KL+SE E + +     +    S + QSE+LLLEY +LLE+NQ L++Q
Sbjct  153  LQVEVSNLTEKLQKLKSEFEEQEQRAITAEAYVASLRKQSEELLLEYDRLLEDNQILQTQ  212



>ref|XP_008382607.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=218

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 115/182 (63%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V++I +  S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKGPATVKTIAGTMSVILISSFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+ +L  LR ++  +K+  DR           +    +EV
Sbjct  91   EASLMGFTLFLGFIIDRMHHYLSKLIGLRXSVGXSKEELDRLQKETIQLKEKEEKASQEV  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+ +I+++   +KKL+ EC  K + V+  + +  S + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KQLQAKISTLTEDLKKLKLECAEKDKSVETAECHVASLQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  NQ  212



>gb|KDP26363.1| hypothetical protein JCGZ_17521 [Jatropha curcas]
Length=216

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 116/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQVKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK---NGGVE----EVNS  191
            SLMGF LFL  +IDR+HHY+ +L  LR  + ++K+        K    G  E    E+  
Sbjct  93   SLMGFTLFLGFIIDRMHHYLTKLISLRSNIGSSKEEVERLQKEKMQLKGKAEKASTEIKQ  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            L+E+I+++   +KKL+ E E K ++++  + +  + + QS  LLLEY +LLEENQ+L++Q
Sbjct  153  LQEQISTLSESLKKLKLENEEKDKQIETAEAHVVALQKQSADLLLEYDRLLEENQNLQAQ  212



>ref|XP_007049723.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
 gb|EOX93880.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
Length=213

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 117/183 (64%), Gaps = 9/183 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  +K++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATMKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+R+L  LR  + ++K       K         +   +E+
Sbjct  91   EASLMGFTLFLGFIIDRMHHYLRKLIGLRSKVGSSKEEVERLQKERIELKEKDDKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKEEI+++   +KKL+ E E K ++++  + +  S + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KLLKEEISTLSENLKKLKLESEEKDKKIETAEAHVASLQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQL  8
             +L
Sbjct  211  IKL  213



>ref|XP_008802267.1| PREDICTED: B-cell receptor-associated protein 29-like [Phoenix 
dactylifera]
Length=221

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 112/179 (63%), Gaps = 9/179 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            LD+ K G+GP +VK++A T+ V++  ++  +  IQ+R L+  S+ PTDQVL    +L+AS
Sbjct  34   LDKLKTGKGPAMVKALACTLSVILASSITGILRIQNRGLKLGSVTPTDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+L+IDRLHH ++++  LRK        +E  KK    F + +     E   L
Sbjct  94   LIGYTLFLALLIDRLHHCLQKVINLRKTVGTSRDEVEKLKKEHHHFKDEEEKSSNERTEL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            +EE+ ++  K++KL+SE E   +     + +  + + Q EKLLLEY +LLE+NQ L++Q
Sbjct  154  REEVCNLTEKLQKLKSEIEELKKRALTAEAHVAALQKQFEKLLLEYDRLLEDNQILQTQ  212



>ref|XP_007140653.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
 gb|ESW12647.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
Length=218

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 114/182 (63%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+++L  LR +  A+       +K             +E+
Sbjct  91   EASLMGFALFLGFLIDRIHHYLQKLVNLRSSTRASNEDLENLRKETVQLKGKGEKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKEE++ +   +K ++ E E K ++V+  + +  S + Q+  LLLEY +LLEENQ+L+
Sbjct  151  KQLKEELSRVSESLKNIKLESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLEENQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  AQ  212



>ref|XP_011095414.1| PREDICTED: uncharacterized protein LOC105174881 [Sesamum indicum]
Length=149

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 81/110 (74%), Gaps = 8/110 (7%)
 Frame = -1

Query  505  RGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQASLMGFV  332
            +GRGP+V  + A T+FV+M+  ++++  IQ R +ES  +NPTDQVLLA Q+L+ASL+GF 
Sbjct  38   QGRGPIVSSTAAGTLFVIMVSILFNITSIQKRSMESASVNPTDQVLLANQLLEASLLGFA  97

Query  331  LFLSLMIDRLHHYIRELRLLRKAMEAAKKHD------RGFDNGKNGGVEE  200
            LFL LMIDR+H+YI+E+R+LRK +EA K+ D      R  + GK+  VEE
Sbjct  98   LFLWLMIDRIHYYIKEVRMLRKHLEAVKRMDQKSEEVRSKEKGKSKAVEE  147



>ref|XP_009410623.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410624.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410625.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410626.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410627.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410629.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 112/179 (63%), Gaps = 9/179 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQVLLAQQILQAS  347
            LD+ K G+GP  VK++A T+ V++  +V S+ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKTGKGPATVKTLACTMSVILASSVASILKIQNRAAKLGTVTPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLL-------RKAMEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+L+IDRLHHY+R+L  L       R+ ++  KK  + F   +   + E   L
Sbjct  94   LIGYTLFLALVIDRLHHYLRKLVSLKTTVGTSREEVDNLKKEQQSFKEKEKTSLSERKKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
             EE+  +K +++KL+ + E   +  +  + +  + + QSE+LLLEY  LLE+NQ L+++
Sbjct  154  HEEVTRLKERLQKLKLDSEEHEKRAQTAEAHVAALQKQSEELLLEYDHLLEDNQILQTR  212



>ref|XP_008226862.1| PREDICTED: uncharacterized protein LOC103326424 [Prunus mume]
Length=153

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+IL LLF+TPLR L+I+ LDR+K+GRGPLV KSV  TV V    T+Y V  +Q R 
Sbjct  11   AEMALILSLLFRTPLRTLVIVGLDRSKQGRGPLVAKSVGGTVLVFFSSTLYGVFSVQKRL  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             E+  +NPTD+VL+A ++L+ASL+GF LFL L+IDRLH+YI+EL LLRK  E  K     
Sbjct  71   TEAGFVNPTDEVLMAHRLLEASLIGFSLFLVLIIDRLHYYIKELNLLRKFNEEIKNLKND  130

Query  232  FDNGKNGGVE  203
            F+  KN   E
Sbjct  131  FEQRKNADAE  140



>ref|XP_008380294.1| PREDICTED: uncharacterized protein LOC103443257 [Malus domestica]
Length=150

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+IL LLF+TPLRKL+I+ LDR+K+GRGPLV KSV  T+ V    T+YSV  +Q R 
Sbjct  11   AEMALILSLLFRTPLRKLVIVGLDRSKQGRGPLVXKSVGGTILVFFSSTIYSVFSVQKRL  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             E+  +NPTD+VL+A ++L+ASL+GF LFL+++IDRLH+YI+EL LLR+ +E  K   + 
Sbjct  71   SEAGFVNPTDEVLMAHRLLEASLIGFSLFLAMIIDRLHYYIKELHLLRERVEEVKNLKKD  130

Query  232  FDNGKNGGVEEVNSLKEEIA  173
            +++ K+    EV    + I+
Sbjct  131  YEHKKSTDPAEVKKATQRIS  150



>gb|ACG37455.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=216

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 111/179 (62%), Gaps = 8/179 (4%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-SINPTDQVLLAQQILQASL  344
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+ +++P DQVL    +L+ASL
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLTVSPMDQVLWRTHLLEASL  93

Query  343  MGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSLK  185
            +G+ LFL+ +IDRLHHY+++L  LRK        +E  +  +R     +     E   L+
Sbjct  94   IGYTLFLAFVIDRLHHYLQKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSGETKRLQ  153

Query  184  EEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
             E+  +   +KKL+SE +    +    + +  + + QSE+LLLEY +LLE+NQ L++QL
Sbjct  154  REVVRLNESMKKLKSEAKEHERKASVAEAHVNALQKQSEELLLEYDRLLEDNQILQTQL  212



>ref|XP_003552124.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
 gb|KHN41384.1| hypothetical protein glysoja_032570 [Glycine soja]
Length=218

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 114/182 (63%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR HHY+++L  LR       + +E  KK             +E+
Sbjct  91   EASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEELENLKKETVQLKEKDEKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKEE++ +   ++K++ E E K ++V+  + +  S + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KQLKEELSHLSKSLEKIKLESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  AQ  212



>ref|XP_007134124.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
 gb|ESW06118.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
Length=219

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 113/182 (62%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I +LD+ K G+GP  VK++A T+ V++  ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKTLDQMKMGKGPATVKTIAGTMSVILFSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF-------DNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+++L  LR    A+K+               +    +E+
Sbjct  91   EASLMGFTLFLGFIIDRVHHYLQKLNKLRSNAGASKEEVESIEKEKVELKEKEEKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LKE+I+ +   +KK + ECE K + V+  + +  S + Q+  LLLEY +LLEENQ+L+
Sbjct  151  MQLKEQISGLSESLKKTKVECEEKDKRVETAEVHVTSLQKQAADLLLEYDRLLEENQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  AQ  212



>ref|XP_002266257.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=218

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 112/179 (63%), Gaps = 9/179 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            LD+ K G+GP  VK++A T+ V+++ +V S+ +IQ++   L ++ P DQVL    +L+ S
Sbjct  34   LDQVKMGKGPATVKTIAGTMSVILLSSVTSILKIQNKGAKLGTMTPMDQVLWRTHLLETS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEVNSL  188
            LMGF LFL  +IDR+HHY+++L  LR    A+K       K        +    +E+  L
Sbjct  94   LMGFSLFLGFLIDRMHHYLQKLNRLRGNAGASKEEFEKLQKERAQLKEKEEQASKEIKLL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            +E+I+++   +KKL+ E E K ++V+  + +  S + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  154  QEQISTLTQDLKKLKLEAEEKDKKVETAEAHVVSLQKQAADLLLEYDRLLEDNQNLQTQ  212



>ref|XP_006452411.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475037.1| PREDICTED: uncharacterized protein LOC102621381 [Citrus sinensis]
 gb|ESR65651.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=131

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 90/118 (76%), Gaps = 2/118 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+IL LLF+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  
Sbjct  12   EMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAR  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            E  +INPT++VL+A  +LQASLMGF LFL+++ DRLH+YI+EL L+R+ +E  K  ++
Sbjct  72   EGGAINPTEEVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQTLEGLKNLNK  129



>ref|NP_001136567.1| uncharacterized LOC100216689 precursor [Zea mays]
 ref|XP_008645522.1| PREDICTED: LOW QUALITY PROTEIN: B-cell receptor-associated protein 
31-like [Zea mays]
 gb|ACF82188.1| unknown [Zea mays]
 gb|AFW66986.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+ +IDRLHHY+++L  LRK        +E  +  +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLQKLMTLRKTSSTSREEVEKLQMENRSLREKEEKSSGETKRL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            + E+  +   +KKL+SE +    +    + +  + + QSE+LLLEY +LLE+NQ L++QL
Sbjct  154  QREVVRLNESMKKLKSEAKEHERKASVAEAHVNALQKQSEELLLEYDRLLEDNQILQTQL  213



>ref|XP_002303054.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
 gb|ABK95486.1| unknown [Populus trichocarpa]
 gb|EEE82327.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
Length=218

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 115/182 (63%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+ P  VK++A T+ V++ +++ ++ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKRPATVKTIAGTMSVILFFSLMNIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+ +L  LR+++ ++K       K        ++    E+
Sbjct  91   EASLMGFTLFLGFLIDRMHHYLSKLIGLRRSVGSSKEEVERLQKEKMQLKEKEDKASMEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L E+I+++   +KKL+ E E K +++K  + +  S + Q   LLLEY +LLE+NQ+L+
Sbjct  151  KLLLEQISTLSENLKKLKLESENKDKQIKTAEAHVVSLQKQCADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  AQ  212



>ref|XP_008385961.1| PREDICTED: uncharacterized protein LOC103448478 [Malus domestica]
Length=155

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+IL LLF+TP+RKL+I+ LDR+K+GRGPLV KSV  T+ V    T+YSV  +Q+R 
Sbjct  11   AEMALILSLLFQTPVRKLVIVGLDRSKQGRGPLVAKSVGGTILVFFSSTIYSVFSVQNRL  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  248
             E+  +NPTD+VL+A ++L+ASL+GF LFL+++IDRLH+YI+EL LLRK +E  K
Sbjct  71   TETGFVNPTDEVLMAHRLLEASLIGFSLFLAMVIDRLHYYIKELXLLRKRVEEVK  125



>ref|XP_008460368.1| PREDICTED: B-cell receptor-associated protein 31-like [Cucumis 
melo]
Length=219

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++AAT+ V+++ ++ ++ +IQ++   L +++P DQVL   Q+L
Sbjct  31   IKSLDQLKMGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLGTMSPMDQVLWRTQLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASL+GF LFL  +IDR+HHY ++L  LR+ + ++K       K        +    +++
Sbjct  91   EASLIGFTLFLGFIIDRMHHYFQKLIGLRENIGSSKEEVERLQKEKTELAQKEEKCSKQI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+EEI+ +   +KK++ E E K + ++    +  S + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KELREEISILSENLKKVKQESEEKDKRIETADAHVTSLQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  NQ  212



>ref|XP_011011172.1| PREDICTED: uncharacterized protein LOC105115831 [Populus euphratica]
Length=218

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V++  ++ S+ +IQS+   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKGPATVKTIAGTMSVILFSSLMSIVKIQSKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK------NGGV-EEV  197
            +ASLMGF LFL  +IDR+HHY+ +L  LR ++ ++K+        K       G V +E+
Sbjct  91   EASLMGFTLFLGFLIDRMHHYLSKLIGLRSSVGSSKEEVERLQKEKMQLKEEEGKVSKEM  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+E+ +++   +KKL+ E E K ++++  + +  +   +S  LLLEY +LLE+NQ+L+
Sbjct  151  KLLQEQFSTLSENLKKLKLESEQKDKQIETAEAHVVALHKRSADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  AQ  212



>ref|XP_010685051.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQVKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKNGGVEEVNS  191
            SLMGF LFL  +IDR+HHY+R+L  +R  + ++       +K  +   + +    +E+ +
Sbjct  93   SLMGFTLFLGFLIDRMHHYLRKLINIRSKVGSSKEEVEKLEKEKQQLKDKEEKASKEITA  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            L++E++ + +++KKL+ E + K + ++    +  + + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  153  LQDELSKVSNEVKKLKIESQEKDKTIETADAHVVALQKQAADLLLEYDRLLEDNQNLQTQ  212



>gb|KDO62065.1| hypothetical protein CISIN_1g045614mg, partial [Citrus sinensis]
Length=123

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 2/112 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+IL LLF+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  
Sbjct  12   EMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAR  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEA  254
            E  +INPT++VL+A  +LQASLMGF LFL+++ DRLH+YI+EL L+R+ +E 
Sbjct  72   EGGAINPTEEVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQTLEG  123



>ref|XP_006281079.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
 gb|EOA13977.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
Length=217

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 117/183 (64%), Gaps = 9/183 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V++   + ++ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILFSNLMNIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN-------GGVEEV  197
            +ASL+G VLFL  +IDR+HHY+ +L  LR    ++K+     +  +           +E+
Sbjct  91   EASLLGVVLFLGFIIDRMHHYLSKLINLRSNAGSSKEELEQLEKERTELKEKDEKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+E ++S+  K+KK E+E + K ++++  + + E+ + QS +LLLEY +LLE+NQHL+
Sbjct  151  KKLQENLSSILEKLKKAEAESKEKDKKLETAETHVEALQKQSAELLLEYDRLLEDNQHLQ  210

Query  16   SQL  8
            SQ+
Sbjct  211  SQI  213



>gb|EYU27354.1| hypothetical protein MIMGU_mgv1a015673mg [Erythranthe guttata]
Length=149

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 8/137 (6%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
            GE+AVIL+LLF+TPLRK L+I LDR K+GRGP+V  +   T+FV+M+  +Y++  IQ+R 
Sbjct  11   GEVAVILVLLFRTPLRKPLLILLDRLKQGRGPVVATTAGGTLFVIMVSLLYNITTIQNRS  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
            LE+  +NPTDQVLLA Q+L+ASL+GF LFL+LMIDR+H+YIRE+R+LRK MEA KK D+ 
Sbjct  71   LEAGGVNPTDQVLLANQLLEASLLGFALFLALMIDRIHYYIREVRMLRKHMEAIKKSDQE  130

Query  232  F------DNGKNGGVEE  200
                   D GKN  VE+
Sbjct  131  SEELKIKDKGKNKVVED  147



>ref|XP_009361097.1| PREDICTED: uncharacterized protein LOC103951454 [Pyrus x bretschneideri]
Length=153

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP  407
             EMA+IL LLF+TPLRKL+I+ LDR+K+GRGPLVVKSV  T+ V    T+YSV  +Q R 
Sbjct  11   AEMALILSLLFRTPLRKLVIVGLDRSKQGRGPLVVKSVGGTILVFFSSTIYSVFSVQKRL  70

Query  406  LES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  233
             E+  +NPTD+VL+A ++L+ASL+GF LFL+++IDRLH+ I+ELRLLR  +E  K   + 
Sbjct  71   SEAGFVNPTDEVLMAHRLLEASLIGFSLFLAMIIDRLHYSIKELRLLRGLVEEVKNLKKD  130

Query  232  FDNGKNGGVEEVNSLKEEIA  173
             ++ K+    EV    + I+
Sbjct  131  DEHRKSTAPAEVKKATQMIS  150



>ref|XP_004144386.1| PREDICTED: uncharacterized protein LOC101213598 [Cucumis sativus]
 ref|XP_004162649.1| PREDICTED: uncharacterized LOC101213598 [Cucumis sativus]
 gb|KGN58366.1| hypothetical protein Csa_3G629240 [Cucumis sativus]
Length=219

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++AAT+ V+++ ++ ++ +IQ++   L +++P DQVL   Q+L
Sbjct  31   IKSLDQLKMGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLGTMSPMDQVLWRTQLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASL+GF LFL  +IDR+HHY ++L  LR+ + ++K       K        +    +++
Sbjct  91   EASLIGFTLFLGFIIDRMHHYFQKLIGLRENIGSSKEEVERLQKEKTELAQKEEKCSKQI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+EEI+ + + +KK++ E   K + ++    +  S + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KELREEISILSANLKKVKQESVEKDKRIETADAHVTSLQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  NQ  212



>gb|EMS58132.1| hypothetical protein TRIUR3_00710 [Triticum urartu]
Length=190

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 107/174 (61%), Gaps = 22/174 (13%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            +++ K G+GP  VK++A T+ V+++ +V ++  IQ R   + +++P DQVL    +L+AS
Sbjct  34   VEQVKTGKGPATVKTLACTLSVILMSSVAAIVRIQDRGHKIGNVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASM  167
            L+G+ LFL+ +IDRLHHY+R+L  LRK+   ++                    +E++A +
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLITLRKSANTSR--------------------EEDMAKL  133

Query  166  KSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLH  5
               +KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ L+SQLH
Sbjct  134  SEDMKKLKSESEDHQRKASDAEAHVNALQKQSEELLLEYDRLLEDNQILQSQLH  187



>ref|XP_010099686.1| hypothetical protein L484_025117 [Morus notabilis]
 gb|EXB80263.1| hypothetical protein L484_025117 [Morus notabilis]
Length=216

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 115/182 (63%), Gaps = 11/182 (6%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K  RG ++  ++A T+F + + + +S+ +IQ+R   L S++P DQVL    +L
Sbjct  31   IKSLDQLKMKRGTVL--TIAGTMFAIFMSSFFSIVKIQNRGAKLGSMSPMDQVLWRTHLL  88

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHYIR+L  LR +       +E  +K        +    +E+
Sbjct  89   EASLMGFTLFLGFIIDRMHHYIRKLIGLRSSVGSSKEELEKLQKEKMQLKEKEQKYSKEI  148

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              LK+E++++   +KKL+ + E K ++V+  + + ++ + Q+  LLLEY +LLE+NQ+L+
Sbjct  149  KLLKDEVSTLSESLKKLKIKSEEKDKKVETAEAHVQALQKQAADLLLEYDRLLEDNQNLQ  208

Query  16   SQ  11
            +Q
Sbjct  209  NQ  210



>emb|CDP15777.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            ++ +D+ K+GRGP+V K+VA T+F++ I T+ ++ +IQ+R +E  +INPTDQ+LL   IL
Sbjct  30   VMMVDKMKQGRGPVVAKTVAGTLFMIFISTLNNIMKIQNRAVEAGTINPTDQILLVNHIL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  227
            +A L+GF LFL +MIDRLH+YI+EL  LRK++EA KK +   D
Sbjct  90   EAILLGFSLFLGVMIDRLHYYIKELHRLRKSLEATKKSNYETD  132



>ref|XP_007216855.1| hypothetical protein PRUPE_ppa021600mg [Prunus persica]
 gb|EMJ18054.1| hypothetical protein PRUPE_ppa021600mg [Prunus persica]
Length=192

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 96/173 (55%), Gaps = 31/173 (18%)
 Frame = -1

Query  526  ISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQVLLAQQILQAS  347
            I++DR KRGRGPLVV+ +A +V  +++  VY                             
Sbjct  32   IAVDRLKRGRGPLVVRIIAGSVLFVLVARVY-----------------------------  62

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASM  167
              GF+LFLS+++DRLHHY RE+ LLR  MEAA++ ++     KNG   E+  L +EIA +
Sbjct  63   --GFLLFLSVILDRLHHYTREVSLLRTEMEAAQRENQTLKEEKNGRAMELKILGQEIAKL  120

Query  166  KSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            ++ I   E+E E K +  K +K  + + + Q E LL E  ++ E+NQ LRSQL
Sbjct  121  RTNIMNTETEYETKAKGAKLEKTKAYALRKQYEGLLAEIDRVQEDNQILRSQL  173



>ref|XP_006452412.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 gb|ESR65652.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+IL LLF+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  
Sbjct  12   EMALILTLLFRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAR  71

Query  403  E--SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            E  +INPT++VL+A  +LQASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  72   EGGAINPTEEVLMANLLLQASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  129



>gb|KEH22623.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=218

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 112/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            SLD+ K G+ P  VK++A T+FV+++ ++ S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQLKMGKAPATVKTIAGTMFVILLSSLMSLVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS-------  191
             L+GF LFL  +IDR+HHY+++L  LR  M A+K+             E+          
Sbjct  93   YLLGFTLFLGFLIDRMHHYLQKLINLRSNMGASKEEVENLKKENVELKEKEEKASKEIKQ  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            LK+E++++   +KK++ E E K + V+  + +  S + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  153  LKKELSTLTEGLKKVKMESEEKDKRVETAEAHVASLQKQAADLLLEYDRLLEDNQNLQAQ  212



>ref|XP_004491710.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=218

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            SLD+ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQLKMGKGPATVKTIAGTMSVILLSSFMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS-------  191
            SL+GF LFL  +IDR+HHY+++L  LR  M A+K+             E+          
Sbjct  93   SLIGFTLFLGFLIDRMHHYLQKLINLRSNMGASKEEVENLKKETMEFKEKEEKASKEIKQ  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            LK+E++++   +KK + E E K + V+  + +  S + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  153  LKKELSTLSEGLKKAKMESEEKDKRVETAESHVASLQKQAADLLLEYDRLLEDNQNLQAQ  212



>ref|XP_002863915.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40174.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 120/183 (66%), Gaps = 9/183 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V++   + S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILFSNLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASL+G VLFL  +IDR+HHY+R+L  LR  + ++K       K   G    ++   +E+
Sbjct  91   EASLLGVVLFLGFIIDRMHHYLRKLINLRSNVGSSKDELEQLQKERAGLKEKEDKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+EE++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE+NQHL+
Sbjct  151  KQLQEELSSILERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLEDNQHLQ  210

Query  16   SQL  8
            SQ+
Sbjct  211  SQI  213



>gb|KHN38264.1| hypothetical protein glysoja_003929 [Glycine soja]
Length=154

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            +I LD  K+GRGPLV K+VAAT+ V++  TVY++ +IQ R  ++  +NPTD+VL+A ++L
Sbjct  30   VIGLDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDASIVNPTDEVLMAHRLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  218
            +A+ +GF LFL L+IDR H+YIRE+ LLRK +E  KK +   D+ K
Sbjct  90   EAAFLGFSLFLGLVIDRQHYYIREINLLRKNLETWKKRNHNHDSLK  135



>ref|XP_010274041.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 112/180 (62%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            +D+ K G+G   +K++A T+ V++  ++ S+  IQ++   L ++ P DQVL    +L+AS
Sbjct  34   MDQLKTGKGSATLKTIAGTMSVILASSIISLLNIQNKGTKLGTVTPMDQVLWRSHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-------NGKNGGVEEVNSL  188
            LMG  LFL  +IDR+HHY+++L  LR A  ++KK               +     E+  L
Sbjct  94   LMGCSLFLGFVIDRIHHYLQKLIALRTAARSSKKEVEKLQIEHIQLKEKEEKASYEIKLL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            +EEI+S+K  +K L+ + + K +++K+ + +  + + Q+E LLLEY +LL+++QHL++Q+
Sbjct  154  QEEISSLKENLKNLKLQSDEKDKQIKSAESHVTALEKQTEDLLLEYDRLLDDSQHLQAQV  213



>ref|XP_010552045.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=219

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 116/181 (64%), Gaps = 9/181 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            SLD+ K G+GP  VK++A T+ V+++ T+ S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQLKMGKGPATVKTIAGTMSVILLSTLMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS-------  191
            SLMG VLFL  +IDR+HHY+ +L  LR  +  +K+        +    E+          
Sbjct  93   SLMGVVLFLGFVIDRMHHYLTKLLYLRSNIGMSKEELEKLQKERTELKEKEEKASKEMKQ  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            L+E+++S+   ++KLE+E + K ++++  + +  + + QS +LLLEY +LLE+NQ+L++Q
Sbjct  153  LQEKLSSLSQNLEKLEAESKDKDKKLETAEAHVSALQKQSAELLLEYDRLLEDNQNLQTQ  212

Query  10   L  8
            +
Sbjct  213  I  213



>ref|XP_002521067.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF41218.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=292

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A+T+ V+++ ++ S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIASTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASL+GF LFL  +IDR+HHY+ +L  LR  + ++K       K        ++    E+
Sbjct  91   EASLIGFTLFLGFIIDRMHHYLTKLIGLRINIGSSKEEVERLQKEKMQLKEKEDKSSMEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+++++++   ++KL+ E E K ++++  + +  S + QS  LLLEY +LLE+NQ+L+
Sbjct  151  EQLRKQVSTLSENLEKLKLENEQKDKQIETAEAHVVSLQKQSADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  AQ  212



>gb|KHN11907.1| hypothetical protein glysoja_019880 [Glycine soja]
Length=139

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQAS  347
            LD  K+GRGPLV K+VAAT+ V++  TVY++ +IQ R  ++  +NPTD+VL+A ++L+A+
Sbjct  33   LDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDAGIVNPTDEVLMAHRLLEAA  92

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
             +GF LFL L+IDR H+YIRE+ LLRK ME AKK
Sbjct  93   FLGFSLFLGLVIDRQHYYIREINLLRKNMETAKK  126



>gb|KDP39157.1| hypothetical protein JCGZ_00914 [Jatropha curcas]
Length=104

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQIL  356
            ++ +D  KRGRG LV K+VAAT+F +    +YSV +IQ R LES  +NPTD+VLLA+++L
Sbjct  6    MVGIDYMKRGRGQLVAKTVAATLFGVFSAILYSVMQIQKRTLESGVVNPTDEVLLAERLL  65

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
            +A+LMGF LFL++M DRLH+YI+EL  +RK +E  K+
Sbjct  66   EATLMGFSLFLAMMADRLHYYIKELYRVRKEVEQLKR  102



>ref|XP_004963921.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=134

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -1

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASM  167
            L G+ LFL L+IDRLHHYIRELR + K MEA  K  R  +  K GG EE+   ++EIAS+
Sbjct  6    LAGYSLFLGLIIDRLHHYIRELRTMNKNMEAVTKQSRTLEEAKLGGTEEIQGYQKEIASL  65

Query  166  KSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
            K +++ L+++ + K EE+K  + NS + + QSE LL+EY +L+ EN  LR+QL +
Sbjct  66   KEQVELLKNQSQKKTEELKTAEANSVALQKQSEGLLMEYDRLIAENGDLRNQLQS  120



>gb|EYU40619.1| hypothetical protein MIMGU_mgv1a013665mg [Erythranthe guttata]
Length=213

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 115/184 (63%), Gaps = 19/184 (10%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            LD+ K  R    V ++AATVFV+++  ++S+ +IQ++  +  ++ P DQVL    +L+A+
Sbjct  34   LDQVKMRRAT--VLTIAATVFVILLSDLFSIFKIQNKGAKHGAMTPMDQVLWRTNVLEAT  91

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-----------NGKNGGVEE  200
            LMGF LFL L+IDR+HH++R+L  L+ +   +K+    FD           N +  G+ E
Sbjct  92   LMGFFLFLGLLIDRMHHHMRKLDELKSSNGVSKEE---FDRVEREKLQLKENQEKTGL-E  147

Query  199  VNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHL  20
            V  L++EI+ +   +KKL+ E   K + VK+ +    S + Q+ +LLLEY +LLE+NQ+L
Sbjct  148  VERLRKEISGLTENVKKLKLESTEKDKSVKSAEARVASLQKQTAELLLEYDRLLEDNQNL  207

Query  19   RSQL  8
            ++Q+
Sbjct  208  QNQV  211



>ref|XP_009151666.1| PREDICTED: uncharacterized protein LOC103874978 [Brassica rapa]
Length=217

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 120/183 (66%), Gaps = 9/183 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  197
            +ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++   +E+
Sbjct  91   EASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERTEFKEKEDKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+E+++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE+NQ L+
Sbjct  151  KQLQEKLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLEDNQKLQ  210

Query  16   SQL  8
            SQ+
Sbjct  211  SQI  213



>emb|CDX86287.1| BnaA06g30040D [Brassica napus]
Length=217

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 120/183 (66%), Gaps = 9/183 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  197
            +ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++   +E+
Sbjct  91   EASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERNEFKEKEDKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+E+++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE+NQ L+
Sbjct  151  KQLQEKLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLEDNQKLQ  210

Query  16   SQL  8
            SQ+
Sbjct  211  SQI  213



>ref|XP_004987306.1| PREDICTED: uncharacterized protein LOC101775823 [Setaria italica]
Length=163

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 92/134 (69%), Gaps = 9/134 (7%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LESINPTDQVL  374
            +++LDR KRGRGP++V++VAATV V++  +++S+ +I+ R         +  + PTDQVL
Sbjct  30   VLALDRLKRGRGPVMVRTVAATVLVVLASSLHSMAQIRGRAEGELDGAGVVGLTPTDQVL  89

Query  373  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-FDNGKNGGVEEV  197
            LA+ +L+ASLMG+ LFL+L+IDRLH+Y++E+R L+K +EA  K ++   +   +G  EE 
Sbjct  90   LARHLLEASLMGYSLFLALVIDRLHNYVKEIRRLKKNLEAVSKQNKTMLEEATHGRSEES  149

Query  196  NSLKEEIASMKSKI  155
                ++I+  K  +
Sbjct  150  ERDLKDISDAKKDV  163



>emb|CDX85356.1| BnaC07g26670D [Brassica napus]
Length=217

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 119/183 (65%), Gaps = 9/183 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  197
            +ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++   +E+
Sbjct  91   EASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERNEFKEKEDKASKEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+E ++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE+NQ L+
Sbjct  151  KQLQETLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLEDNQKLQ  210

Query  16   SQL  8
            SQ+
Sbjct  211  SQI  213



>ref|NP_001143481.1| hypothetical protein [Zea mays]
 gb|ACF83647.1| unknown [Zea mays]
 gb|ACG32480.1| hypothetical protein [Zea mays]
 gb|AFW77082.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_955327 [Zea 
mays]
Length=161

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LESINPTDQVL  374
            +++LD  KRGRGP++V+++AATV V++  +++S+ +I+           +  + PTDQVL
Sbjct  30   VLALDHLKRGRGPVMVRTIAATVLVVLASSLHSMAKIRGHAEGELDGSGVVGLTPTDQVL  89

Query  373  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEE  200
            LA+ +L+ASLMG+ LFL+L+IDRLH+Y++E R LRK +E   K ++  +   NG +EE
Sbjct  90   LARHLLEASLMGYSLFLALVIDRLHNYVKENRRLRKKLEEVLKQNKALEEATNGKLEE  147



>emb|CDP03896.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 107/179 (60%), Gaps = 11/179 (6%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            LD+ K  +G   V ++A T   +++   +S+ +IQ++   L +++P DQVL    +L+AS
Sbjct  34   LDQVKMRKGT--VLTIAGTFAAILLSNFFSIVKIQNKGAKLGTMSPMDQVLWRTNLLEAS  91

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEVNSL  188
            LMGF LFL  +IDR+HHY+R+L  LR    A +K +   +  K           EE+  +
Sbjct  92   LMGFCLFLGFLIDRMHHYLRKLIGLRSTAGALRKENERLEKDKLQLKEKAEKADEEIKVM  151

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            K+EI+S+   + KLE E   K ++V+  + +  + + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  152  KKEISSLTENLNKLEMESAEKDKKVETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210



>ref|XP_004491413.1| PREDICTED: uncharacterized protein LOC101509893 [Cicer arietinum]
Length=140

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQAS  347
            LD  KRG+GPL+ K+VA+TVFV+   T+Y++ +I  R  ++  INPT++VL+A  +L+AS
Sbjct  33   LDVLKRGKGPLITKTVASTVFVVFGSTIYTILKIHKRSKDAGMINPTEEVLMAHHLLEAS  92

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
            LMGF LF  LMIDR H+Y++E+  LRK ME AKK
Sbjct  93   LMGFSLFFGLMIDRQHYYVKEITSLRKNMEIAKK  126



>ref|XP_009775442.1| PREDICTED: uncharacterized protein LOC104225364 [Nicotiana sylvestris]
Length=216

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 108/183 (59%), Gaps = 11/183 (6%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
             LD+ K  +G   V ++A T+  ++     S+ +IQ++   L ++ P DQVL    +L+A
Sbjct  33   CLDQVKMRKGT--VLTIAGTIAAILFSNFISIIKIQNKGAKLGTMTPMDQVLWRTNLLEA  90

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEVNS  191
            +LMGF LFL  +IDR+HHY+R+L +LR       K  E+ +K    F    +   EE+  
Sbjct  91   TLMGFSLFLGFLIDRMHHYLRKLIVLRNNAGSSKKEFESLEKEKLQFKEKADKAAEEMKQ  150

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
             ++EI+S+   +KK++ + E K + V+  + +  + + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  151  SQKEISSLTESLKKVKLQLEQKNKLVETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210

Query  10   LHA  2
             H 
Sbjct  211  AHG  213



>ref|XP_008235454.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=218

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQLKMGKGPATVKTIACTMSVILLSSFISIVKIQNKGVKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+ +L  LR  + A+K       K        ++   +E+
Sbjct  91   EASLMGFTLFLGFIIDRMHHYLSKLIGLRSNVGASKEEVDRLQKETMQLKEKEDKSSQEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L+E+I+++   +KKL+ EC+ K + ++  + +  + + Q+  LLLEY +LLE+NQ+L+
Sbjct  151  KQLQEKISTLSEDLKKLKLECKEKDKNIETAEAHVAALQKQAADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  TQ  212



>ref|XP_004290194.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458169.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
Length=214

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 105/176 (60%), Gaps = 5/176 (3%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            LD+ K GRGP+ +  +A T+ V+++    S+ ++Q++   L +++P DQVL    IL+AS
Sbjct  34   LDQLKVGRGPVTLIGIAGTMGVILLSRFISIVKMQNKGEKLGTMSPMDQVLYRTHILEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLL---RKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEI  176
            LM F +FL  +IDR H Y+ +L  L   ++ +E  +K        +    +E+  L+E+I
Sbjct  94   LMSFAVFLGFIIDRTHDYLTKLDGLTSTKEEVERLQKEKVQLTEKEEKSSKEIKQLQEKI  153

Query  175  ASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            A++   +KKL+ EC  K + V+  + +  S + Q+  LLLEY  LLE+NQ L++Q 
Sbjct  154  ATLSEDLKKLKLECAEKDKAVETAESHVTSLQKQAADLLLEYDHLLEDNQKLQTQF  209



>ref|XP_009610381.1| PREDICTED: uncharacterized protein LOC104104089 [Nicotiana tomentosiformis]
Length=216

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 108/183 (59%), Gaps = 11/183 (6%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
             LD+ K  +G ++  ++A T+  ++     S+ +IQ++   L ++ P DQVL    +L+A
Sbjct  33   CLDQVKMRKGTVL--TIAGTIAAILFSNFISIIKIQNKGAKLGTMTPMDQVLWRTNLLEA  90

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEVNS  191
            +LMGF LFL  +IDR+HHY+R+L +LR       K  E  +K    F    +   EE+  
Sbjct  91   TLMGFSLFLGFLIDRMHHYLRKLIVLRNSAGSSKKEFERLEKEKLQFKEKADKAAEEMKQ  150

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
             ++EI+S+   +KK++ + E K + V+  + +  + + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  151  SQKEISSLTESLKKVKLQMEEKDKRVETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210

Query  10   LHA  2
             H 
Sbjct  211  AHG  213



>ref|XP_011089080.1| PREDICTED: uncharacterized protein LOC105170143 [Sesamum indicum]
Length=216

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 110/183 (60%), Gaps = 11/183 (6%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQIL  356
            I  LD+ K  R    V ++A T+FV+++  ++S+ +IQ++  +  ++ P DQVL    +L
Sbjct  31   IKGLDQVKMRRA--TVLTIAGTIFVILLSNLFSILKIQNKGAKHGTMTPMDQVLWRTNLL  88

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKNGGVEEV  197
            +A+LMGF LFL  +IDR+HHY+R+L  LR       + +E  +K        +     EV
Sbjct  89   EATLMGFSLFLGFLIDRMHHYMRKLIKLRSNTGVSKQEVEMLEKEKLQLKEKEEKAAGEV  148

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L++E++S+   + KL SE   K ++V+  + +  + + Q+  LLLEY +LLE+NQ+L+
Sbjct  149  KRLQKEMSSLTENLNKLRSESAEKDKKVETAEAHVAALQKQAADLLLEYDRLLEDNQNLQ  208

Query  16   SQL  8
            +Q+
Sbjct  209  TQV  211



>ref|XP_002437063.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
 gb|EER88430.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
Length=160

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 82/117 (70%), Gaps = 8/117 (7%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LESINPTDQVL  374
            +++LDR K+GRGP++V+++AATV V++  +++S+ +I+SR         +  + PTDQVL
Sbjct  30   VVALDRLKQGRGPVMVRTIAATVLVVLASSLHSMTKIRSRADGELDGAGIVGLTPTDQVL  89

Query  373  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  203
            LA+ +L+ASLMG+ LFL+L+IDRLH+Y++E R LRK +E   K +       +G  E
Sbjct  90   LARHVLEASLMGYSLFLALVIDRLHNYVKENRRLRKKLEEVSKQNETMLEATHGPKE  146



>ref|XP_006452413.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475036.1| PREDICTED: uncharacterized protein LOC102621108 [Citrus sinensis]
 gb|ESR65653.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 91/118 (77%), Gaps = 2/118 (2%)
 Frame = -1

Query  583  EMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL  404
            EMA+IL LLF++PLRKLLI+ LD+ K+GRGPLV KSV ATV V++   VY+V EI  R  
Sbjct  12   EMALILALLFESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAVYNVVEIHKRSR  71

Query  403  ES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            ES  +NPT++VL+A  +L+ASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  72   ESGALNPTEEVLMADLLLEASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  129



>ref|XP_004295837.1| PREDICTED: uncharacterized protein LOC101305253 [Fragaria vesca 
subsp. vesca]
Length=152

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = -1

Query  586  GEMAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI-QSR  410
             EM +IL LLF++PLR+L+I+ LD +K+GRGPLV KSV  T+ V  I T+YSV  + + R
Sbjct  11   AEMVLILSLLFRSPLRQLVIMGLDCSKQGRGPLVAKSVGGTILVFFISTIYSVFNVHKKR  70

Query  409  PLES--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRK  266
              E+  INPT++VL+A +IL+ASL GF LFL+LMIDRLH+YI+EL  LRK
Sbjct  71   STEAGFINPTNEVLMAHRILEASLTGFSLFLALMIDRLHYYIKELYRLRK  120



>gb|KDO62066.1| hypothetical protein CISIN_1g046403mg [Citrus sinensis]
Length=117

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = -1

Query  580  MAVIllllfktplrklLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE  401
            MA+IL LLF++PLRKLLI+ LD+ K+GRGPLV KSV ATV V++   VY+V EI  R  E
Sbjct  1    MALILALLFESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAVYNVVEIHKRSRE  60

Query  400  S--INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  236
            S  +NPT++VL+A  +L+ASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  61   SGALNPTEEVLMADLLLEASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  117



>ref|XP_008674143.1| PREDICTED: B-cell receptor-associated protein 31-like [Zea mays]
Length=270

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 104/180 (58%), Gaps = 14/180 (8%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVLLAQQILQAS  347
            +D+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL    +L+AS
Sbjct  34   VDQVKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKNGGVEEVNSL  188
            L+G+ LFL+ +IDRLHHY+R+L  LRK    +++        +R     +     E   L
Sbjct  94   LIGYTLFLAFVIDRLHHYLRKLLTLRKTSSTSREEVEKLQMENRSLREKEEKSSSETKRL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEY-----GQLLEENQH  23
            + EIA +   +KKL+SE E    +    + + ++ + QSE+LL  +     GQL     H
Sbjct  154  QREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLHSFLAARHGQLPSVADH  213



>ref|XP_006340009.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=216

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 110/182 (60%), Gaps = 11/182 (6%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
             LD+ K  +G   V ++A T+  +++    S+ +IQ++   + ++ P DQVL    +L+A
Sbjct  33   CLDQVKMRKGT--VLTIAGTISAILVSNFISIIKIQNKGAKIGTMTPMDQVLWRTNLLEA  90

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEVNS  191
            +LMGF LFL  +IDR+HHY+R+L +LR +  ++KK     +  K       +   EE+  
Sbjct  91   TLMGFSLFLGFLIDRMHHYLRKLIVLRSSAGSSKKEFERLEKEKLQLKEKADKAAEEIKL  150

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
             +++++S+   +KK++ E E K + V+  + +  + + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  151  SQKQLSSLTETLKKVKLESEEKDKRVETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210

Query  10   LH  5
             H
Sbjct  211  AH  212



>ref|XP_010913045.1| PREDICTED: B-cell receptor-associated protein 29-like [Elaeis 
guineensis]
Length=218

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 115/180 (64%), Gaps = 9/180 (5%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQAS  347
            LD+ K G+GP  VK++A T+ VL+  ++ S+ +IQ+R   L ++ P DQVL    +L+AS
Sbjct  34   LDQLKTGKGPATVKTLACTLSVLLASSITSILKIQNRGTKLGTVTPMDQVLWRTHLLEAS  93

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-------FDNGKNGGVEEVNSL  188
            L+G+ LFL L+IDRLHHY+R++  L+K +  +K+           F + ++    E+  L
Sbjct  94   LIGYTLFLGLVIDRLHHYLRKMVTLKKTVGTSKEEVEKLKKEHLHFKDKEDKASSEMQKL  153

Query  187  KEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQL  8
            + E+ S+  K++KL++ECE + +   + + +  S + Q E+LLLEY +LLE+NQ L+ QL
Sbjct  154  QREVGSLTEKLQKLKTECEQQEKRAVSAEAHVVSLQKQLEELLLEYDRLLEDNQILQGQL  213



>ref|XP_004247073.1| PREDICTED: uncharacterized protein LOC101251810 [Solanum lycopersicum]
Length=216

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 109/183 (60%), Gaps = 11/183 (6%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
             LD+ K  +G   V ++A T+  ++     S+ +IQ++   + ++ P DQVL    +L+A
Sbjct  33   CLDQVKMRKGT--VLTIAGTISAILFSNFISIIKIQNKGAKIGTMTPMDQVLWRTNLLEA  90

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------NGGVEEVNS  191
            +LMGF LFL  +IDR+HHY+R+L +LR +  ++KK     +  K       +   EE+  
Sbjct  91   TLMGFSLFLGFLIDRMHHYLRKLIVLRSSAGSSKKEFERLEKEKLQLKEKADKAAEEIKL  150

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
             +++++S+   +KK++ E E K + V+  + +  + + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  151  SQKQLSSLTETLKKVKLESEEKDKRVETAEAHVAALQKQAADLLLEYDRLLEDNQNLQNQ  210

Query  10   LHA  2
             H 
Sbjct  211  AHG  213



>ref|XP_011024634.1| PREDICTED: uncharacterized protein LOC105125752 [Populus euphratica]
Length=218

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 113/182 (62%), Gaps = 9/182 (5%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            I SLD+ K G+ P  VK++A T+ V++ +++ ++ +IQ++   L +++P DQVL    +L
Sbjct  31   IKSLDQVKMGKRPATVKTIAGTMSVILFFSLMNIVKIQNKGAKLGTMSPMDQVLWRTHLL  90

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEV  197
            +ASLMGF LFL  +IDR+HHY+  L  LR+ + ++K       K        ++    E+
Sbjct  91   EASLMGFTLFLGFLIDRMHHYLSRLIGLRRCVGSSKEEVERLQKEKMQLKEKEDKASMEI  150

Query  196  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  17
              L E+I+++   +KKL+ E E K ++++  + +  S + Q   LLLEY +LLE+NQ+L+
Sbjct  151  KLLLEQISTLSESLKKLKLESEKKDKQIETAEAHVVSLQKQCADLLLEYDRLLEDNQNLQ  210

Query  16   SQ  11
            +Q
Sbjct  211  AQ  212



>ref|XP_007201384.1| hypothetical protein PRUPE_ppa012189mg [Prunus persica]
 gb|EMJ02583.1| hypothetical protein PRUPE_ppa012189mg [Prunus persica]
Length=180

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 110/173 (64%), Gaps = 9/173 (5%)
 Frame = -1

Query  502  GRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQASLMGFVL  329
            G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL    +L+ASLMGF L
Sbjct  2    GKGPATVKTIACTMSVILLSSFISIVKIQNKGVKLGTMSPMDQVLWRTHLLEASLMGFTL  61

Query  328  FLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGGVEEVNSLKEEIAS  170
            FL  +IDR+HHY+ +L  LR  + A+K       K        ++   +E+  L+E+I++
Sbjct  62   FLGFIIDRMHHYLSKLIGLRSNVGASKEEVDRLQKETMHLKEKEDKSSQEIKQLQEKIST  121

Query  169  MKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            +   +KKL+ EC+ K + ++  + +  + + Q+  LLLEY +LLE+NQ+L++Q
Sbjct  122  LSEDLKKLKLECKEKDKNIETAEAHVAALQKQAADLLLEYDRLLEDNQNLQTQ  174



>ref|XP_007020770.1| F-box family protein with a domain of Uncharacterized protein 
function, putative [Theobroma cacao]
 gb|EOY12295.1| F-box family protein with a domain of Uncharacterized protein 
function, putative [Theobroma cacao]
Length=543

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = -1

Query  520  LDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQAS  347
            LD+ K GRGP++ K+VA T+FV+ I   Y+  EIQ R LE   INPTD+VLLA +IL+AS
Sbjct  420  LDKIKEGRGPVISKTVAGTLFVVFISISYNAIEIQKRALEGGVINPTDEVLLANRILEAS  479

Query  346  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  245
            LMGF LFL+L+  RLH++I+EL   R+ +EA +K
Sbjct  480  LMGFALFLALVTYRLHYHIKELNPARRRLEADEK  513



>ref|XP_010464329.1| PREDICTED: uncharacterized protein LOC104744901 [Camelina sativa]
Length=220

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 108/194 (56%), Gaps = 31/194 (16%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            SLD+ K G+ P  VK++A T+FV  +  + ++ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQLKLGKAPATVKTIAGTMFVNFLSNLMNIIKIQNKGAKLGTMSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS-------  191
            SLMG VLF   +IDR HHY+ +L  LR             D    G ++++         
Sbjct  93   SLMGVVLFFGFIIDRTHHYLGKLITLRSN-----------DGSSKGELDQLRKERTELKE  141

Query  190  -----------LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  44
                       LKE+++ +   +KK E+E + K  +++  + +  + + QS +LLLEY +
Sbjct  142  KEEKASKEIKQLKEKLSCVLENLKKAENEAKEKETKLETAEAHVTALQKQSSELLLEYDR  201

Query  43   LLEENQHLRSQLHA  2
            LLE+NQ+L++Q+ A
Sbjct  202  LLEDNQNLQTQILA  215



>ref|XP_008455897.1| PREDICTED: B-cell receptor-associated protein 31-like [Cucumis 
melo]
Length=108

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -1

Query  316  MIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESE  137
            MIDRLHHYIRELRLLRK ME AKK  R     ++   E++ +L EE  ++K+KI KLESE
Sbjct  1    MIDRLHHYIRELRLLRKTMEVAKKQIRA---SEDASAEKLKALGEEATTLKNKITKLESE  57

Query  136  CEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHA  2
             E K +E    +  +++ + QS + LLEY +LLE+NQ+LR+QL +
Sbjct  58   VEVKTKEANDAEAETDALRKQSGEYLLEYDRLLEDNQNLRNQLES  102



>ref|XP_009388739.1| PREDICTED: uncharacterized protein LOC103975489 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = -1

Query  529  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQIL  356
            ++ LDR KRGR  ++VK++AAT  +++  ++YS+ EI+ R   L +  PTDQ+L+++ +L
Sbjct  30   VLGLDRLKRGRSTVMVKTLAATAVLVLASSIYSMAEIRLRFAELGAPTPTDQILMSRHLL  89

Query  355  QASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNG  212
            +ASL+G+ LFL+L+IDRLH YI EL  LR +M+A  K +R     K G
Sbjct  90   EASLLGYSLFLALIIDRLHLYIGELHGLRNSMKAVMKQNRVIGTAKTG  137



>ref|XP_010493705.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=219

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 117/181 (65%), Gaps = 9/181 (5%)
 Frame = -1

Query  523  SLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLAQQILQA  350
            SLD+ K G+GP  VK++A T+ V++   + S+ +IQ++   L +++P DQVL    +L+A
Sbjct  33   SLDQMKMGKGPATVKTIAGTMSVILFSNLMSIVKIQNKGSKLGTMSPMDQVLWRTHLLEA  92

Query  349  SLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNS-------  191
            SLMG VLFL  +IDR+HHY+R+L  LR  + ++K+        +    E+          
Sbjct  93   SLMGVVLFLGFIIDRVHHYLRKLINLRSNVGSSKEELEELQKERTEMKEKEEKASKEIKL  152

Query  190  LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQ  11
            L+E+++S+  ++KK E+E + K ++++  + + E+ + QS +LLLEY +LLE+NQHL+SQ
Sbjct  153  LQEKLSSILERLKKAETESKEKEKKLETAETHVEALQKQSAELLLEYDRLLEDNQHLQSQ  212

Query  10   L  8
            +
Sbjct  213  I  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690