BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003F16

Length=722
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011093636.1|  PREDICTED: hexokinase-1                            290   2e-91   Sesamum indicum [beniseed]
gb|KDO66585.1|  hypothetical protein CISIN_1g010895mg                   274   4e-88   Citrus sinensis [apfelsine]
gb|KDO66584.1|  hypothetical protein CISIN_1g010895mg                   275   3e-87   Citrus sinensis [apfelsine]
gb|KHN41674.1|  Hexokinase-1                                            276   9e-87   Glycine soja [wild soybean]
gb|KDO66582.1|  hypothetical protein CISIN_1g010895mg                   275   4e-86   Citrus sinensis [apfelsine]
gb|AFO84084.1|  hexokinase                                              276   5e-86   Actinidia deliciosa [Chinese gooseberry]
emb|CAN83149.1|  hypothetical protein VITISV_024177                     275   6e-86   Vitis vinifera
ref|XP_003525287.1|  PREDICTED: hexokinase-1-like                       275   7e-86   Glycine max [soybeans]
ref|XP_003530493.1|  PREDICTED: hexokinase-1-like                       275   1e-85   Glycine max [soybeans]
ref|XP_007160283.1|  hypothetical protein PHAVU_002G308400g             275   2e-85   Phaseolus vulgaris [French bean]
emb|CBI27996.3|  unnamed protein product                                273   2e-85   Vitis vinifera
ref|NP_001275786.1|  hexokinase                                         275   2e-85   Citrus sinensis [apfelsine]
gb|AEJ95926.1|  HXK1                                                    272   6e-85   Vitis vinifera
ref|XP_002283608.1|  PREDICTED: hexokinase-1-like                       273   9e-85   Vitis vinifera
gb|KDP33801.1|  hypothetical protein JCGZ_07372                         271   2e-84   Jatropha curcas
ref|XP_007013022.1|  Hexokinase 2 isoform 3                             269   4e-84   
gb|AAS60195.1|  hexokinase 4a                                           271   5e-84   Nicotiana tabacum [American tobacco]
gb|KEH21332.1|  hexokinase                                              266   6e-84   Medicago truncatula
gb|AFO84083.1|  hexokinase                                              270   9e-84   Actinidia chinensis
ref|XP_009601881.1|  PREDICTED: hexokinase-2-like                       270   1e-83   Nicotiana tomentosiformis
ref|NP_001234710.1|  hexokinase                                         270   1e-83   Solanum lycopersicum
ref|XP_007013021.1|  Hexokinase 1 isoform 2                             270   1e-83   Theobroma cacao [chocolate]
ref|XP_010049611.1|  PREDICTED: hexokinase-1-like                       269   2e-83   Eucalyptus grandis [rose gum]
ref|XP_008387424.1|  PREDICTED: hexokinase-1-like                       259   2e-83   
ref|XP_007215785.1|  hypothetical protein PRUPE_ppa009797mg             262   2e-83   
ref|XP_007013020.1|  Hexokinase 1 isoform 1                             269   3e-83   
gb|KJB65034.1|  hypothetical protein B456_010G077400                    268   4e-83   Gossypium raimondii
ref|XP_004503491.1|  PREDICTED: hexokinase-1-like isoform X2            268   4e-83   Cicer arietinum [garbanzo]
ref|XP_006353497.1|  PREDICTED: hexokinase-1-like isoform X2            267   4e-83   Solanum tuberosum [potatoes]
ref|XP_004503490.1|  PREDICTED: hexokinase-1-like isoform X1            268   8e-83   
emb|CDP03250.1|  unnamed protein product                                267   8e-83   Coffea canephora [robusta coffee]
ref|XP_008242483.1|  PREDICTED: hexokinase-1                            267   1e-82   Prunus mume [ume]
ref|XP_006353496.1|  PREDICTED: hexokinase-1-like isoform X1            267   1e-82   Solanum tuberosum [potatoes]
ref|XP_007203872.1|  hypothetical protein PRUPE_ppa004637mg             267   1e-82   Prunus persica
ref|XP_010688341.1|  PREDICTED: hexokinase-1                            266   3e-82   Beta vulgaris subsp. vulgaris [field beet]
gb|AET05183.2|  hexokinase                                              266   4e-82   Medicago truncatula
gb|AIB55755.1|  hexokinase, partial (chloroplast)                       256   4e-82   Brassica rapa
gb|KHN40378.1|  Hexokinase-1                                            264   1e-81   Glycine soja [wild soybean]
gb|AHB32106.1|  hexokinase                                              264   2e-81   Camellia sinensis [black tea]
gb|AHD25654.1|  hexokinase 1                                            264   2e-81   Camellia sinensis [black tea]
ref|XP_003516735.1|  PREDICTED: hexokinase-1-like                       263   3e-81   Glycine max [soybeans]
gb|AHG98487.1|  hexokinase                                              263   4e-81   Dimocarpus longan [longan]
gb|AAS60197.1|  hexokinase 5                                            263   4e-81   Nicotiana tabacum [American tobacco]
ref|XP_009795017.1|  PREDICTED: hexokinase-2-like                       263   5e-81   Nicotiana sylvestris
gb|KHG25517.1|  Hexokinase-1 -like protein                              262   7e-81   Gossypium arboreum [tree cotton]
sp|Q9SEK3.1|HXK1_SPIOL  RecName: Full=Hexokinase-1; AltName: Full...    262   9e-81   Spinacia oleracea
gb|KJB83117.1|  hypothetical protein B456_013G230400                    261   2e-80   Gossypium raimondii
ref|XP_011014418.1|  PREDICTED: hexokinase-1-like                       261   2e-80   Populus euphratica
ref|XP_011008120.1|  PREDICTED: hexokinase-1-like                       261   2e-80   Populus euphratica
ref|XP_008458873.1|  PREDICTED: hexokinase-1-like isoform X3            260   4e-80   Cucumis melo [Oriental melon]
ref|XP_003630707.1|  Hexokinase                                         263   4e-80   
ref|XP_010249484.1|  PREDICTED: hexokinase-1                            260   5e-80   Nelumbo nucifera [Indian lotus]
ref|XP_008458856.1|  PREDICTED: hexokinase-1-like isoform X2            260   6e-80   
ref|NP_001284452.1|  hexokinase-1-like                                  259   1e-79   Cucumis melo [Oriental melon]
gb|AAS60196.1|  hexokinase 4b                                           259   1e-79   Nicotiana tabacum [American tobacco]
ref|XP_008228416.1|  PREDICTED: hexokinase-1-like                       259   2e-79   Prunus mume [ume]
ref|XP_002325031.1|  Hexokinase 1 family protein                        259   2e-79   Populus trichocarpa [western balsam poplar]
ref|XP_007024321.1|  Hexokinase 2                                       258   3e-79   
ref|XP_008458849.1|  PREDICTED: hexokinase-1-like isoform X1            260   3e-79   Cucumis melo [Oriental melon]
gb|KHG22031.1|  Hexokinase-1                                            259   3e-79   Gossypium arboreum [tree cotton]
gb|KHN27811.1|  Hexokinase-1                                            256   4e-79   Glycine soja [wild soybean]
gb|ADZ96378.1|  hexokinase 1                                            258   4e-79   Eriobotrya japonica [loquat]
gb|AID50967.1|  hexokinase 1                                            258   5e-79   Malus domestica [apple tree]
ref|XP_002514221.1|  hexokinase, putative                               257   6e-79   Ricinus communis
gb|AFU82542.1|  hexokinase                                              248   7e-79   Artemisia tridentata [big sagebrush]
ref|XP_009338734.1|  PREDICTED: hexokinase-1-like isoform X1            257   8e-79   Pyrus x bretschneideri [bai li]
gb|AAL60583.1|AF454961_1  hexokinase                                    257   9e-79   Brassica oleracea
gb|ACJ04704.1|  hexokinase 1                                            257   9e-79   Cucumis melo [Oriental melon]
emb|CDY03331.1|  BnaC09g10170D                                          257   9e-79   
ref|XP_010267128.1|  PREDICTED: hexokinase-1-like                       257   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_006408903.1|  hypothetical protein EUTSA_v10001968mg             257   1e-78   Eutrema salsugineum [saltwater cress]
gb|KFK40349.1|  hypothetical protein AALP_AA3G362600                    256   2e-78   Arabis alpina [alpine rockcress]
ref|XP_003529000.1|  PREDICTED: hexokinase-1-like                       256   3e-78   Glycine max [soybeans]
ref|XP_004135675.1|  PREDICTED: hexokinase-2-like                       256   3e-78   Cucumis sativus [cucumbers]
ref|XP_008337603.1|  PREDICTED: hexokinase-1-like                       255   5e-78   
ref|XP_004141023.1|  PREDICTED: hexokinase-1-like                       255   5e-78   
ref|XP_009102132.1|  PREDICTED: hexokinase-1                            255   6e-78   Brassica rapa
ref|NP_001280783.1|  uncharacterized protein LOC103443741               254   6e-78   Malus domestica [apple tree]
gb|AIX02984.1|  hexokinase                                              254   7e-78   Morella rubra [Chinese arbutus]
gb|KJB56835.1|  hypothetical protein B456_009G137700                    254   9e-78   Gossypium raimondii
emb|CDY48733.1|  BnaA09g10080D                                          254   1e-77   Brassica napus [oilseed rape]
gb|AAL60584.1|AF454962_1  hexokinase                                    254   1e-77   Brassica oleracea
gb|ABI18156.1|  hexokinase                                              254   1e-77   Helianthus annuus
ref|XP_009112637.1|  PREDICTED: hexokinase-1-like                       253   2e-77   Brassica rapa
ref|XP_010098150.1|  hypothetical protein L484_026284                   253   3e-77   Morus notabilis
emb|CDY35895.1|  BnaA07g00920D                                          253   3e-77   Brassica napus [oilseed rape]
ref|XP_007152969.1|  hypothetical protein PHAVU_004G175500g             253   5e-77   Phaseolus vulgaris [French bean]
gb|KEH27216.1|  hexokinase                                              252   5e-77   Medicago truncatula
gb|AHY84731.1|  hexokinase                                              251   1e-76   Manihot esculenta [manioc]
ref|XP_004302852.1|  PREDICTED: hexokinase-1-like                       251   3e-76   Fragaria vesca subsp. vesca
ref|XP_004287480.1|  PREDICTED: hexokinase-1                            250   4e-76   Fragaria vesca subsp. vesca
ref|XP_002886018.1|  ATHXK2                                             249   6e-76   Arabidopsis lyrata subsp. lyrata
ref|XP_010467923.1|  PREDICTED: hexokinase-2 isoform X2                 247   7e-76   Camelina sativa [gold-of-pleasure]
gb|KHN40379.1|  Hexokinase-2                                            249   8e-76   Glycine soja [wild soybean]
ref|XP_010526433.1|  PREDICTED: hexokinase-1                            249   9e-76   Tarenaya hassleriana [spider flower]
ref|XP_008387327.1|  PREDICTED: hexokinase-1-like                       249   1e-75   
ref|XP_006299465.1|  hypothetical protein CARUB_v10015630mg             249   2e-75   Capsella rubella
ref|XP_010540986.1|  PREDICTED: hexokinase-1-like                       248   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_004513053.1|  PREDICTED: hexokinase-1-like                       248   2e-75   Cicer arietinum [garbanzo]
gb|KFK29465.1|  hypothetical protein AALP_AA7G137600                    248   4e-75   Arabis alpina [alpine rockcress]
ref|XP_010489125.1|  PREDICTED: hexokinase-2-like                       248   4e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006853711.1|  hypothetical protein AMTR_s00056p00151260          247   6e-75   Amborella trichopoda
ref|XP_010467922.1|  PREDICTED: hexokinase-2 isoform X1                 247   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_003516783.1|  PREDICTED: hexokinase-1-like                       247   6e-75   Glycine max [soybeans]
gb|EYU27268.1|  hypothetical protein MIMGU_mgv1a019208mg                246   9e-75   Erythranthe guttata [common monkey flower]
gb|AAA60333.1|  hexokinase                                              244   1e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KHG28915.1|  Hexokinase-1                                            246   1e-74   Gossypium arboreum [tree cotton]
ref|XP_002867423.1|  ATHXK1                                             246   1e-74   Arabidopsis lyrata subsp. lyrata
gb|KJB70380.1|  hypothetical protein B456_011G070700                    246   2e-74   Gossypium raimondii
ref|NP_001077921.1|  hexokinase 2                                       242   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416617.1|  PREDICTED: hexokinase-2-like                       245   4e-74   Camelina sativa [gold-of-pleasure]
pdb|4QS9|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S17...    244   5e-74   Arabidopsis thaliana [mouse-ear cress]
pdb|4QS7|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure ...    244   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194642.1|  hexokinase 1                                          244   7e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007135629.1|  hypothetical protein PHAVU_010G144900g             244   1e-73   Phaseolus vulgaris [French bean]
ref|XP_002515958.1|  hexokinase, putative                               243   1e-73   Ricinus communis
gb|AHY84734.1|  hexokinase                                              243   1e-73   Manihot esculenta [manioc]
ref|XP_006285258.1|  hypothetical protein CARUB_v10006629mg             243   2e-73   Capsella rubella
gb|AAO24584.1|  At2g19860                                               243   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179576.1|  hexokinase 2                                          243   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778615.1|  PREDICTED: hexokinase-2-like isoform X2            236   4e-73   
ref|XP_010447886.1|  PREDICTED: hexokinase-1                            242   4e-73   
ref|XP_004510315.1|  PREDICTED: hexokinase-1-like                       241   8e-73   Cicer arietinum [garbanzo]
ref|XP_010438337.1|  PREDICTED: hexokinase-1-like                       241   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010433133.1|  PREDICTED: hexokinase-1-like                       240   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010665886.1|  PREDICTED: hexokinase-1-like isoform X2            239   3e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008778614.1|  PREDICTED: hexokinase-2-like isoform X1            236   4e-72   Phoenix dactylifera
ref|XP_003533038.1|  PREDICTED: hexokinase-1-like isoform X1            239   4e-72   Glycine max [soybeans]
gb|KDP40854.1|  hypothetical protein JCGZ_24853                         239   4e-72   Jatropha curcas
ref|XP_010924444.1|  PREDICTED: hexokinase-2-like isoform X2            239   8e-72   Elaeis guineensis
ref|NP_001233957.1|  hexokinase                                         239   1e-71   Solanum lycopersicum
ref|XP_010665885.1|  PREDICTED: hexokinase-1-like isoform X1            239   1e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010924442.1|  PREDICTED: hexokinase-2-like isoform X1            239   1e-71   Elaeis guineensis
gb|AAP40021.1|  hexokinase                                              238   2e-71   Nicotiana benthamiana
ref|XP_008795842.1|  PREDICTED: hexokinase-2-like isoform X2            238   2e-71   Phoenix dactylifera
ref|XP_010915190.1|  PREDICTED: hexokinase-2-like                       238   2e-71   Elaeis guineensis
ref|XP_003627048.1|  Hexokinase                                         238   2e-71   Medicago truncatula
gb|AFK48467.1|  unknown                                                 228   2e-71   Lotus japonicus
ref|XP_009352555.1|  PREDICTED: hexokinase-1                            238   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_008795834.1|  PREDICTED: hexokinase-2-like isoform X1            238   3e-71   Phoenix dactylifera
ref|XP_002283574.1|  PREDICTED: hexokinase-2                            238   3e-71   Vitis vinifera
dbj|BAP47497.1|  hexokinase                                             237   3e-71   Gentiana triflora
gb|EYU21451.1|  hypothetical protein MIMGU_mgv1a005070mg                237   4e-71   Erythranthe guttata [common monkey flower]
ref|XP_009803252.1|  PREDICTED: hexokinase-1                            236   1e-70   Nicotiana sylvestris
emb|CBI36049.3|  unnamed protein product                                234   2e-70   Vitis vinifera
ref|XP_009606563.1|  PREDICTED: hexokinase-1                            235   2e-70   Nicotiana tomentosiformis
gb|KJB35041.1|  hypothetical protein B456_006G096800                    235   2e-70   Gossypium raimondii
ref|XP_006343033.1|  PREDICTED: hexokinase-1-like                       234   4e-70   
sp|Q9SEK2.1|HXK1_TOBAC  RecName: Full=Hexokinase-1; AltName: Full...    234   4e-70   Nicotiana tabacum [American tobacco]
gb|AAT77515.1|  hexokinase 7                                            233   1e-69   Nicotiana tabacum [American tobacco]
emb|CDO97969.1|  unnamed protein product                                233   1e-69   Coffea canephora [robusta coffee]
ref|XP_011000949.1|  PREDICTED: hexokinase-1-like                       231   5e-69   Populus euphratica
gb|EYU45835.1|  hypothetical protein MIMGU_mgv1a005054mg                231   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_002299739.1|  hypothetical protein POPTR_0001s19130g             229   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_011072439.1|  PREDICTED: hexokinase-1-like                       230   3e-68   Sesamum indicum [beniseed]
ref|XP_009406171.1|  PREDICTED: hexokinase-2-like                       229   4e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789199.1|  PREDICTED: hexokinase-2-like                       229   5e-68   
ref|XP_009415191.1|  PREDICTED: hexokinase-2-like                       226   6e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009777315.1|  PREDICTED: hexokinase-2                            225   1e-66   Nicotiana sylvestris
ref|XP_009622660.1|  PREDICTED: hexokinase-2                            224   3e-66   Nicotiana tomentosiformis
gb|AAS60194.1|  hexokinase 3                                            224   4e-66   Nicotiana tabacum [American tobacco]
gb|KDO51804.1|  hypothetical protein CISIN_1g0115052mg                  218   5e-66   Citrus sinensis [apfelsine]
ref|XP_010915379.1|  PREDICTED: hexokinase-2-like                       223   1e-65   Elaeis guineensis
gb|AEB00838.1|  hexokinase 2                                            222   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009394175.1|  PREDICTED: hexokinase-2-like                       222   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89593.1|  predicted protein                                      221   3e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009392524.1|  PREDICTED: hexokinase-2-like                       221   5e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010231125.1|  PREDICTED: hexokinase-2 isoform X2                 216   6e-64   
gb|AAT77513.1|  hexokinase 3                                            218   8e-64   Nicotiana sylvestris
ref|NP_001274841.1|  hexokinase-2                                       218   9e-64   Solanum tuberosum [potatoes]
ref|XP_004969912.1|  PREDICTED: hexokinase-6-like                       217   2e-63   Setaria italica
gb|ABA01010.1|  hexokinase                                              217   2e-63   Solanum chacoense
ref|XP_006465701.1|  PREDICTED: hexokinase-1-like                       216   3e-63   Citrus sinensis [apfelsine]
ref|XP_006426867.1|  hypothetical protein CICLE_v10025452mg             216   3e-63   Citrus clementina [clementine]
ref|XP_003568034.1|  PREDICTED: hexokinase-2 isoform X1                 216   4e-63   Brachypodium distachyon [annual false brome]
dbj|BAJ93240.1|  predicted protein                                      216   6e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006654666.1|  PREDICTED: hexokinase-5-like                       214   8e-63   
ref|XP_010322313.1|  PREDICTED: hexokinase isoform X1                   215   9e-63   Solanum lycopersicum
ref|XP_003568072.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-5...    215   9e-63   
emb|CAN74362.1|  hypothetical protein VITISV_016381                     216   1e-62   Vitis vinifera
ref|NP_001234406.1|  hexokinase                                         214   2e-62   
gb|KCW79624.1|  hypothetical protein EUGRSUZ_C00983                     213   3e-62   Eucalyptus grandis [rose gum]
gb|EMT08969.1|  Hexokinase-5                                            211   6e-62   
gb|EMS55979.1|  Hexokinase-5                                            210   9e-62   Triticum urartu
ref|XP_010047252.1|  PREDICTED: hexokinase-2-like                       213   9e-62   Eucalyptus grandis [rose gum]
ref|XP_010047667.1|  PREDICTED: hexokinase-1-like                       212   2e-61   Eucalyptus grandis [rose gum]
gb|EAZ13494.1|  hypothetical protein OsJ_03410                          210   5e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646311.1|  PREDICTED: hexokinase-6-like                       211   8e-61   
ref|XP_011080413.1|  PREDICTED: hexokinase-1-like                       210   8e-61   Sesamum indicum [beniseed]
ref|NP_001044214.1|  Os01g0742500                                       209   2e-60   
ref|XP_004961448.1|  PREDICTED: hexokinase-5-like                       208   6e-60   Setaria italica
sp|Q2KNB9.1|HXK2_ORYSJ  RecName: Full=Hexokinase-2; AltName: Full...    206   2e-59   Oryza sativa Japonica Group [Japonica rice]
gb|AFW78822.1|  hexokinase-2                                            206   3e-59   
sp|O64390.1|HXK1_SOLTU  RecName: Full=Hexokinase-1; AltName: Full...    205   7e-59   Solanum tuberosum [potatoes]
gb|ACG44289.1|  hexokinase-2                                            204   1e-58   Zea mays [maize]
ref|NP_001123599.1|  hexokinase2                                        204   1e-58   Zea mays [maize]
ref|XP_003569773.1|  PREDICTED: hexokinase-6                            204   2e-58   Brachypodium distachyon [annual false brome]
dbj|BAK06520.1|  predicted protein                                      203   5e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002440104.1|  hypothetical protein SORBIDRAFT_09g026080          203   6e-58   Sorghum bicolor [broomcorn]
gb|EAY98804.1|  hypothetical protein OsI_20748                          202   1e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_008675068.1|  PREDICTED: hexokinase-6                            202   2e-57   Zea mays [maize]
gb|EMS60419.1|  Hexokinase-9                                            197   2e-57   Triticum urartu
ref|XP_002458467.1|  hypothetical protein SORBIDRAFT_03g034230          201   3e-57   Sorghum bicolor [broomcorn]
emb|CDM84036.1|  unnamed protein product                                199   2e-56   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001056082.1|  Os05g0522500                                       198   2e-56   
gb|EAY98739.1|  hypothetical protein OsI_20669                          198   3e-56   Oryza sativa Indica Group [Indian rice]
sp|Q2KNB7.1|HXK9_ORYSJ  RecName: Full=Hexokinase-9; AltName: Full...    198   3e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75659.1|  hypothetical protein OsI_03566                          198   3e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_010271549.1|  PREDICTED: probable hexokinase-like 2 protein      196   1e-55   
gb|EMT04435.1|  Hexokinase-6                                            196   1e-55   
gb|ABR18277.1|  unknown                                                 197   2e-55   Picea sitchensis
gb|ACN35115.1|  unknown                                                 194   4e-55   Zea mays [maize]
ref|XP_003635648.1|  PREDICTED: probable hexokinase-like 2 protein      186   6e-55   
emb|CBI23561.3|  unnamed protein product                                186   1e-54   Vitis vinifera
gb|AFW82530.1|  hexokinase                                              194   1e-54   
gb|EPS70676.1|  hexokinase 1a                                           192   3e-54   Genlisea aurea
gb|EMT15586.1|  Hexokinase-7                                            191   5e-54   
ref|NP_001105529.1|  LOC542510                                          192   5e-54   
ref|XP_006654122.1|  PREDICTED: hexokinase-7-like                       188   8e-54   
gb|AAT47078.1|  unknown protein                                         194   9e-53   Oryza sativa Japonica Group [Japonica rice]
emb|CBI23516.3|  unnamed protein product                                188   1e-52   Vitis vinifera
ref|XP_003635485.1|  PREDICTED: probable hexokinase-like 2 protein      188   2e-52   Vitis vinifera
ref|XP_004960891.1|  PREDICTED: hexokinase-7-like isoform X2            186   4e-52   
ref|XP_004960890.1|  PREDICTED: hexokinase-7-like isoform X1            186   5e-52   Setaria italica
ref|XP_011021821.1|  PREDICTED: probable hexokinase-like 2 protein      185   2e-51   Populus euphratica
ref|XP_006380814.1|  hypothetical protein POPTR_0007s14490g             184   2e-51   
sp|Q1WM16.2|HXK7_ORYSJ  RecName: Full=Hexokinase-7; AltName: Full...    184   3e-51   Oryza sativa Japonica Group [Japonica rice]
gb|KGN60580.1|  hypothetical protein Csa_2G000870                       175   4e-51   Cucumis sativus [cucumbers]
gb|AAZ93624.1|  hexokinase 7                                            184   4e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002310319.2|  hexokinase family protein                          184   5e-51   
gb|EPS60819.1|  hexokinase                                              183   5e-51   Genlisea aurea
gb|EEC78650.1|  hypothetical protein OsI_18744                          184   5e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_002988103.1|  hypothetical protein SELMODRAFT_269350             184   5e-51   Selaginella moellendorffii
ref|XP_006426179.1|  hypothetical protein CICLE_v10027315mg             184   7e-51   Citrus clementina [clementine]
ref|XP_002972691.1|  hypothetical protein SELMODRAFT_441916             184   9e-51   Selaginella moellendorffii
ref|XP_008807620.1|  PREDICTED: hexokinase-2, chloroplastic-like        174   2e-50   
ref|XP_004172942.1|  PREDICTED: LOW QUALITY PROTEIN: probable hex...    180   2e-50   
ref|XP_003568782.1|  PREDICTED: hexokinase-7                            181   3e-50   Brachypodium distachyon [annual false brome]
ref|XP_007047663.1|  Hexokinase-like 3                                  181   5e-50   
emb|CDP03252.1|  unnamed protein product                                174   7e-50   Coffea canephora [robusta coffee]
ref|XP_002440735.1|  hypothetical protein SORBIDRAFT_09g005840          180   7e-50   Sorghum bicolor [broomcorn]
gb|AEB00837.1|  hexokinase 1                                            177   7e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006466389.1|  PREDICTED: probable hexokinase-like 2 protei...    181   8e-50   Citrus sinensis [apfelsine]
ref|XP_004143424.1|  PREDICTED: probable hexokinase-like 2 protei...    181   8e-50   Cucumis sativus [cucumbers]
ref|XP_006646274.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-9...    181   8e-50   
ref|XP_008787361.1|  PREDICTED: hexokinase-2-like                       182   8e-50   
ref|XP_008440464.1|  PREDICTED: probable hexokinase-like 2 protei...    181   1e-49   Cucumis melo [Oriental melon]
ref|XP_011099434.1|  PREDICTED: probable hexokinase-like 2 protein      180   1e-49   Sesamum indicum [beniseed]
ref|XP_009771324.1|  PREDICTED: probable hexokinase-like 2 protein      180   2e-49   Nicotiana sylvestris
ref|XP_004231963.1|  PREDICTED: probable hexokinase-like 2 protein      179   3e-49   Solanum lycopersicum
ref|XP_010941986.1|  PREDICTED: hexokinase-2-like                       179   4e-49   Elaeis guineensis
dbj|BAB78697.1|  hexokinase                                             174   4e-49   Nicotiana tabacum [American tobacco]
ref|XP_001784630.1|  hexokinase protein HXK2                            179   5e-49   
ref|XP_001754148.1|  hexokinase protein HXK7                            179   8e-49   
gb|ACN29323.1|  unknown                                                 178   1e-48   Zea mays [maize]
ref|XP_006357744.1|  PREDICTED: probable hexokinase-like 2 protei...    178   1e-48   Solanum tuberosum [potatoes]
ref|XP_010232254.1|  PREDICTED: hexokinase-9-like isoform X2            177   1e-48   
ref|XP_010920252.1|  PREDICTED: hexokinase-2, chloroplastic             178   1e-48   Elaeis guineensis
ref|NP_001146056.1|  hypothetical protein                               178   1e-48   Zea mays [maize]
ref|XP_003567061.1|  PREDICTED: hexokinase-9-like isoform X1            177   2e-48   Brachypodium distachyon [annual false brome]
gb|EMS52197.1|  Hexokinase-8                                            175   2e-48   Triticum urartu
ref|XP_001752229.1|  hexokinase protein HXK8                            177   2e-48   
ref|XP_004509202.1|  PREDICTED: probable hexokinase-like 2 protei...    177   2e-48   Cicer arietinum [garbanzo]
ref|XP_001770177.1|  hexokinase protein HXK9                            177   3e-48   
gb|KDO84849.1|  hypothetical protein CISIN_1g011283mg                   176   3e-48   Citrus sinensis [apfelsine]
ref|XP_006473649.1|  PREDICTED: hexokinase-2, chloroplastic-like        177   3e-48   Citrus sinensis [apfelsine]
gb|KJB40324.1|  hypothetical protein B456_007G057600                    176   4e-48   Gossypium raimondii
ref|XP_008365574.1|  PREDICTED: probable hexokinase-like 2 protein      177   4e-48   
ref|XP_002510526.1|  hexokinase, putative                               176   5e-48   Ricinus communis
ref|XP_009354634.1|  PREDICTED: probable hexokinase-like 2 protein      177   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_007017793.1|  Hexokinase 3                                       176   6e-48   
ref|XP_009375879.1|  PREDICTED: probable hexokinase-like 2 protein      176   7e-48   Pyrus x bretschneideri [bai li]
gb|AHY84730.1|  hexokinase                                              176   8e-48   Manihot esculenta [manioc]
ref|XP_011083536.1|  PREDICTED: hexokinase-2, chloroplastic             176   8e-48   Sesamum indicum [beniseed]
ref|XP_009605675.1|  PREDICTED: probable hexokinase-like 2 protein      176   8e-48   Nicotiana tomentosiformis
ref|XP_010061051.1|  PREDICTED: hexokinase-2, chloroplastic             175   1e-47   Eucalyptus grandis [rose gum]
gb|EYU44540.1|  hypothetical protein MIMGU_mgv1a006774mg                174   1e-47   Erythranthe guttata [common monkey flower]
gb|KHN01703.1|  Putative hexokinase-like 2 protein                      174   1e-47   Glycine soja [wild soybean]
ref|XP_001779478.1|  hexokinase protein HXK11                           176   1e-47   
gb|KHN47567.1|  Putative hexokinase-like 2 protein                      175   2e-47   
ref|XP_004968460.1|  PREDICTED: hexokinase-8-like                       174   2e-47   
ref|XP_002866929.1|  hypothetical protein ARALYDRAFT_490831             174   2e-47   
ref|XP_006600900.1|  PREDICTED: probable hexokinase-like 2 protei...    174   2e-47   
ref|XP_008342598.1|  PREDICTED: probable hexokinase-like 2 protein      174   3e-47   
ref|XP_003550953.1|  PREDICTED: probable hexokinase-like 2 protei...    174   3e-47   
ref|XP_006435174.1|  hypothetical protein CICLE_v10000939mg             174   3e-47   
emb|CDP02662.1|  unnamed protein product                                174   3e-47   
ref|XP_006580806.1|  PREDICTED: probable hexokinase-like 2 protei...    174   4e-47   
ref|XP_002455027.1|  hypothetical protein SORBIDRAFT_03g003190          174   4e-47   
ref|XP_007155782.1|  hypothetical protein PHAVU_003G231300g             173   5e-47   
gb|AAZ93625.1|  hexokinase 8                                            172   7e-47   
ref|XP_007208760.1|  hypothetical protein PRUPE_ppa025661mg             173   7e-47   
ref|XP_008236899.1|  PREDICTED: probable hexokinase-like 2 protein      173   7e-47   
sp|Q1WM15.2|HXK8_ORYSJ  RecName: Full=Hexokinase-8; AltName: Full...    172   8e-47   
gb|ACN25682.1|  unknown                                                 172   9e-47   
ref|NP_001130970.1|  uncharacterized protein LOC100192075               173   9e-47   
ref|XP_008672063.1|  PREDICTED: uncharacterized protein LOC100192...    173   1e-46   
gb|KDO78770.1|  hypothetical protein CISIN_1g038487mg                   172   1e-46   
ref|NP_001042264.1|  Os01g0190400                                       172   1e-46   
ref|XP_002984124.1|  hypothetical protein SELMODRAFT_234446             172   1e-46   
emb|CDP07402.1|  unnamed protein product                                172   1e-46   
gb|ACG43712.1|  hexokinase-1                                            172   1e-46   
ref|NP_001150106.1|  hexokinase-1                                       171   2e-46   
ref|XP_009109397.1|  PREDICTED: probable hexokinase-like 2 protein      172   2e-46   
ref|XP_002528913.1|  hexokinase, putative                               171   3e-46   
ref|XP_010104447.1|  Hexokinase-2                                       171   5e-46   
ref|XP_010268380.1|  PREDICTED: hexokinase-2, chloroplastic             170   6e-46   
gb|ACG47843.1|  hexokinase-1                                            171   7e-46   
ref|XP_006643859.1|  PREDICTED: hexokinase-8-like                       169   7e-46   
ref|XP_010527158.1|  PREDICTED: probable hexokinase-like 2 protein      170   8e-46   
ref|XP_011045105.1|  PREDICTED: hexokinase-2, chloroplastic             169   1e-45   
ref|XP_007222247.1|  hypothetical protein PRUPE_ppa004715mg             168   3e-45   
ref|XP_001784334.1|  hexokinase protein HXK3                            169   3e-45   
ref|XP_007222248.1|  hypothetical protein PRUPE_ppa004715mg             169   3e-45   
ref|XP_003589478.1|  Hexokinase I                                       168   3e-45   
ref|XP_004499271.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-2...    168   5e-45   
ref|XP_010437179.1|  PREDICTED: LOW QUALITY PROTEIN: probable hex...    167   1e-44   
gb|KDP36930.1|  hypothetical protein JCGZ_08221                         167   1e-44   
gb|AHD25655.1|  hexokinase 2                                            167   1e-44   
ref|XP_002972212.1|  hypothetical protein SELMODRAFT_231902             166   2e-44   
ref|XP_004289383.1|  PREDICTED: probable hexokinase-like 2 protein      166   2e-44   
gb|AIT55904.1|  hexokinase                                              166   4e-44   
gb|KHG14299.1|  Hexokinase-2, chloroplastic                             165   5e-44   
sp|Q6Q8A5.1|HXK2_TOBAC  RecName: Full=Hexokinase-2, chloroplastic...    165   6e-44   
emb|CBI19858.3|  unnamed protein product                                163   6e-44   
ref|XP_009626314.1|  PREDICTED: hexokinase-2, chloroplastic             165   7e-44   
ref|XP_009780796.1|  PREDICTED: hexokinase-2, chloroplastic             165   8e-44   
ref|XP_001772444.1|  hexokinase protein HXK1                            165   8e-44   
gb|AAQ72424.1|  hexokinase PpHxk1                                       165   8e-44   
gb|AEJ95927.1|  HXK2                                                    164   9e-44   
ref|XP_006661182.1|  PREDICTED: hexokinase-1-like                       164   1e-43   
ref|XP_002974995.1|  hypothetical protein SELMODRAFT_150326             164   1e-43   
ref|XP_002977412.1|  hypothetical protein SELMODRAFT_232972             164   1e-43   
ref|XP_008387945.1|  PREDICTED: hexokinase-2, chloroplastic             164   1e-43   
ref|NP_001234717.1|  plastidic hexokinase                               164   1e-43   
ref|XP_003564653.1|  PREDICTED: hexokinase-8-like                       163   2e-43   
ref|XP_007160669.1|  hypothetical protein PHAVU_001G007000g             164   2e-43   
ref|XP_004291365.1|  PREDICTED: hexokinase-2, chloroplastic             163   2e-43   
gb|EEC70091.1|  hypothetical protein OsI_00720                          163   3e-43   
ref|XP_009335085.1|  PREDICTED: hexokinase-2, chloroplastic             163   3e-43   
ref|NP_001267834.1|  hexokinase                                         163   3e-43   
gb|KJB63529.1|  hypothetical protein B456_010G004700                    163   3e-43   
gb|EEE54030.1|  hypothetical protein OsJ_00699                          162   4e-43   
ref|XP_007156986.1|  hypothetical protein PHAVU_002G034000g             162   7e-43   
ref|NP_001275315.1|  hexokinase-related protein 1                       162   9e-43   
ref|XP_006829458.1|  hypothetical protein AMTR_s00254p00018780          161   1e-42   
ref|XP_003550424.1|  PREDICTED: hexokinase-2, chloroplastic-like ...    161   1e-42   
ref|XP_002298298.1|  hexokinase family protein                          160   3e-42   
ref|XP_009405075.1|  PREDICTED: hexokinase-2-like                       160   8e-42   
ref|XP_009388038.1|  PREDICTED: hexokinase-3-like                       157   1e-41   
gb|EMT13168.1|  Hexokinase-8                                            158   1e-41   
gb|KGN60032.1|  hypothetical protein Csa_3G872140                       158   1e-41   
gb|AAT77512.1|  hexokinase 2                                            157   2e-41   
ref|XP_004136385.1|  PREDICTED: hexokinase-2, chloroplastic-like        158   2e-41   
gb|AEB00840.1|  hexokinase 4                                            151   3e-41   
ref|XP_001776765.1|  hexokinase protein HXK10                           158   3e-41   
ref|XP_001762951.1|  hexokinase protein HXK6                            157   4e-41   
ref|XP_006411846.1|  hypothetical protein EUTSA_v10027262mg             157   4e-41   
ref|XP_008221267.1|  PREDICTED: hexokinase-2, chloroplastic             156   1e-40   
ref|XP_010092207.1|  hypothetical protein L484_013525                   155   1e-40   
ref|XP_003545034.1|  PREDICTED: hexokinase-2, chloroplastic-like        156   1e-40   
ref|XP_008466487.1|  PREDICTED: hexokinase-2, chloroplastic             155   1e-40   
emb|CDX90402.1|  BnaA08g15820D                                          155   2e-40   
ref|XP_004140206.1|  PREDICTED: hexokinase-3-like                       155   2e-40   
gb|KGN48114.1|  hypothetical protein Csa_6G434340                       155   2e-40   
gb|EAZ39651.1|  hypothetical protein OsJ_24079                          153   4e-40   
gb|KFK30395.1|  hypothetical protein AALP_AA7G255700                    155   4e-40   
gb|EMT31348.1|  Hexokinase-9                                            156   4e-40   
ref|XP_008449690.1|  PREDICTED: hexokinase-3                            154   6e-40   
gb|ADN33926.1|  hexokinase                                              154   7e-40   
ref|NP_195497.1|  hexokinase-like 3                                     154   7e-40   
ref|XP_010695425.1|  PREDICTED: hexokinase-2, chloroplastic             154   8e-40   
gb|EAZ03706.1|  hypothetical protein OsI_25838                          153   1e-39   
ref|NP_001059538.1|  Os07g0446800                                       153   1e-39   
gb|EYU46224.1|  hypothetical protein MIMGU_mgv1a004779mg                153   1e-39   
ref|XP_003580531.1|  PREDICTED: hexokinase-4, chloroplastic             152   2e-39   
ref|XP_009132731.1|  PREDICTED: probable hexokinase-like 2 protein      152   3e-39   
ref|XP_010106711.1|  hypothetical protein L484_000821                   143   3e-39   
emb|CDY49677.1|  BnaC03g61220D                                          151   5e-39   
ref|NP_001059124.1|  Os07g0197100                                       152   5e-39   
ref|XP_004972151.1|  PREDICTED: hexokinase-9-like                       143   6e-39   
gb|EAZ03118.1|  hypothetical protein OsI_25263                          151   6e-39   
gb|AHZ34665.1|  hexokinase 3 (chloroplast)                              151   9e-39   
ref|XP_006285339.1|  hypothetical protein CARUB_v10006729mg             150   1e-38   
dbj|BAK01318.1|  predicted protein                                      150   1e-38   
ref|XP_010273376.1|  PREDICTED: hexokinase-3-like                       146   1e-38   
ref|XP_002894073.1|  hypothetical protein ARALYDRAFT_314227             150   2e-38   
ref|XP_008227192.1|  PREDICTED: hexokinase-3 isoform X2                 149   3e-38   
ref|XP_003517518.1|  PREDICTED: hexokinase-3-like                       149   3e-38   
ref|XP_006657535.1|  PREDICTED: hexokinase-4, chloroplastic-like        148   5e-38   
ref|XP_008227191.1|  PREDICTED: hexokinase-3 isoform X1                 149   5e-38   
ref|XP_010432022.1|  PREDICTED: probable hexokinase-like 2 protein      149   6e-38   
ref|XP_006590474.1|  PREDICTED: hexokinase-3-like                       149   6e-38   
ref|XP_001760948.1|  hexokinase protein HXK4                            149   6e-38   
ref|XP_010045034.1|  PREDICTED: hexokinase-4-like                       147   7e-38   
ref|XP_010500300.1|  PREDICTED: hexokinase-like 1 protein               148   8e-38   
ref|NP_001056137.1|  Os05g0532600                                       139   2e-37   
gb|AIU64847.1|  hexokinase-3                                            146   5e-37   
ref|XP_010273315.1|  PREDICTED: hexokinase-3-like                       145   7e-37   
ref|XP_008775017.1|  PREDICTED: hexokinase-3-like isoform X2            145   9e-37   
ref|XP_010479187.1|  PREDICTED: hexokinase-like 1 protein isoform X1    145   9e-37   
ref|XP_008775016.1|  PREDICTED: hexokinase-3-like isoform X1            145   1e-36   
ref|XP_009414963.1|  PREDICTED: hexokinase-3-like                       145   1e-36   
gb|AFO84085.1|  hexokinase                                              145   1e-36   
ref|XP_007211826.1|  hypothetical protein PRUPE_ppa004471mg             145   2e-36   
ref|XP_010938649.1|  PREDICTED: hexokinase-3-like                       144   2e-36   
gb|KJB83529.1|  hypothetical protein B456_013G251900                    140   2e-36   
ref|XP_001766433.1|  hexokinase protein HXK5                            144   2e-36   
ref|XP_006303965.1|  hypothetical protein CARUB_v10008846mg             144   3e-36   
ref|XP_011080375.1|  PREDICTED: hexokinase-3 isoform X1                 143   5e-36   
ref|XP_011080376.1|  PREDICTED: hexokinase-3 isoform X2                 143   5e-36   
gb|KHG14450.1|  hypothetical protein F383_08688                         143   6e-36   
ref|XP_011090147.1|  PREDICTED: hexokinase-3-like                       143   6e-36   
ref|XP_002891576.1|  hypothetical protein ARALYDRAFT_474175             143   7e-36   
gb|KJB83528.1|  hypothetical protein B456_013G251900                    141   7e-36   
ref|XP_009144955.1|  PREDICTED: hexokinase-3-like                       142   8e-36   
ref|XP_010921911.1|  PREDICTED: hexokinase-3-like isoform X2            142   8e-36   
ref|NP_175463.1|  hexokinase-like 1                                     142   9e-36   
gb|EPS64171.1|  hypothetical protein M569_10608                         142   9e-36   
ref|XP_010921910.1|  PREDICTED: hexokinase-3-like isoform X1            142   9e-36   
gb|KFK35941.1|  hypothetical protein AALP_AA4G057200                    142   1e-35   
ref|XP_007015149.1|  Hexokinase-like 1                                  142   1e-35   
gb|AHY84733.1|  hexokinase                                              142   2e-35   
ref|XP_006393517.1|  hypothetical protein EUTSA_v10011426mg             141   2e-35   
ref|XP_011032066.1|  PREDICTED: hexokinase-3 isoform X1                 141   2e-35   
ref|XP_010665884.1|  PREDICTED: hexokinase-1-like                       141   3e-35   
ref|XP_003565048.1|  PREDICTED: hexokinase-3                            141   3e-35   
gb|KJB83523.1|  hypothetical protein B456_013G251900                    141   3e-35   
gb|KJB83524.1|  hypothetical protein B456_013G251900                    141   3e-35   
ref|XP_004511503.1|  PREDICTED: hexokinase-3-like                       141   3e-35   
emb|CDY37134.1|  BnaC06g03650D                                          140   4e-35   
ref|XP_008385759.1|  PREDICTED: hexokinase-3-like                       140   5e-35   
ref|XP_010246625.1|  PREDICTED: hexokinase-3-like                       140   5e-35   
ref|XP_003610965.1|  Hexokinase                                         140   6e-35   
ref|XP_010501937.1|  PREDICTED: hexokinase-3-like                       139   8e-35   
emb|CDY29586.1|  BnaA05g15840D                                          139   9e-35   
ref|XP_008363245.1|  PREDICTED: hexokinase-3                            139   1e-34   
ref|XP_004154641.1|  PREDICTED: hexokinase-3-like                       139   1e-34   
ref|XP_004139044.1|  PREDICTED: hexokinase-3-like                       139   1e-34   
dbj|BAJ85932.1|  predicted protein                                      139   2e-34   
ref|XP_009405453.1|  PREDICTED: hexokinase-3-like                       139   2e-34   
ref|XP_002987642.1|  hypothetical protein SELMODRAFT_269299             138   2e-34   
gb|KDO50429.1|  hypothetical protein CISIN_1g0104562mg                  135   3e-34   
emb|CDY68234.1|  BnaCnng58160D                                          137   3e-34   
ref|XP_008450397.1|  PREDICTED: hexokinase-3-like                       138   3e-34   
ref|XP_006446203.1|  hypothetical protein CICLE_v10014962mg             138   3e-34   
ref|XP_002313358.2|  hexokinase family protein                          138   3e-34   
ref|NP_175220.2|  hexokinase 3                                          138   4e-34   
ref|XP_010479505.1|  PREDICTED: hexokinase-3 isoform X1                 138   4e-34   
ref|XP_002513538.1|  hexokinase, putative                               138   4e-34   
emb|CDY45062.1|  BnaA08g02130D                                          137   4e-34   
gb|AEB00839.1|  hexokinase 3                                            136   5e-34   
emb|CDY07303.1|  BnaC05g26650D                                          137   5e-34   
ref|XP_009147837.1|  PREDICTED: hexokinase-3                            137   6e-34   
emb|CDY03607.1|  BnaC03g68660D                                          137   7e-34   
ref|XP_009343799.1|  PREDICTED: hexokinase-3-like                       137   7e-34   
ref|XP_006307314.1|  hypothetical protein CARUB_v10008936mg             137   8e-34   
gb|EMT24694.1|  Hexokinase-10                                           137   8e-34   
emb|CDY22797.1|  BnaA06g02800D                                          137   8e-34   
ref|XP_009107216.1|  PREDICTED: hexokinase-3-like                       137   9e-34   
ref|XP_009366073.1|  PREDICTED: hexokinase-3                            137   1e-33   
gb|EMS67591.1|  Hexokinase-3                                            136   1e-33   
ref|XP_010461899.1|  PREDICTED: hexokinase-3-like                       136   1e-33   
gb|KHN39258.1|  Hexokinase-1                                            134   2e-33   
gb|AFG67270.1|  hypothetical protein 2_7207_01                          129   2e-33   
gb|EMT23999.1|  Hexokinase-3                                            137   2e-33   
gb|AHY84732.1|  hexokinase                                              135   3e-33   
emb|CDY20902.1|  BnaC06g01220D                                          135   3e-33   
emb|CDY06724.1|  BnaA10g05030D                                          135   3e-33   
gb|KFK39986.1|  hypothetical protein AALP_AA3G315000                    135   3e-33   
ref|XP_009337028.1|  PREDICTED: hexokinase-3-like                       135   4e-33   
ref|XP_010651825.1|  PREDICTED: hexokinase-3 isoform X2                 134   4e-33   
ref|XP_010536106.1|  PREDICTED: hexokinase-4-like                       134   5e-33   
ref|XP_009118944.1|  PREDICTED: hexokinase-like 1 protein               135   5e-33   
gb|AEW08365.1|  hypothetical protein 2_7207_01                          127   5e-33   
emb|CAN74594.1|  hypothetical protein VITISV_003476                     134   5e-33   
gb|AFG67277.1|  hypothetical protein 2_7207_01                          127   6e-33   
ref|XP_002274759.1|  PREDICTED: hexokinase-3 isoform X1                 134   6e-33   
gb|AEW08364.1|  hypothetical protein 2_7207_01                          127   7e-33   
ref|XP_006645311.1|  PREDICTED: hexokinase-3-like                       134   9e-33   
ref|XP_007131563.1|  hypothetical protein PHAVU_011G023700g             134   1e-32   
ref|XP_006470700.1|  PREDICTED: hexokinase-3-like                       134   1e-32   
emb|CDP09609.1|  unnamed protein product                                133   2e-32   
ref|NP_001045354.1|  Os01g0940100                                       132   2e-32   
gb|KHN39431.1|  Hexokinase-2, chloroplastic                             134   2e-32   
gb|KHN09247.1|  Hexokinase-3                                            132   3e-32   
ref|XP_003537744.1|  PREDICTED: hexokinase-3-like                       132   3e-32   
gb|EMT06972.1|  Hexokinase-4, chloroplastic                             132   4e-32   
dbj|BAD87613.1|  putative hexokinase                                    132   5e-32   
sp|Q2KNB4.1|HXK3_ORYSJ  RecName: Full=Hexokinase-3; AltName: Full...    132   5e-32   
gb|EAY77169.1|  hypothetical protein OsI_05139                          132   5e-32   
gb|KFK39983.1|  hypothetical protein AALP_AA3G314700                    131   7e-32   
gb|EMT07302.1|  Hexokinase-2                                            131   7e-32   
emb|CDY25373.1|  BnaA05g19110D                                          131   8e-32   
gb|KCW79125.1|  hypothetical protein EUGRSUZ_C005692                    122   2e-31   
gb|KHN05494.1|  Hexokinase-3                                            130   2e-31   
gb|EEE55981.1|  hypothetical protein OsJ_04720                          131   2e-31   
gb|KDP22128.1|  hypothetical protein JCGZ_25959                         130   3e-31   
ref|XP_003540378.1|  PREDICTED: hexokinase-3-like                       130   3e-31   
ref|XP_009145689.1|  PREDICTED: hexokinase-4                            129   5e-31   



>ref|XP_011093636.1| PREDICTED: hexokinase-1 [Sesamum indicum]
Length=496

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 161/175 (92%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGDT+PPKLKIPFILRTPDMSAMH DTS DLKVVG+KLKDILE
Sbjct  323  GEIVRRVLCRMAEEASFFGDTIPPKLKIPFILRTPDMSAMHHDTSPDLKVVGSKLKDILE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNSSLKMRK++VE+CDIVATR ARLSAAGI+GILKKLGRD+ K GE  +RSV+A+DGGL
Sbjct  383  VPNSSLKMRKIIVEICDIVATRGARLSAAGILGILKKLGRDTVKEGE-KQRSVIALDGGL  441

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR CMESTLKELLG+ +E +V+EHSNDGSGIGAALLAA+HSQYLE D S
Sbjct  442  FEHYTKFRKCMESTLKELLGDVAEDIVVEHSNDGSGIGAALLAASHSQYLEIDNS  496



>gb|KDO66585.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
 gb|KDO66586.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=284

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGDTVPPKLKIPFILRTP MSAMH DTS DL+VVG KLKDILE
Sbjct  110  GEIVRRVLCRMAEEANFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLRVVGKKLKDILE  169

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVATR ARLSAAGIVGILKKLGRD+ + GE  K SV+A+DGGL
Sbjct  170  ISNTSLKMRKLVVELCDIVATRGARLSAAGIVGILKKLGRDTVRDGEKQK-SVIALDGGL  228

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKF  CM+ST+KELLG E SE++VIEHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  229  FEHYTKFSACMQSTVKELLGEEVSETVVIEHSNDGSGIGAALLAASHSQYLEVEES  284



>gb|KDO66584.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=363

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGDTVPPKLKIPFILRTP MSAMH DTS DL+VVG KLKDILE
Sbjct  189  GEIVRRVLCRMAEEANFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLRVVGKKLKDILE  248

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVATR ARLSAAGIVGILKKLGRD+ + GE  K SV+A+DGGL
Sbjct  249  ISNTSLKMRKLVVELCDIVATRGARLSAAGIVGILKKLGRDTVRDGEKQK-SVIALDGGL  307

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKF  CM+ST+KELLG E SE++VIEHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  308  FEHYTKFSACMQSTVKELLGEEVSETVVIEHSNDGSGIGAALLAASHSQYLEVEES  363



>gb|KHN41674.1| Hexokinase-1 [Glycine soja]
Length=437

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 161/176 (91%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR L KMAEEA+ FGDTVPPKLK+PFILRTPDMSAMH DTS+DLKVVGNKLKDILE
Sbjct  263  GEIVRRALFKMAEEADFFGDTVPPKLKVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILE  322

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVATR ARL+AAGI+GILKK+GRD+ K GE  K SV+A+DGGL
Sbjct  323  ISNTSLKMRKIVVELCDIVATRGARLAAAGILGILKKIGRDTVKVGEKQK-SVIALDGGL  381

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+C+E TLKELLG EA+E++VIEH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  382  FEHYTKFRECLEGTLKELLGDEAAETIVIEHANDGSGIGAALLAASHSQYLGVEES  437



>gb|KDO66582.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=465

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGDTVPPKLKIPFILRTP MSAMH DTS DL+VVG KLKDILE
Sbjct  291  GEIVRRVLCRMAEEANFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLRVVGKKLKDILE  350

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVATR ARLSAAGIVGILKKLGRD+ + GE  K SV+A+DGGL
Sbjct  351  ISNTSLKMRKLVVELCDIVATRGARLSAAGIVGILKKLGRDTVRDGEKQK-SVIALDGGL  409

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKF  CM+ST+KELLG E SE++VIEHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  410  FEHYTKFSACMQSTVKELLGEEVSETVVIEHSNDGSGIGAALLAASHSQYLEVEES  465



>gb|AFO84084.1| hexokinase [Actinidia deliciosa]
Length=497

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 163/175 (93%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MAEEA+ FGDT+PPKLKIPFILRTPDMSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLCRMAEEADFFGDTIPPKLKIPFILRTPDMSAMHHDTSSDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK RK++VE+CDI++ R ARLSAAGI+GILKKLGRD+ +  E  +RSV+A+DGGL
Sbjct  384  IPNTSLKTRKLIVELCDIISIRGARLSAAGILGILKKLGRDTVRE-EEKQRSVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYTKFR+ MESTLKELLGEAS+++VIEHSNDGSG+GAALLAA+HSQYLE ++S
Sbjct  443  YEHYTKFREAMESTLKELLGEASDTIVIEHSNDGSGVGAALLAASHSQYLEVEDS  497



>emb|CAN83149.1| hypothetical protein VITISV_024177 [Vitis vinifera]
Length=498

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVLC+MAEEA+LFGDTVPPKLKIPFILRTPDMSAMH DTS DL+VVG+KLKDIL+
Sbjct  324  GDIVRRVLCRMAEEADLFGDTVPPKLKIPFILRTPDMSAMHHDTSPDLRVVGSKLKDILD  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK RKVV+E+CDIVATR ARLSAAGI+GILKKLGRD+ K G   + SV+A+DGGL
Sbjct  384  IPNTSLKTRKVVIELCDIVATRGARLSAAGILGILKKLGRDTMKEGGDKQNSVIALDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            +EHYT+FR C+ESTLKELLG E S+++VI+HSNDGSGIGAALLAA+HSQYLE D
Sbjct  444  YEHYTEFRTCLESTLKELLGAEVSDNIVIKHSNDGSGIGAALLAASHSQYLEED  497



>ref|XP_003525287.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 161/176 (91%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR L KMAEEA+ FGDTVPPKLK+PFILRTPDMSAMH DTS+DLKVVGNKLKDILE
Sbjct  324  GEIVRRALFKMAEEADFFGDTVPPKLKVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVATR ARL+AAGI+GILKK+GRD+ K GE  K SV+A+DGGL
Sbjct  384  ISNTSLKMRKIVVELCDIVATRGARLAAAGILGILKKIGRDTVKVGEKQK-SVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+C+E TLKELLG EA+E++VIEH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  443  FEHYTKFRECLEGTLKELLGDEAAETIVIEHANDGSGIGAALLAASHSQYLGVEES  498



>ref|XP_003530493.1| PREDICTED: hexokinase-1-like [Glycine max]
 gb|KHN16646.1| Hexokinase-1 [Glycine soja]
Length=498

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 161/176 (91%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRR L KMAEEA+ FGDTVPPKLK+PFILRTPDMSAMH DTS+DLKVVGNKLKDILE
Sbjct  324  GEVVRRALLKMAEEADFFGDTVPPKLKVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVATR ARL+AAGI+GILKK+GRD+ K GE  K SV+A+DGGL
Sbjct  384  ISNTSLKMRKIVVELCDIVATRGARLAAAGILGILKKIGRDTVKVGEKQK-SVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+C+ES LKELLG EA+E++VIEH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  443  FEHYTKFRECLESALKELLGDEAAETIVIEHANDGSGIGAALLAASHSQYLGVEES  498



>ref|XP_007160283.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
 gb|ESW32277.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
Length=498

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR L KMAEEA+ FGDTVPPKLK+PFILRTPDMSAMH DT++DLKVVGNKLKDILE
Sbjct  324  GEIVRRALLKMAEEADFFGDTVPPKLKVPFILRTPDMSAMHHDTTSDLKVVGNKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VV +CDIVATR ARL+AAGI+GILKKLGRD+ K GE  K SV+A+DGGL
Sbjct  384  ISNTSLKMRKIVVALCDIVATRGARLAAAGILGILKKLGRDTVKVGEKQK-SVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR+C+ESTLKELLG EA+E++VIEH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  443  FEHYAKFRECLESTLKELLGEEAAETIVIEHANDGSGIGAALLAASHSQYLGVEES  498



>emb|CBI27996.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 161/174 (93%), Gaps = 2/174 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVLC+MAEEA+LFGDTVPPKLKIPFILRTPDMSAMH DTS DL+VVG+KLKDIL+
Sbjct  263  GDIVRRVLCRMAEEADLFGDTVPPKLKIPFILRTPDMSAMHHDTSPDLRVVGSKLKDILD  322

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK RKVV+E+CDIVATR ARLSAAGI+GILKKLGRD+ K G+  + SV+A+DGGL
Sbjct  323  IPNTSLKTRKVVIELCDIVATRGARLSAAGILGILKKLGRDTMKEGD-KQNSVIALDGGL  381

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            +EHYT+FR C+ESTLKELLG E S+++VI+HSNDGSGIGAALLAA+HSQYLE D
Sbjct  382  YEHYTEFRTCLESTLKELLGAEVSDNIVIKHSNDGSGIGAALLAASHSQYLEED  435



>ref|NP_001275786.1| hexokinase [Citrus sinensis]
 ref|XP_006451310.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|AAG28503.1|AF196966_1 hexokinase [Citrus sinensis]
 gb|ESR64550.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66583.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=498

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGDTVPPKLKIPFILRTP MSAMH DTS DL+VVG KLKDILE
Sbjct  324  GEIVRRVLCRMAEEANFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLRVVGKKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVATR ARLSAAGIVGILKKLGRD+ + GE  K SV+A+DGGL
Sbjct  384  ISNTSLKMRKLVVELCDIVATRGARLSAAGIVGILKKLGRDTVRDGEKQK-SVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKF  CM+ST+KELLG E SE++VIEHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  443  FEHYTKFSACMQSTVKELLGEEVSETVVIEHSNDGSGIGAALLAASHSQYLEVEES  498



>gb|AEJ95926.1| HXK1 [Vitis vinifera]
Length=470

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 161/174 (93%), Gaps = 2/174 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVLC+MAEEA+LFGDTVPPKLKIPFILRTPDMSAMH DTS DL+VVG+KLKDIL+
Sbjct  297  GDIVRRVLCRMAEEADLFGDTVPPKLKIPFILRTPDMSAMHHDTSPDLRVVGSKLKDILD  356

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK RKVV+E+CDIVATR ARLSAAGI+GILKKLGRD+ K G+  + SV+A+DGGL
Sbjct  357  IPNTSLKTRKVVIELCDIVATRGARLSAAGILGILKKLGRDTMKEGD-KQNSVIALDGGL  415

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            +EHYT+FR C+ESTLKELLG E S+++VI+HSNDGSGIGAALLAA+HSQYLE D
Sbjct  416  YEHYTEFRTCLESTLKELLGAEVSDNIVIKHSNDGSGIGAALLAASHSQYLEED  469



>ref|XP_002283608.1| PREDICTED: hexokinase-1-like [Vitis vinifera]
Length=497

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 161/174 (93%), Gaps = 2/174 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVLC+MAEEA+LFGDTVPPKLKIPFILRTPDMSAMH DTS DL+VVG+KLKDIL+
Sbjct  324  GDIVRRVLCRMAEEADLFGDTVPPKLKIPFILRTPDMSAMHHDTSPDLRVVGSKLKDILD  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK RKVV+E+CDIVATR ARLSAAGI+GILKKLGRD+ K G+  + SV+A+DGGL
Sbjct  384  IPNTSLKTRKVVIELCDIVATRGARLSAAGILGILKKLGRDTMKEGD-KQNSVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            +EHYT+FR C+ESTLKELLG E S+++VI+HSNDGSGIGAALLAA+HSQYLE D
Sbjct  443  YEHYTEFRTCLESTLKELLGAEVSDNIVIKHSNDGSGIGAALLAASHSQYLEED  496



>gb|KDP33801.1| hypothetical protein JCGZ_07372 [Jatropha curcas]
Length=498

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MAEEA  FGD VP KLKIPFILRTPDMSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEIVRRVLVEMAEEAAFFGDVVPSKLKIPFILRTPDMSAMHHDTSSDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLKMRKV+VE+C IVA+R ARLSAAGI G+LKKLGRD+ K GE  +RSV+A+DGGL
Sbjct  384  IPNTSLKMRKVIVELCGIVASRGARLSAAGIAGVLKKLGRDTVKDGE-KQRSVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR CMESTLKELLG E SES+VIEHSNDGSGIGAALLAA+HSQYL+  ES
Sbjct  443  FEHYTKFRVCMESTLKELLGEEVSESIVIEHSNDGSGIGAALLAASHSQYLDVAES  498



>ref|XP_007013022.1| Hexokinase 2 isoform 3 [Theobroma cacao]
 gb|EOY30641.1| Hexokinase 2 isoform 3 [Theobroma cacao]
Length=437

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEAE FGDTVPPKLKIPFILRTP MSAMH DTS DLKVV  KLKDILE
Sbjct  263  GEIVRRVLYKMAEEAEFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLKVVATKLKDILE  322

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+CDIVATR ARLSAAGIVGILKKLGRD  K GE  K SVVA+DGGL
Sbjct  323  ISNTSLKMRKVIVELCDIVATRGARLSAAGIVGILKKLGRDIVKDGEKLK-SVVALDGGL  381

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYTKFR CME+TL ELLG E S+++VIEHSNDGSGIGA LLAA HSQY+E +ES
Sbjct  382  YEHYTKFRTCMENTLTELLGDEVSDNIVIEHSNDGSGIGATLLAACHSQYIEVEES  437



>gb|AAS60195.1| hexokinase 4a [Nicotiana tabacum]
Length=498

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MAEEA  F D VPPKLK PFILRTPDMSAMH D SADLKVVG+KLKDILE
Sbjct  325  GEILRRVLCRMAEEASFFDDYVPPKLKTPFILRTPDMSAMHHDKSADLKVVGDKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNS+ KMRK++VE+CDI+ +R ARLSAAGIVGILKKLGRD+ K GE  +RSV+AVDG L
Sbjct  385  VPNSTWKMRKIIVELCDIITSRGARLSAAGIVGILKKLGRDTLKDGE-KQRSVIAVDGAL  443

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+CME T+KELLG+A+ES+VIE SNDGSGIGAALLAA+HSQYL  +ES
Sbjct  444  FEHYTKFRNCMEGTIKELLGDAAESIVIELSNDGSGIGAALLAASHSQYLGLEES  498



>gb|KEH21332.1| hexokinase [Medicago truncatula]
Length=363

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR L KMAEEAE FGDTVPPKLKIPFILRTPDMS+MH DT+ DLK VG+KL+DILE
Sbjct  189  GEIVRRALLKMAEEAEFFGDTVPPKLKIPFILRTPDMSSMHHDTTPDLKEVGSKLRDILE  248

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVA+R ARL+AAGI+GILKKLGRD+ K GE  K SV+A+DGGL
Sbjct  249  ISNTSLKMRKIVVELCDIVASRGARLAAAGILGILKKLGRDTVKGGEKQK-SVIALDGGL  307

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR C+E TLKELLG EA+E++V+EH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  308  FEHYTKFRVCLEDTLKELLGDEAAETVVVEHANDGSGIGAALLAASHSQYLGVEES  363



>gb|AFO84083.1| hexokinase [Actinidia chinensis]
Length=497

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA LFGDTVPPKLKIPFILRTP MSAMH DTS+DL+VV  KLKDILE
Sbjct  324  GEIVRRVLCRMAEEAALFGDTVPPKLKIPFILRTPHMSAMHHDTSSDLRVVETKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK +VE+CDIVA R ARLSAAGI+GILKKLGRD+   GE N RSV+A+DGGL
Sbjct  384  ISNTSLKTRKAIVELCDIVAIRGARLSAAGILGILKKLGRDTVTEGE-NMRSVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR+ MESTLKELLG+ASE++VIEHSNDGSGIGAALLAA+HS YLE +ES
Sbjct  443  FEHYMKFRNSMESTLKELLGKASETIVIEHSNDGSGIGAALLAASHSLYLEVEES  497



>ref|XP_009601881.1| PREDICTED: hexokinase-2-like [Nicotiana tomentosiformis]
Length=498

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MAEEA  F D VPPKLK PFILRTPDMSAMH D SADLKVVG+KLKDILE
Sbjct  325  GEILRRVLCRMAEEASFFDDYVPPKLKTPFILRTPDMSAMHHDKSADLKVVGDKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNS+ KMRK++VE+CDI+ +R ARLSAAGIVGILKKLGRD+ K GE  +RSV+AVDG L
Sbjct  385  VPNSTWKMRKIIVELCDIITSRGARLSAAGIVGILKKLGRDTLKDGE-KQRSVIAVDGAL  443

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+CME T+KELLG+A+ES+VIE SNDGSG+GAALLAA+HSQYL  +ES
Sbjct  444  FEHYTKFRNCMEGTIKELLGDAAESIVIELSNDGSGVGAALLAASHSQYLGLEES  498



>ref|NP_001234710.1| hexokinase [Solanum lycopersicum]
 gb|AAY60841.1| hexokinase [Solanum lycopersicum]
Length=499

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 159/175 (91%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MAEEA LFGD VP KLK+PF+LRTPDM+AMH D SADLKVVGNKLKDILE
Sbjct  326  GEILRRVLCRMAEEASLFGDYVPSKLKVPFVLRTPDMAAMHHDESADLKVVGNKLKDILE  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNS+LKMRK+VVE+CDI+ +R ARLSAAGIVGILKKLGRD++K GE  +RSV+AVDG L
Sbjct  386  VPNSTLKMRKIVVELCDIITSRGARLSAAGIVGILKKLGRDTFKDGE-KQRSVIAVDGAL  444

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+C++ T+KELLG+A++S VIE SNDGSG+GAALLAA+HSQY + +ES
Sbjct  445  FEHYTKFRNCLKETMKELLGDAADSTVIELSNDGSGVGAALLAASHSQYTDLEES  499



>ref|XP_007013021.1| Hexokinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30640.1| Hexokinase 1 isoform 2 [Theobroma cacao]
Length=498

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEAE FGDTVPPKLKIPFILRTP MSAMH DTS DLKVV  KLKDILE
Sbjct  324  GEIVRRVLYKMAEEAEFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLKVVATKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+CDIVATR ARLSAAGIVGILKKLGRD  K GE  K SVVA+DGGL
Sbjct  384  ISNTSLKMRKVIVELCDIVATRGARLSAAGIVGILKKLGRDIVKDGEKLK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYTKFR CME+TL ELLG E S+++VIEHSNDGSGIGA LLAA HSQY+E +ES
Sbjct  443  YEHYTKFRTCMENTLTELLGDEVSDNIVIEHSNDGSGIGATLLAACHSQYIEVEES  498



>ref|XP_010049611.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
 gb|KCW82325.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=500

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRRVL KMAEEA  FGD VPPKL+I FILRTPDMSAMH DTS+DLKVVGNKL+DILE
Sbjct  325  GEVVRRVLLKMAEEASFFGDNVPPKLRISFILRTPDMSAMHHDTSSDLKVVGNKLRDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N++LKMRKVVVE+CDIVATR ARLSAAGIVGILKKLGRDS K G   ++SV+A+DGGL
Sbjct  385  ISNTTLKMRKVVVELCDIVATRGARLSAAGIVGILKKLGRDSAKEGAEQQKSVIALDGGL  444

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHY KF  CMESTLKEL+G E ++++VIEHSNDGSGIGAALLAA+HS+YL A+E
Sbjct  445  FEHYKKFSACMESTLKELIGEEVAQNIVIEHSNDGSGIGAALLAASHSEYLMAEE  499



>ref|XP_008387424.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=216

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC++AEEA LFGDTVPPKLK+PFILRTPDMSAMH D S+DL+VV  KLK++LE
Sbjct  42   GEIVRRVLCRIAEEASLFGDTVPPKLKVPFILRTPDMSAMHHDASSDLRVVREKLKNVLE  101

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RKV+VE+C+IVATR ARL+AAG++G+LKKLGRD+ K GE N+++VVA+DGGL
Sbjct  102  ISNTSLKVRKVIVELCNIVATRGARLAAAGVLGVLKKLGRDAVKDGE-NQKTVVALDGGL  160

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT++  CME+TL+ELLG E +E++VIEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  161  YEHYTEYSKCMENTLRELLGEEVAETIVIEHSNDGSGIGAALLAASHSQYLGIDES  216



>ref|XP_007215785.1| hypothetical protein PRUPE_ppa009797mg [Prunus persica]
 gb|EMJ16984.1| hypothetical protein PRUPE_ppa009797mg [Prunus persica]
Length=277

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLCK+AEEA LFGDTVPPKLK+PFILRTPDMSAMH DTS+DLKVV + LK++LE
Sbjct  103  GEIVRRVLCKIAEEASLFGDTVPPKLKVPFILRTPDMSAMHHDTSSDLKVVRDILKNVLE  162

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RK+VVE+C+IVATR ARL+AAGIVG+LKK+G+D++K GE  +R+VVA+DGGL
Sbjct  163  ISNTSLKVRKIVVELCNIVATRGARLAAAGIVGVLKKVGKDAFKDGE-KQRTVVALDGGL  221

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY ++  CME+TL+ELLG E SES+VIEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  222  YEHYNEYSKCMENTLRELLGEEVSESIVIEHSNDGSGIGAALLAASHSQYLGVDES  277



>ref|XP_007013020.1| Hexokinase 1 isoform 1 [Theobroma cacao]
 gb|EOY30639.1| Hexokinase 1 isoform 1 [Theobroma cacao]
Length=521

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEAE FGDTVPPKLKIPFILRTP MSAMH DTS DLKVV  KLKDILE
Sbjct  347  GEIVRRVLYKMAEEAEFFGDTVPPKLKIPFILRTPHMSAMHHDTSPDLKVVATKLKDILE  406

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+CDIVATR ARLSAAGIVGILKKLGRD  K GE  K SVVA+DGGL
Sbjct  407  ISNTSLKMRKVIVELCDIVATRGARLSAAGIVGILKKLGRDIVKDGEKLK-SVVALDGGL  465

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYTKFR CME+TL ELLG E S+++VIEHSNDGSGIGA LLAA HSQY+E +ES
Sbjct  466  YEHYTKFRTCMENTLTELLGDEVSDNIVIEHSNDGSGIGATLLAACHSQYIEVEES  521



>gb|KJB65034.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65035.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65036.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
Length=498

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLCKMAEEA +FGDTVPPKLKIPFILRTP+ SAMH DTS DLKVV  KLKDILE
Sbjct  324  GEIVRRVLCKMAEEAAIFGDTVPPKLKIPFILRTPNTSAMHHDTSPDLKVVATKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RK++VEVCDIVATR ARLSAAGIVGILKKLGRD+ K GE  K SVVA+DGGL
Sbjct  384  ISNTSLKLRKLIVEVCDIVATRGARLSAAGIVGILKKLGRDTVKDGEKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYTKFR CME+TL ELLG EASE++ +EHS DGSGIGAALLAA+HSQY+E +E
Sbjct  443  YEHYTKFRTCMENTLWELLGEEASENIAVEHSMDGSGIGAALLAASHSQYIEVEE  497



>ref|XP_004503491.1| PREDICTED: hexokinase-1-like isoform X2 [Cicer arietinum]
Length=498

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEAE FGDTVPPKLKIPFILRTPDMS++H DTS DLKVVGNKL+DILE
Sbjct  324  GEIVRRVLLKMAEEAEFFGDTVPPKLKIPFILRTPDMSSIHHDTSPDLKVVGNKLRDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VVE+CDIVATR ARL+AAGI+GILKK+GRD+ KAGE  K SV+A+DGGL
Sbjct  384  ISNTSLKTRKIVVELCDIVATRGARLAAAGILGILKKIGRDTVKAGEKQK-SVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR C+E TLKELLG EA++++V++H+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  443  FEHYTKFRVCLEETLKELLGDEAADTVVVKHANDGSGIGAALLAASHSQYLGVEES  498



>ref|XP_006353497.1| PREDICTED: hexokinase-1-like isoform X2 [Solanum tuberosum]
Length=466

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 158/175 (90%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MA+EA LFGD VP KLKIPFILRTPDM+AMH D SADLKVVGNKLKDILE
Sbjct  293  GEILRRVLCRMAKEASLFGDYVPSKLKIPFILRTPDMAAMHHDESADLKVVGNKLKDILE  352

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNS+LKMRK+VVE+CDI+ +R ARLSAAGIVGILKKLG+D+ K GE N+RSV+AVDG L
Sbjct  353  VPNSTLKMRKIVVELCDIITSRGARLSAAGIVGILKKLGKDTLKDGE-NQRSVIAVDGAL  411

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FE YTKFR+C+E T+KELLG+ ++S+VIE SNDGSG+GAALLAA+HSQY + +ES
Sbjct  412  FERYTKFRNCLEETMKELLGDTADSIVIELSNDGSGVGAALLAASHSQYTDLEES  466



>ref|XP_004503490.1| PREDICTED: hexokinase-1-like isoform X1 [Cicer arietinum]
Length=526

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEAE FGDTVPPKLKIPFILRTPDMS++H DTS DLKVVGNKL+DILE
Sbjct  352  GEIVRRVLLKMAEEAEFFGDTVPPKLKIPFILRTPDMSSIHHDTSPDLKVVGNKLRDILE  411

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VVE+CDIVATR ARL+AAGI+GILKK+GRD+ KAGE  K SV+A+DGGL
Sbjct  412  ISNTSLKTRKIVVELCDIVATRGARLAAAGILGILKKIGRDTVKAGEKQK-SVIALDGGL  470

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR C+E TLKELLG EA++++V++H+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  471  FEHYTKFRVCLEETLKELLGDEAADTVVVKHANDGSGIGAALLAASHSQYLGVEES  526



>emb|CDP03250.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGD VPPKL IPFILRTP+MSA+H DTS DLKVVG KLKDILE
Sbjct  324  GEIVRRVLCRMAEEAAFFGDAVPPKLNIPFILRTPEMSAIHHDTSCDLKVVGAKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPNSSLK+RKV+VE+CDIV +R ARLSAAG++GILKKLGRD+   GE  K SVVA+DGGL
Sbjct  384  IPNSSLKVRKVIVEICDIVVSRGARLSAAGVLGILKKLGRDTITDGEKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR+CM+STL+ELLG+A E++ I HSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  443  FEHYAKFRNCMDSTLQELLGDAYENVSIIHSNDGSGIGAALLAASHSQYLEVEES  497



>ref|XP_008242483.1| PREDICTED: hexokinase-1 [Prunus mume]
Length=498

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVLCKMAEEA  FGD VPPKLK+PFILRTPDMSAMH DTS DL+VVG+KLKDILE
Sbjct  324  GDIVRRVLCKMAEEASFFGDVVPPKLKVPFILRTPDMSAMHHDTSPDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKVVV +CDIVATR ARLSAAGI+G+LKKLGRD+ K GE  K SVVA+DGGL
Sbjct  384  ISNTSLKMRKVVVALCDIVATRGARLSAAGIMGVLKKLGRDTVKEGEKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT+FR  MESTLKELLG E +E + +EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  443  YEHYTEFRTSMESTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_006353496.1| PREDICTED: hexokinase-1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 158/175 (90%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MA+EA LFGD VP KLKIPFILRTPDM+AMH D SADLKVVGNKLKDILE
Sbjct  326  GEILRRVLCRMAKEASLFGDYVPSKLKIPFILRTPDMAAMHHDESADLKVVGNKLKDILE  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNS+LKMRK+VVE+CDI+ +R ARLSAAGIVGILKKLG+D+ K GE N+RSV+AVDG L
Sbjct  386  VPNSTLKMRKIVVELCDIITSRGARLSAAGIVGILKKLGKDTLKDGE-NQRSVIAVDGAL  444

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FE YTKFR+C+E T+KELLG+ ++S+VIE SNDGSG+GAALLAA+HSQY + +ES
Sbjct  445  FERYTKFRNCLEETMKELLGDTADSIVIELSNDGSGVGAALLAASHSQYTDLEES  499



>ref|XP_007203872.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
 gb|EMJ05071.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
Length=498

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVLCKMAEEA  FGD VPPKLK+PFILRTPDMSAMH DTS DL+VVG+KLKDILE
Sbjct  324  GDIVRRVLCKMAEEASFFGDVVPPKLKVPFILRTPDMSAMHHDTSPDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKVVV +CDIVATR ARLSAAGI+G+LKKLGRD+ K GE  K SVVA+DGGL
Sbjct  384  ISNTSLKMRKVVVALCDIVATRGARLSAAGIMGVLKKLGRDTVKEGEKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT+FR  MESTLKELLG E +E + +EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  443  YEHYTEFRTSMESTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_010688341.1| PREDICTED: hexokinase-1 [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLCKMAEEA  FGDTVPPKLK PFILRTPDMSAMH DTS DLKVV +KLKD+L 
Sbjct  324  GEIVRRVLCKMAEEASFFGDTVPPKLKTPFILRTPDMSAMHHDTSPDLKVVASKLKDVLG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK+RKV+V++CDI+A+R A LSAAGI+GI+KKLG+D+ K GE N++SV+A+DGGL
Sbjct  384  IPNTSLKVRKVIVDICDIIASRGACLSAAGILGIIKKLGKDALKQGE-NQKSVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR+CME +LKELLG E ++++V+EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  443  FEHYAKFRECMEDSLKELLGDEIADTIVVEHSNDGSGIGAALLAASHSQYLEEEES  498



>gb|AET05183.2| hexokinase [Medicago truncatula]
Length=498

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR L KMAEEAE FGDTVPPKLKIPFILRTPDMS+MH DT+ DLK VG+KL+DILE
Sbjct  324  GEIVRRALLKMAEEAEFFGDTVPPKLKIPFILRTPDMSSMHHDTTPDLKEVGSKLRDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVA+R ARL+AAGI+GILKKLGRD+ K GE  K SV+A+DGGL
Sbjct  384  ISNTSLKMRKIVVELCDIVASRGARLAAAGILGILKKLGRDTVKGGEKQK-SVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR C+E TLKELLG EA+E++V+EH+NDGSGIGAALLAA+HSQYL  +ES
Sbjct  443  FEHYTKFRVCLEDTLKELLGDEAAETVVVEHANDGSGIGAALLAASHSQYLGVEES  498



>gb|AIB55755.1| hexokinase, partial (chloroplast), partial (chloroplast) [Brassica 
rapa]
Length=203

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMA+EA  FGD+VPPKL+IPFI+RTPDMSAMH DTS DLKVVG+KLKDILE
Sbjct  27   GEILRRVLLKMADEAAFFGDSVPPKLRIPFIIRTPDMSAMHSDTSPDLKVVGSKLKDILE  86

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVVV +CDI+A+R ARLSAAGI GILKKLGRD+ K GE+ K SV+A+DGGL
Sbjct  87   VPTTSLKMRKVVVSLCDIIASRGARLSAAGIYGILKKLGRDTPKDGETQK-SVIAMDGGL  145

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYL+
Sbjct  146  FEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLD  197



>gb|KHN40378.1| Hexokinase-1 [Glycine soja]
Length=482

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 4/176 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K+AEE + FGDTVPPKL+IPF+LRTPDMSA+H+DTS+DLKVVGNKLKDILE
Sbjct  310  GEIVRRVLLKLAEEVDFFGDTVPPKLRIPFVLRTPDMSAIHQDTSSDLKVVGNKLKDILE  369

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVA R ARLSAAGI GILKK+GRD+ K G   K+SVVA+DGGL
Sbjct  370  INNTSLKMRKIVVELCDIVANRGARLSAAGIFGILKKIGRDTVKDG---KKSVVALDGGL  426

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR  +ESTLKELLG EA+E++ IE SNDGSGIGAALLAA+HSQYLE  ES
Sbjct  427  FEHYTKFRSSLESTLKELLGDEAAETIGIEQSNDGSGIGAALLAASHSQYLEVQES  482



>gb|AHB32106.1| hexokinase [Camellia sinensis]
Length=495

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+R VLCKMAEEA  FGDTVPPKLK+PFILRTP MSAMH DTS+DL+VVG+KLKD+LE
Sbjct  324  GEILRVVLCKMAEEAAFFGDTVPPKLKVPFILRTPHMSAMHHDTSSDLRVVGSKLKDVLE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RKVVVE+CDI++ R ARL+AAGI+GILKKLGRD+ + GE  +RSV+A+DGGL
Sbjct  384  ISNTSLKTRKVVVELCDIISFRGARLAAAGILGILKKLGRDTLREGE-KQRSVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYTKFR+ ME TLKELLGEAS ++VIEHSNDGSGIGAALLAA+HSQYLE
Sbjct  443  YEHYTKFRNAMEGTLKELLGEASGTIVIEHSNDGSGIGAALLAASHSQYLE  493



>gb|AHD25654.1| hexokinase 1 (chloroplast) [Camellia sinensis]
Length=495

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+R VLCKMAEEA  FGDTVPPKLK+PFILRTP MSAMH DTS+DL+VVG+KLKD+LE
Sbjct  324  GEILRVVLCKMAEEAAFFGDTVPPKLKVPFILRTPHMSAMHHDTSSDLRVVGSKLKDVLE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RKVVVE+CDI++ R ARL+AAGI+GILKKLGRD+ + GE  +RSV+A+DGGL
Sbjct  384  ISNTSLKTRKVVVELCDIISFRGARLAAAGILGILKKLGRDTLREGE-KQRSVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYTKFR+ ME TLKELLGEAS ++VIEHSNDGSGIGAALLAA+HSQYLE
Sbjct  443  YEHYTKFRNAMEGTLKELLGEASGTIVIEHSNDGSGIGAALLAASHSQYLE  493



>ref|XP_003516735.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 4/176 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K+AEE + FGDTVPPKL+IPF+LRTPDMSA+H+DTS+DLKVVGNKLKDILE
Sbjct  324  GEIVRRVLLKLAEEVDFFGDTVPPKLRIPFVLRTPDMSAIHQDTSSDLKVVGNKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVA R ARLSAAGI GILKK+GRD+ K G   K+SVVA+DGGL
Sbjct  384  INNTSLKMRKIVVELCDIVANRGARLSAAGIFGILKKIGRDTVKDG---KKSVVALDGGL  440

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR  +ESTLKELLG EA+E++ IE SNDGSGIGAALLAA+HSQYLE  ES
Sbjct  441  FEHYTKFRSSLESTLKELLGDEAAETIGIEQSNDGSGIGAALLAASHSQYLEVQES  496



>gb|AHG98487.1| hexokinase [Dimocarpus longan]
Length=496

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRRVL +MAEEA  FGD VPPKLKIP+ILRTPDMSAMH D S+DLKVVGNKLKDILE
Sbjct  324  GEVVRRVLYRMAEEASFFGDAVPPKLKIPYILRTPDMSAMHHDMSSDLKVVGNKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+CDIVATR ARLSAAGIVGILKKLGRD+ + GE  K +V+A+DGGL
Sbjct  384  ISNTSLKMRKVIVEICDIVATRGARLSAAGIVGILKKLGRDTVRDGEKQK-TVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHY KF  CMESTLKELLG E +E++VIE SNDGSGIGAALLAA+HSQYLE
Sbjct  443  FEHYKKFSSCMESTLKELLGEEVAENIVIELSNDGSGIGAALLAASHSQYLE  494



>gb|AAS60197.1| hexokinase 5 [Nicotiana tabacum]
Length=499

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MA+EA LFGD VP KLKIPFILRTPDM+AMH D SADLKVVGNKLKDILE
Sbjct  326  GEILRRVLCRMAKEASLFGDYVPSKLKIPFILRTPDMAAMHHDESADLKVVGNKLKDILE  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNS+LKMRK+VVE+CDI+ +R ARLSAAGIVGILKKLG+D+ K GE N+RSV+AVDG L
Sbjct  386  VPNSTLKMRKIVVELCDIITSRGARLSAAGIVGILKKLGKDTLKDGE-NQRSVIAVDGAL  444

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FE YTKFR+C+E T+KELLG+ ++S+VIE SNDGSG+GAALLAA+ SQY + +ES
Sbjct  445  FERYTKFRNCLEETMKELLGDTADSIVIELSNDGSGVGAALLAASPSQYTDLEES  499



>ref|XP_009795017.1| PREDICTED: hexokinase-2-like [Nicotiana sylvestris]
Length=498

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MAEEA  F D VPPKLK PFILRT DMSAMH D SADLKVVG+KLKDILE
Sbjct  325  GEILRRVLCRMAEEASFFDDYVPPKLKTPFILRTQDMSAMHHDKSADLKVVGDKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNS+ KMRK++VE+CDI+ +R ARLSAAGIVGILKKLGRD+ K GE  +RSV+AVDG L
Sbjct  385  VPNSTWKMRKIIVELCDIITSRGARLSAAGIVGILKKLGRDTLKDGE-KQRSVIAVDGAL  443

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+CME T+KELLG+A+E++V++ SNDGSG+GAALLAA+HSQYL  +ES
Sbjct  444  FEHYTKFRNCMEGTIKELLGDAAENIVVKLSNDGSGVGAALLAASHSQYLGLEES  498



>gb|KHG25517.1| Hexokinase-1 -like protein [Gossypium arboreum]
Length=498

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLCKMAEEA +FGD VPPKLKIPFILRTP  SAMH DTS DLKVV  KLKDILE
Sbjct  324  GEIVRRVLCKMAEEAAIFGDAVPPKLKIPFILRTPHTSAMHHDTSPDLKVVATKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RK++VEVCDIVATR ARLSAAGI GILKKLGRD+ K GE  K S VA+DGGL
Sbjct  384  ISNTSLKLRKLIVEVCDIVATRGARLSAAGIAGILKKLGRDTVKVGEKQK-SAVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYTKFR CME+TL ELLG EASE++ +EHS DGSGIGAALLAA+HSQY+E +E
Sbjct  443  YEHYTKFRTCMENTLWELLGEEASENIAVEHSMDGSGIGAALLAASHSQYIEVEE  497



>sp|Q9SEK3.1|HXK1_SPIOL RecName: Full=Hexokinase-1; AltName: Full=SoHxK1 [Spinacia oleracea]
 gb|AAF18584.1|AF118132_1 chloroplast outer envelope hexokinase 1 [Spinacia oleracea]
Length=498

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MA+EA LFGDTVP KLK PFILRTPDMSAMH DTS DLKVV +KLKD+L 
Sbjct  324  GEIVRRVLYRMADEASLFGDTVPSKLKTPFILRTPDMSAMHHDTSPDLKVVASKLKDVLG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPNSSLK+RK++V+VCD++A+R A +SAAGI+GI+KKLGRD+ K GE N++SV+A+DGGL
Sbjct  384  IPNSSLKVRKIIVDVCDVIASRGACISAAGILGIIKKLGRDTLKQGE-NQKSVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR+CME +LKELLG E +E++VIEHSNDGSGIGAALLAA+HSQYLE DES
Sbjct  443  FEHYAKFRECMEDSLKELLGDEVAETIVIEHSNDGSGIGAALLAASHSQYLEEDES  498



>gb|KJB83117.1| hypothetical protein B456_013G230400 [Gossypium raimondii]
Length=498

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRRVL KMA+EA  FGDT+P KLKIPFILRTP MSAMH+DTS DLK+V  KLKDILE
Sbjct  324  GEVVRRVLYKMADEAAFFGDTIPEKLKIPFILRTPHMSAMHQDTSPDLKIVATKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+CDIVATR ARLSAAGI GILKK+GRD+ K GE  K SVV++DGGL
Sbjct  384  ISNTSLKMRKVIVELCDIVATRGARLSAAGIAGILKKIGRDTLKDGEKQK-SVVSLDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYTKFR CME+TL ELLG E SE+++IEHSNDGSGIGAALLAA+HSQY+  DES
Sbjct  443  YEHYTKFRTCMENTLTELLGEEVSENIIIEHSNDGSGIGAALLAASHSQYIGIDES  498



>ref|XP_011014418.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA  FGD VPPKLKIPFILRTP MSAMH D S+DL+VVG+KLKDILE
Sbjct  324  GEIVRRVLLKMAEEAAFFGDIVPPKLKIPFILRTPHMSAMHHDESSDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IP++SLKMRK +VE+CDIVATR ARLSAAGIVGI+KKLGRD+ K GE  K SV+A+DGGL
Sbjct  384  IPHTSLKMRKAIVELCDIVATRGARLSAAGIVGIIKKLGRDTVKDGEKQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY+KF  CMESTLKELLG E S+++V+E SNDGSGIGAALLAA+HSQYL+ +ES
Sbjct  443  YEHYSKFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIGAALLAASHSQYLDVEES  498



>ref|XP_011008120.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA  FGD VPPKLKIPFILRTP MSAMH D S+DL+VVG+KLKDILE
Sbjct  324  GEIVRRVLLKMAEEAAFFGDIVPPKLKIPFILRTPHMSAMHHDESSDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IP++SLKMRK +VE+CDIVATR ARLSAAGIVGI+KKLGRD+ K GE  K SV+A+DGGL
Sbjct  384  IPHTSLKMRKAIVELCDIVATRGARLSAAGIVGIIKKLGRDTVKDGEKQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY+KF  CMESTLKELLG E S+++V+E SNDGSGIGAALLAA+HSQYL+ +ES
Sbjct  443  YEHYSKFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIGAALLAASHSQYLDVEES  498



>ref|XP_008458873.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458879.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458886.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458893.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458902.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458909.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458916.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458922.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458929.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458934.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458936.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458939.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
Length=498

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR+VL KMAEEA +FG+TVPPKLKIPFILRTP MSAMH DTS DLKVV NKLKD+LE
Sbjct  324  GEIVRKVLVKMAEEATIFGETVPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK++VE+CD+VATR ARLSAAGI+GILKKLGRD+ + GE  K SVVA+DGGL
Sbjct  384  ISNTSLKTRKIIVELCDVVATRGARLSAAGILGILKKLGRDTIRVGEKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYTKFR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE DE
Sbjct  443  YEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDE  497



>ref|XP_003630707.1| Hexokinase [Medicago truncatula]
Length=610

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 155/171 (91%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR L KMAEEAE FGDTVPPKLKIPFILRTPDMS+MH DT+ DLK VG+KL+DILE
Sbjct  324  GEIVRRALLKMAEEAEFFGDTVPPKLKIPFILRTPDMSSMHHDTTPDLKEVGSKLRDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VVE+CDIVA+R ARL+AAGI+GILKKLGRD+ K GE  K SV+A+DGGL
Sbjct  384  ISNTSLKMRKIVVELCDIVASRGARLAAAGILGILKKLGRDTVKGGEKQK-SVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            FEHYTKFR C+E TLKELLG EA+E++V+EH+NDGSGIGAALLAA+HSQYL
Sbjct  443  FEHYTKFRVCLEDTLKELLGDEAAETVVVEHANDGSGIGAALLAASHSQYL  493



>ref|XP_010249484.1| PREDICTED: hexokinase-1 [Nelumbo nucifera]
Length=498

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL  MAEEA  FGDTVPP+LK+PFILRTPDMSAMH DTS DLKVVGNKLKDIL 
Sbjct  324  GDIVRRVLLSMAEEAAFFGDTVPPQLKVPFILRTPDMSAMHHDTSPDLKVVGNKLKDILG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK RK VVE+C+IVATR ARLSAAGI+GILKKLGRD  K GE  +R+V+A+DGGL
Sbjct  384  IPNTSLKTRKAVVELCNIVATRGARLSAAGILGILKKLGRDVVKEGE-KQRTVLAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT+FR C+ESTLKELLG E S ++ +EHSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  443  YEHYTEFRVCLESTLKELLGEEVSANVSVEHSNDGSGIGAALLAASHSQYLEVEDS  498



>ref|XP_008458856.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
 ref|XP_008458864.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
Length=502

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR+VL KMAEEA +FG+TVPPKLKIPFILRTP MSAMH DTS DLKVV NKLKD+LE
Sbjct  328  GEIVRKVLVKMAEEATIFGETVPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLE  387

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK++VE+CD+VATR ARLSAAGI+GILKKLGRD+ + GE  K SVVA+DGGL
Sbjct  388  ISNTSLKTRKIIVELCDVVATRGARLSAAGILGILKKLGRDTIRVGEKQK-SVVALDGGL  446

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYTKFR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE DE
Sbjct  447  YEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDE  501



>ref|NP_001284452.1| hexokinase-1-like [Cucumis melo]
 ref|XP_008450786.1| PREDICTED: hexokinase-1-like [Cucumis melo]
 gb|ACJ04705.1| hexokinase 2 [Cucumis melo]
Length=498

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA LFGD VPPKLK PFILRTPDMSAMH DTS DLKVVG KL +ILE
Sbjct  324  GEIVRRVLCRMAEEAALFGDVVPPKLKKPFILRTPDMSAMHHDTSPDLKVVGTKLNNILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + NS L +RK+V E+CDIVATR ARLSAAGI GI+KKLGRD+ K G+ N++SV+AVDGGL
Sbjct  384  VSNSPLPLRKIVFELCDIVATRGARLSAAGIYGIIKKLGRDTPKDGD-NQKSVIAVDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+ +ES+LKELLGE  +++ VIEHSNDGSGIGAALLAA+HSQYL  +ES
Sbjct  443  FEHYTKFRNSLESSLKELLGEQVADNFVIEHSNDGSGIGAALLAASHSQYLGVEES  498



>gb|AAS60196.1| hexokinase 4b [Nicotiana tabacum]
Length=498

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVLC+MAEEA  F D VPPKLK PFILRT DMSAMH D SADLKVVG+KLKDILE
Sbjct  325  GEILRRVLCRMAEEASFFDDYVPPKLKTPFILRTQDMSAMHHDKSADLKVVGDKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNS+ KMRK++VE+CDI+ +R ARLSAAGIVGILKKLGRD+ K GE  +RSV+AVDG L
Sbjct  385  VPNSTWKMRKIIVELCDIITSRGARLSAAGIVGILKKLGRDTLKDGE-KQRSVIAVDGAL  443

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+CME T+KELLG+A+E++V++ S DGSG+GAALLAA+HSQYL   ES
Sbjct  444  FEHYTKFRNCMEGTIKELLGDAAENIVVKLSYDGSGVGAALLAASHSQYLGLKES  498



>ref|XP_008228416.1| PREDICTED: hexokinase-1-like [Prunus mume]
Length=497

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLCK+AEEA LFGDTVPPKLK+PFILRTPDMSAMH DTS+DLKVV + LK++LE
Sbjct  323  GEIVRRVLCKIAEEASLFGDTVPPKLKVPFILRTPDMSAMHHDTSSDLKVVRDILKNVLE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+S K+RKVVVE+C+IVATR ARL+AAGI+G+LKK+G+D++K GE  +R+VVA+DGGL
Sbjct  383  ISNTSRKIRKVVVELCNIVATRGARLAAAGILGVLKKVGKDAFKDGE-KQRTVVALDGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY ++  CME+TL+ELLG E SES+VIEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  442  YEHYNEYSKCMENTLRELLGEEVSESIVIEHSNDGSGIGAALLAASHSQYLGVDES  497



>ref|XP_002325031.1| Hexokinase 1 family protein [Populus trichocarpa]
 gb|EEF03596.1| Hexokinase 1 family protein [Populus trichocarpa]
Length=498

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA  FGD VP KLKIPFILRTP MSAMH D S+DL+VVG+KLKDILE
Sbjct  324  GEIVRRVLLKMAEEAAFFGDIVPQKLKIPFILRTPHMSAMHHDESSDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IP++SLKMRK +VE+CDIVATR ARLSAAGIVGI+KKLGRD+ K GE  K SV+A+DGGL
Sbjct  384  IPHTSLKMRKAIVELCDIVATRGARLSAAGIVGIIKKLGRDTVKDGEKQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY+KF  CMESTLKELLG E S+++V+E SNDGSGIGAALLAA+HSQYLE +ES
Sbjct  443  YEHYSKFSTCMESTLKELLGEEVSDNIVVEQSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_007024321.1| Hexokinase 2 [Theobroma cacao]
 gb|EOY26943.1| Hexokinase 2 [Theobroma cacao]
Length=498

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MAEEA  FGD VPPKLK+PF+LRTP MSAMH+DTS DLKVV NKLKD LE
Sbjct  324  GEIVRRVLLRMAEEAAFFGDIVPPKLKVPFVLRTPVMSAMHQDTSPDLKVVANKLKDTLE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+S+KMRKV+VE+C+IVATR ARLSAAGI+GILKK GRD+ K GE  +R+V+A+DGGL
Sbjct  384  ISNTSVKMRKVIVELCNIVATRGARLSAAGILGILKKTGRDTVKVGE-KQRTVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY +FR C+E+TL ELLG E SES+V+EHSNDGSGIGAALLAA+HSQY+E +ES
Sbjct  443  YEHYAEFRKCLENTLSELLGEEVSESIVVEHSNDGSGIGAALLAASHSQYVEMEES  498



>ref|XP_008458849.1| PREDICTED: hexokinase-1-like isoform X1 [Cucumis melo]
Length=583

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR+VL KMAEEA +FG+TVPPKLKIPFILRTP MSAMH DTS DLKVV NKLKD+LE
Sbjct  409  GEIVRKVLVKMAEEATIFGETVPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLE  468

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK++VE+CD+VATR ARLSAAGI+GILKKLGRD+ + GE  K SVVA+DGGL
Sbjct  469  ISNTSLKTRKIIVELCDVVATRGARLSAAGILGILKKLGRDTIRVGEKQK-SVVALDGGL  527

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYTKFR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE DE
Sbjct  528  YEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDE  582



>gb|KHG22031.1| Hexokinase-1 [Gossypium arboreum]
Length=529

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRRVL KMA+EA  FGDT+P KLKIPFILRTP MSAMH+DT+ DLK+V  KLKDILE
Sbjct  355  GEVVRRVLYKMADEAAFFGDTIPEKLKIPFILRTPHMSAMHQDTTPDLKIVAKKLKDILE  414

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+CDIVATR ARLSAAGI GILKK+GRD+ K GE  K SVV++DGGL
Sbjct  415  ISNTSLKMRKVIVELCDIVATRGARLSAAGIAGILKKIGRDTLKDGEKQK-SVVSLDGGL  473

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYTKFR CME+TL ELLG E SE+++IEHSNDGSGIGAALLAA+HSQY+  DES
Sbjct  474  YEHYTKFRTCMENTLTELLGEEVSENIIIEHSNDGSGIGAALLAASHSQYIGIDES  529



>gb|KHN27811.1| Hexokinase-1 [Glycine soja]
Length=433

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEE + FGDTVPPKL+IPF+LRTPDMSAMH DTS+DLKVVGNKLKDILE
Sbjct  259  GDIVRRVLLKMAEEVDFFGDTVPPKLRIPFVLRTPDMSAMHHDTSSDLKVVGNKLKDILE  318

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VVE+CDIVATR ARLSAAGI  ILKK+GRD+ K G+  K SVVA+DGGL
Sbjct  319  INNTSLKTRKIVVELCDIVATRGARLSAAGIFSILKKIGRDTVKDGKKQK-SVVALDGGL  377

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR  +ESTLKELLG EA E++ IEHSNDGSGIGAALLAA++SQYL   ES
Sbjct  378  FEHYAKFRSSLESTLKELLGDEADETVGIEHSNDGSGIGAALLAASNSQYLGVQES  433



>gb|ADZ96378.1| hexokinase 1 [Eriobotrya japonica]
Length=497

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC++AEEA LFGDTVPPKL +PFILRTPDMSAMH D S+DL+VV  KLK++LE
Sbjct  323  GEIVRRVLCRIAEEASLFGDTVPPKLNVPFILRTPDMSAMHHDASSDLRVVREKLKNVLE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RKV+VE+C+IVATR ARL+AAG++G+LKKLGRD+ K GE N+++VVA+DGGL
Sbjct  383  ISNTSLKVRKVIVELCNIVATRGARLAAAGVLGVLKKLGRDAVKDGE-NQKTVVALDGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT++  CME+TL+ELLG E +E+++IEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  442  YEHYTEYSKCMENTLRELLGEEVAETIIIEHSNDGSGIGAALLAASHSQYLGIDES  497



>gb|AID50967.1| hexokinase 1 [Malus domestica]
Length=498

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA+ FGD VPPKLKIPFILRTP+MSA+H D+S DLKVVG+KLKDILE
Sbjct  324  GEIVRRVLLKMAEEADFFGDVVPPKLKIPFILRTPEMSAIHHDSSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV V VCDIVATRAARLSAAG++G+LKKLGRD+ K GE  K S++A+DGGL
Sbjct  384  ISNTSLKMRKVAVAVCDIVATRAARLSAAGMLGVLKKLGRDTVKDGEKQK-SMIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT+FR  ME TLKELLG E +E + +EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  443  YEHYTEFRTSMECTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_002514221.1| hexokinase, putative [Ricinus communis]
 gb|EEF48175.1| hexokinase, putative [Ricinus communis]
Length=498

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA LFGD VPPKL+IPFILRTP MSAMH+DTS+DL+VVG+KLKDILE
Sbjct  324  GEIVRRVLLKMAEEANLFGDVVPPKLEIPFILRTPVMSAMHQDTSSDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK RK +V++CDIVATR ARLSAAGIVGILKKLGRD+ K  E +K SV+A+DGGL
Sbjct  384  IPNTSLKTRKAIVKLCDIVATRGARLSAAGIVGILKKLGRDTIKEREKHK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHYTKFR C+EST++ELLG E SE++V+EHSNDGSGIGAALLAA+HS Y E  E
Sbjct  443  FEHYTKFRVCLESTIEELLGKEVSENIVVEHSNDGSGIGAALLAASHSLYREVAE  497



>gb|AFU82542.1| hexokinase, partial [Artemisia tridentata]
Length=196

 Score =   248 bits (632),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA EAE FGD+VP KL+ PFILRTPDMSAMH D++ DLKVV +KLKD+LE
Sbjct  21   GEIVRRVLLKMAVEAEFFGDSVPSKLEKPFILRTPDMSAMHHDSTPDLKVVASKLKDVLE  80

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK++VEVCD VA RAARLSAAGI+GILKK+GRD+ K G+ N++SV+A+DGGL
Sbjct  81   ISNTSLKMRKIIVEVCDTVANRAARLSAAGILGILKKIGRDTVKEGDENQKSVIAMDGGL  140

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKF   +++ + ELLG EAS++++IE SNDGSG+GAALLAA+HSQY   DES
Sbjct  141  FEHYTKFSIALQNAMDELLGEEASKNMIIELSNDGSGLGAALLAASHSQYATYDES  196



>ref|XP_009338734.1| PREDICTED: hexokinase-1-like isoform X1 [Pyrus x bretschneideri]
Length=497

 Score =   257 bits (657),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC++A+EA LFGDTVPPKL +PFILRTPDMSAMH D S+DL+VV  KLK++LE
Sbjct  323  GEIVRRVLCRIADEASLFGDTVPPKLNVPFILRTPDMSAMHHDASSDLRVVREKLKNVLE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RKV+VE+C+IVATR ARL+AAG++G+LKKLGRD+ K GE N+++VVA+DGGL
Sbjct  383  ISNTSLKVRKVIVELCNIVATRGARLAAAGVLGVLKKLGRDAVKDGE-NQKTVVALDGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT++  CME+TL+ELLG E +E++VIEHSNDGSGIGAALLAA+HSQYL  DES
Sbjct  442  YEHYTEYSKCMENTLRELLGEEVAETIVIEHSNDGSGIGAALLAASHSQYLGIDES  497



>gb|AAL60583.1|AF454961_1 hexokinase [Brassica oleracea]
Length=499

 Score =   257 bits (656),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD++PPKLK+PFI+RTP MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDSIPPKLKVPFIIRTPTMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P ++LKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K GE+ ++SV+A+DGGL
Sbjct  384  VP-TTLKMRKVVISLCNIIATRGARLSAAGIYGILKKLGRDAPKDGETTQKSVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT+F +CMES+LKELLG EASES+ + HSNDGSG+GAALLAA+HSQYLE  E+
Sbjct  443  FEHYTQFSECMESSLKELLGDEASESVEVIHSNDGSGVGAALLAASHSQYLEDSET  498



>gb|ACJ04704.1| hexokinase 1 [Cucumis melo]
Length=498

 Score =   257 bits (656),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR+VL KMAEEA +FG+T PPKLKIPFILRTP MSAMH DTS DLKVV NKLKD+LE
Sbjct  324  GEIVRKVLVKMAEEATIFGETAPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK++VE+CD+VATR ARLSAAGI+GILKKLGRD+ + GE  K SVVA+DGGL
Sbjct  384  ISNTSLKTRKIIVELCDVVATRGARLSAAGILGILKKLGRDTIRVGEKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYT+FR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE DE
Sbjct  443  YEHYTEFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDE  497



>emb|CDY03331.1| BnaC09g10170D [Brassica napus]
Length=499

 Score =   257 bits (656),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD++PPKLK+PFI+RTP MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDSIPPKLKVPFIIRTPTMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P ++LKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K GE+ ++SV+A+DGGL
Sbjct  384  VP-TTLKMRKVVISLCNIIATRGARLSAAGIYGILKKLGRDAPKDGETTQKSVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT+F +CMES+LKELLG EASES+ + HSNDGSG+GAALLAA+HSQYLE  E+
Sbjct  443  FEHYTQFSECMESSLKELLGDEASESVEVIHSNDGSGVGAALLAASHSQYLEDSET  498



>ref|XP_010267128.1| PREDICTED: hexokinase-1-like [Nelumbo nucifera]
Length=500

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL +MAEEA  FGDTVP KL +PFILRTPDMSAMH DTS+DLKVVG+KLKDIL 
Sbjct  326  GDIVRRVLLRMAEEAAFFGDTVPLKLTVPFILRTPDMSAMHHDTSSDLKVVGSKLKDILG  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R+ +VE+C+IVATR ARLSAAG++GILKK+GRD  K GE  +R+VVA+DGGL
Sbjct  386  ISNTSLKTRRAIVELCNIVATRGARLSAAGMLGILKKMGRDIIKEGE-KQRTVVAMDGGL  444

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT+FR+C+E+TLKELLG EASES+V+EHSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  445  YEHYTEFRNCLENTLKELLGEEASESVVVEHSNDGSGIGAALLAASHSQYLEVEDS  500



>ref|XP_006408903.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
 gb|ESQ50356.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
Length=499

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD+VPPKL+IPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDSVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +C+I+A+R ARLSAAGI GILKKLGR++ K GE+ K SV+A+DGGL
Sbjct  384  VPTTSLKMRKVVISLCNIIASRGARLSAAGIYGILKKLGRETPKDGETQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT+F +CMES+LKELLG EASES+ + HSNDGSG+GAALLAA+HSQYLE  E+
Sbjct  443  FEHYTQFSECMESSLKELLGDEASESVEVIHSNDGSGVGAALLAASHSQYLEDSET  498



>gb|KFK40349.1| hypothetical protein AALP_AA3G362600 [Arabis alpina]
Length=500

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 154/174 (89%), Gaps = 2/174 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA+ FGDTVPPKL+IPFI+RTP MSAMH DTS DLKVVG+KLKDIL+
Sbjct  324  GEILRRVLLKMAEEADFFGDTVPPKLRIPFIIRTPHMSAMHSDTSPDLKVVGSKLKDILD  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +C+I+A+R ARLSAAGI GILKKLGRD+ K GE+ K S +A+DGGL
Sbjct  384  VPTTSLKMRKVVISLCNIIASRGARLSAAGIYGILKKLGRDATKEGETQK-SAIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            FEHYT+F +CMES LKELLG EASES+ + HSNDGSG+GAALLAA+HSQYLE D
Sbjct  443  FEHYTQFSECMESALKELLGDEASESVEVIHSNDGSGVGAALLAASHSQYLEED  496



>ref|XP_003529000.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEE + FGDTVPPKL+IPF+LRTPDMSAMH DTS+DLKVVGNKLKDILE
Sbjct  324  GDIVRRVLLKMAEEVDFFGDTVPPKLRIPFVLRTPDMSAMHHDTSSDLKVVGNKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VVE+CDIVATR ARLSAAGI  ILKK+GRD+ K G+  K SVVA+DGGL
Sbjct  384  INNTSLKTRKIVVELCDIVATRGARLSAAGIFSILKKIGRDTVKDGKKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR  +ESTLKELLG EA E++ IEHSNDGSGIGAALLAA++SQYL   ES
Sbjct  443  FEHYAKFRSSLESTLKELLGDEADETVGIEHSNDGSGIGAALLAASNSQYLGVQES  498



>ref|XP_004135675.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 ref|XP_004157285.1| PREDICTED: hexokinase-2-like [Cucumis sativus]
 gb|KGN66181.1| hypothetical protein Csa_1G574970 [Cucumis sativus]
Length=498

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA LFGD VPPKLK PFILRTPDMSAMH DTS DLKVVG+KL +ILE
Sbjct  324  GEIVRRVLCRMAEEAALFGDVVPPKLKKPFILRTPDMSAMHHDTSPDLKVVGSKLNNILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + NS L +RK+V  +CDIVATR ARLSAAGI GI+KKLGRD+ K G+ N++SV+AVDGGL
Sbjct  384  VSNSPLPLRKIVFMLCDIVATRGARLSAAGIYGIIKKLGRDTPKDGD-NQKSVIAVDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR+ +ES+LKELLG + +++ VIEHSNDGSGIGAALLAA+HSQYL  +ES
Sbjct  443  FEHYTKFRNSLESSLKELLGDQVADNFVIEHSNDGSGIGAALLAASHSQYLGVEES  498



>ref|XP_008337603.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA+ FGD VPPKLKIPF LRTP+MSA+H D+S DLKVVG+KLKDILE
Sbjct  324  GEIVRRVLLKMAEEADFFGDVVPPKLKIPFXLRTPEMSAIHHDSSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV V VCDIVATRAARLSAAG++G+LKKLGRD+ K GE  K S++A+DGGL
Sbjct  384  ISNTSLKMRKVXVAVCDIVATRAARLSAAGMLGVLKKLGRDTVKDGEKQK-SMIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT+FR  ME TLKELLG E +E + +EHSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  443  YEHYTEFRTSMECTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_004141023.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_004157890.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 gb|KGN60576.1| hypothetical protein Csa_2G000830 [Cucumis sativus]
Length=498

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR+VL KMAEEA +FGDTVPPKLKIPFILRTP  SAMH DTS DLKVV +KLKD+LE
Sbjct  324  GEIVRKVLVKMAEEAAIFGDTVPPKLKIPFILRTPHTSAMHHDTSPDLKVVASKLKDVLE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK++VE+CD+VATR ARLSAAGI+GILKKLGRD+ + GE  K SVVA+DGGL
Sbjct  384  ISNTSLKTRKIIVELCDVVATRGARLSAAGILGILKKLGRDTVRVGEKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYTKFR  ME+TLKELLG E + ++ +EHSNDGSGIGAALLAA+HSQYLE +E
Sbjct  443  YEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVEE  497



>ref|XP_009102132.1| PREDICTED: hexokinase-1 [Brassica rapa]
Length=500

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMA+EA  FGD+VPPKL+IPFI+RTPDMSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMADEAAFFGDSVPPKLRIPFIIRTPDMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVVV +CDI+A+R ARLSAAGI GILKKLGRD+ K GE+ K SV+A+DGGL
Sbjct  384  VPTTSLKMRKVVVSLCDIIASRGARLSAAGIYGILKKLGRDTPKDGETQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYL+
Sbjct  443  FEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLD  494



>ref|NP_001280783.1| uncharacterized protein LOC103443741 [Malus domestica]
 gb|AFU56883.1| hexokinase [Malus domestica]
Length=497

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC++AEEA LFGDT+PPKLK+PF LRTPDMSAMH+D S+DL+VV  KLK++LE
Sbjct  323  GEIVRRVLCRIAEEASLFGDTIPPKLKVPFNLRTPDMSAMHQDASSDLRVVREKLKNVLE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RKV+VE+C+IVATR ARL+AAG++G+LKKLGRD+ K GE NK++VVA+DGGL
Sbjct  383  ISNTSLKVRKVIVELCNIVATRGARLAAAGVLGVLKKLGRDAVKDGE-NKKTVVALDGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT++  CME+TL+ELLG E +E++VIEHSNDGSGIGAALLAA+HSQY   DES
Sbjct  442  YEHYTEYSKCMENTLRELLGEEVAETVVIEHSNDGSGIGAALLAASHSQYPGIDES  497



>gb|AIX02984.1| hexokinase [Morella rubra]
Length=497

 Score =   254 bits (650),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G IVRRVLC+MAEEA+LFGD+VPPKLKIPFILRT DMSAMH DTS+DL+VVG+KLKDILE
Sbjct  323  GGIVRRVLCRMAEEADLFGDSVPPKLKIPFILRTLDMSAMHHDTSSDLRVVGSKLKDILE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SLK RKV+ EVCDIVATR ARLSAAG++GILKKLGRD+ + GE  +RSV+A+DGGL
Sbjct  383  ISSTSLKARKVIAEVCDIVATRGARLSAAGMLGILKKLGRDTVRDGE-KQRSVIALDGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY KFR CM+STL ELLG E + ++V+EHSNDGSGIGAALLAA+HSQY   +ES
Sbjct  442  YEHYNKFRTCMKSTLNELLGEEVAGNIVVEHSNDGSGIGAALLAASHSQYAGVEES  497



>gb|KJB56835.1| hypothetical protein B456_009G137700 [Gossypium raimondii]
Length=498

 Score =   254 bits (650),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGDTVPPKL+ PFIL TP MSAMH+DTS DLKVV + LKDILE
Sbjct  324  GEIVRRVLCRMAEEAAFFGDTVPPKLEEPFILGTPIMSAMHQDTSPDLKVVASNLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+C+IVATR ARLSAAG++G+LKK+GRD+ K GE  K +V+A+DGGL
Sbjct  384  ISNTSLKMRKVIVELCNIVATRGARLSAAGVLGVLKKMGRDTIKGGEKQK-TVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT++R+C+E+TL EL+G E S ++ IEHSNDGSGIGAALLAA+HSQYLE DES
Sbjct  443  YEHYTEYRECLENTLNELVGEEVSRTIEIEHSNDGSGIGAALLAASHSQYLETDES  498



>emb|CDY48733.1| BnaA09g10080D [Brassica napus]
Length=499

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD++PPKLK+PFI+RTP MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDSIPPKLKVPFIIRTPTMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P ++LKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K GE+ ++SV+A+DGGL
Sbjct  384  VP-TTLKMRKVVISLCNIIATRGARLSAAGIYGILKKLGRDAPKDGEATQKSVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYLE  E+
Sbjct  443  FEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLEDSET  498



>gb|AAL60584.1|AF454962_1 hexokinase [Brassica oleracea]
 emb|CDX82746.1| BnaC07g01200D [Brassica napus]
Length=499

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMA+EA  FGD+VPPKL+IPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMADEAAFFGDSVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVVV +CDI+A R ARLSAAGI GILKKLGRD+ K GE+ K SV+A+DGGL
Sbjct  384  VPTTSLKMRKVVVSLCDIIACRGARLSAAGIYGILKKLGRDAPKDGETQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT+F +CMES+LKELLG EAS+S+ + HSNDGSG+GAALLAA+HSQYL+  ++
Sbjct  443  FEHYTQFSECMESSLKELLGDEASDSVEVIHSNDGSGVGAALLAASHSQYLDDSQT  498



>gb|ABI18156.1| hexokinase [Helianthus annuus]
Length=498

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRRVL KMAEEAE FGD VP KL+ PFILRTPDMSAMH D++ DLKVV  KLKDILE
Sbjct  322  GEVVRRVLLKMAEEAEFFGDIVPSKLQKPFILRTPDMSAMHHDSTPDLKVVATKLKDILE  381

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VEVCD+VATR ARLSAAGI+GILKK+G+D+ K GE N++SV+A+DGGL
Sbjct  382  ISNTSLKMRKVIVEVCDLVATRGARLSAAGILGILKKIGKDTCKEGEENQKSVIAMDGGL  441

Query  361  FEHYTKFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR  M+ T+ ELLGE  S+++++E SNDGSG+GAALLAA+HSQYLE  ES
Sbjct  442  FEHYTKFRKTMQDTMNELLGEEISKNIIVELSNDGSGLGAALLAASHSQYLEYIES  497



>ref|XP_009112637.1| PREDICTED: hexokinase-1-like [Brassica rapa]
Length=499

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD++PPKLK+PFI+RTP MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDSIPPKLKVPFIIRTPTMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P ++LKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K GE+ ++SV+A+DGGL
Sbjct  384  VP-TTLKMRKVVISLCNIIATRGARLSAAGIYGILKKLGRDAPKDGETTQKSVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYL+  E+
Sbjct  443  FEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLQDSET  498



>ref|XP_010098150.1| hypothetical protein L484_026284 [Morus notabilis]
 gb|EXB74587.1| hypothetical protein L484_026284 [Morus notabilis]
Length=499

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR+VLC++AEEA LFGDTVPPKLK+PFILRTP  SAMH DTS DLKVV +KL+DILE
Sbjct  324  GEIVRKVLCRIAEEASLFGDTVPPKLKVPFILRTPHTSAMHHDTSPDLKVVADKLRDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VV++C+IVATR ARL+AAGI+GILKKLGR++ K GE ++++V+A+DGGL
Sbjct  384  ITNTSLKERKLVVQLCNIVATRGARLAAAGILGILKKLGRETLKNGE-DQKTVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT++R C+ESTL EL+GE  SES+VIEHSNDGSGIGAA LAA+HSQY + +ES
Sbjct  443  YEHYTEYRKCLESTLTELIGEKVSESIVIEHSNDGSGIGAAFLAASHSQYPDVEES  498



>emb|CDY35895.1| BnaA07g00920D [Brassica napus]
Length=500

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMA+EA  FGD+VPPKL+IPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMADEAAFFGDSVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVVV +CDI+A+R ARLSAAGI GILKKLGRD+ K GE+ K SV+A+DGGL
Sbjct  384  VPTTSLKMRKVVVSLCDIIASRGARLSAAGIYGILKKLGRDAPKDGETQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSG+GAALLAA+HSQYL+
Sbjct  443  FEHYTQFSECMESSLKELLGDEASGSVEVIHSNDGSGVGAALLAASHSQYLD  494



>ref|XP_007152969.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
 gb|ESW24963.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
Length=500

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEEA+ FGDTVPPKLKIP ILRTPDMSA+H D S+DL VVG KLKDILE
Sbjct  324  GDIVRRVLLKMAEEADFFGDTVPPKLKIPLILRTPDMSAIHHDASSDLNVVGTKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNK-RSVVAVDGG  365
            I N+SLKMRK+VVE+CDIVATR ARLSAAGI GILKK+GRD+ KA E  K +SV+A+DGG
Sbjct  384  INNTSLKMRKLVVELCDIVATRGARLSAAGIFGILKKIGRDTVKAEEKQKQKSVIALDGG  443

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            LFEHYT+FR  +ESTLKELLG EAS+S+ IEHSNDGSGIGAALLAA +SQYL
Sbjct  444  LFEHYTEFRSSLESTLKELLGDEASDSVGIEHSNDGSGIGAALLAACNSQYL  495



>gb|KEH27216.1| hexokinase [Medicago truncatula]
Length=496

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEEAE+FGDTVPPKL+IPFILRTPDMSAMH D+S+DLKVVG KLKDILE
Sbjct  322  GDIVRRVLLKMAEEAEIFGDTVPPKLRIPFILRTPDMSAMHHDSSSDLKVVGKKLKDILE  381

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+ LK+RK+ VE+CDIV+ R ARL+AA I GIL+KLGRD+ K G+  K SV+A+DGGL
Sbjct  382  IDNTPLKVRKIAVELCDIVSVRGARLAAAAIFGILRKLGRDTVKDGDKQK-SVIALDGGL  440

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR CMESTL+ELLG EAS ++ IEHSNDGSGIGAALLAA+ SQYL  +ES
Sbjct  441  FEHYAKFRTCMESTLRELLGDEASGTIGIEHSNDGSGIGAALLAASQSQYLGVEES  496



>gb|AHY84731.1| hexokinase [Manihot esculenta]
Length=498

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MA+EA  FGD VPPKL+IPFILRTP MSAMH DTS+DLKVVG+KLKDILE
Sbjct  324  GEIVRRVLLRMAQEAAFFGDVVPPKLEIPFILRTPHMSAMHHDTSSDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK +VE+CDIVATR ARLSAAGI+GILKKLGRD+ K GE  K SV+A+DGGL
Sbjct  384  ISNTSLKMRKAIVELCDIVATRGARLSAAGIMGILKKLGRDAVKDGEKQK-SVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR  MESTLKELLG E SES++IEHSNDGSGIGAALLAA+HSQYLE  E+
Sbjct  443  FEHYTKFRSSMESTLKELLGEEISESIIIEHSNDGSGIGAALLAASHSQYLEVAEA  498



>ref|XP_004302852.1| PREDICTED: hexokinase-1-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR L ++AEEA +FGD VPPKLK+PFILRTPDMSAMH DTS DLKVV + LK++LE
Sbjct  323  GEIVRRALYRIAEEASIFGDIVPPKLKVPFILRTPDMSAMHHDTSYDLKVVRDILKNVLE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RK++VE+C+ VATR ARL+AAGI+G+LKKLGRD ++ GE  K++V+A+DGGL
Sbjct  383  ISNTSLKVRKLIVELCNTVATRGARLAAAGILGVLKKLGRDVFRDGEKQKKTVIALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT++  CME+TL+ELLG E   S+VIEHSNDGSGIGAAL+AA+HSQYL+ DES
Sbjct  443  FEHYTEYSKCMENTLRELLGEEVGASIVIEHSNDGSGIGAALIAASHSQYLQDDES  498



>ref|XP_004287480.1| PREDICTED: hexokinase-1 [Fragaria vesca subsp. vesca]
Length=498

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEEA  FGDTVP KLKIPF+LRTPDMSAMH D+S DL+VVG+KLKDILE
Sbjct  324  GDIVRRVLLKMAEEAAFFGDTVPHKLKIPFVLRTPDMSAMHHDSSPDLRVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK+RK VV +CDIVATR ARLSAAGI+G+LKKLGRD+ K GE +K SVVA+DGGL
Sbjct  384  ISNTSLKVRKAVVALCDIVATRGARLSAAGILGVLKKLGRDTVKDGEKHK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT+FR CMESTL ELLG + +E + +EHSNDGSGIGAALLAA+HS YL  ++S
Sbjct  443  FEHYTEFRVCMESTLDELLGDDVAEHISVEHSNDGSGIGAALLAASHSHYLGVEDS  498



>ref|XP_002886018.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62277.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKLKIPFILRTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDIVPPKLKIPFILRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +PNSSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GE+ K SV+A+DGGL
Sbjct  384  VPNSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDATKDGEAQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADESL  194
            FEHYT+F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE ++  
Sbjct  443  FEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELEDDF  499



>ref|XP_010467923.1| PREDICTED: hexokinase-2 isoform X2 [Camelina sativa]
Length=412

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKL+IPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  234  GEILRRVLLKMAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  293

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P SSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GES K SV+A+DGGL
Sbjct  294  VPTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDAAKDGESQK-SVIAMDGGL  352

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHYT+F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE  E
Sbjct  353  FEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLEPGE  407



>gb|KHN40379.1| Hexokinase-2 [Glycine soja]
Length=503

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEEA+ FGDTVPPKL+IPFILRT  +  MH DTS+DLKVVGNKLKDILE
Sbjct  329  GDIVRRVLLKMAEEADFFGDTVPPKLRIPFILRTYHIVVMHHDTSSDLKVVGNKLKDILE  388

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VV++CDIVATR ARLSAAGI GILKK+GRD+ KAGE  K SVVA+DGGL
Sbjct  389  INNTSLKMRKIVVQLCDIVATRGARLSAAGIFGILKKIGRDTIKAGEKQK-SVVALDGGL  447

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FE Y KFR  +ESTLKELLG EA+E + IE SNDGSGIGAALLAA+HSQYL   ES
Sbjct  448  FEGYKKFRSSLESTLKELLGDEAAEMIGIEQSNDGSGIGAALLAASHSQYLGVPES  503



>ref|XP_010526433.1| PREDICTED: hexokinase-1 [Tarenaya hassleriana]
Length=499

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGDTVPPKL+IPFI+RTP MSAMH DTS DLKVVG+KLKDILE
Sbjct  325  GEILRRVLLKMAEEAAFFGDTVPPKLRIPFIIRTPHMSAMHCDTSPDLKVVGSKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +C+I+A+R ARLSAAGI GILKKLGRD  K GE  K SVVA+DGGL
Sbjct  385  VPTTSLKMRKVVISLCNIIASRGARLSAAGIYGILKKLGRDVPKEGEQQK-SVVAMDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY++F   MESTLKELLG E S+++ I HSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  444  FEHYSQFSASMESTLKELLGEEVSDNIEIIHSNDGSGIGAALLAASHSQYLEVEDS  499



>ref|XP_008387327.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEEA+ FGD VPPKLKIPF+LRTP MSAMH D+S DLKVVGNKLKDILE
Sbjct  324  GDIVRRVLLKMAEEADFFGDVVPPKLKIPFVLRTPVMSAMHHDSSPDLKVVGNKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMR VV  +CDIV TR ARLSAAGI+G+LKKLGRD+ K GE  K SVVA+DGGL
Sbjct  384  ISNTSLKMRXVVXALCDIVXTRGARLSAAGILGVLKKLGRDTVKBGEKQK-SVVALDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT+FR  ME TLKELLG E +E + IE S+DGSGIGAALLAA+HSQYLE +ES
Sbjct  443  YEHYTEFRTSMEXTLKELLGDEVAEXISIELSSDGSGIGAALLAASHSQYLEVEES  498



>ref|XP_006299465.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
 gb|EOA32363.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
Length=504

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKL+IPFI+RTP+MSAMH DTS DLKVVGNKLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGNKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P SSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GE+ K SV+A+DGGL
Sbjct  384  VPTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDASKDGETQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHYT+F + M+S+LKELLG E +ES+ +  SNDGSG+GAALLAA+HSQYLE +E
Sbjct  443  FEHYTQFSEAMKSSLKELLGDEVAESVEVILSNDGSGVGAALLAASHSQYLEPEE  497



>ref|XP_010540986.1| PREDICTED: hexokinase-1-like [Tarenaya hassleriana]
Length=499

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGDTVPPKL+IPFI+RTP MSAMH D S DLKVVG+KLKDILE
Sbjct  325  GEILRRVLLKMAEEAAFFGDTVPPKLRIPFIIRTPHMSAMHSDASPDLKVVGSKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IP +SLKMRKVV+ +C+I+A+R ARLSAAGI GILKKLGRD  K GE  K SVVA+DGGL
Sbjct  385  IPTTSLKMRKVVISLCNIIASRGARLSAAGIYGILKKLGRDVPKEGEQQK-SVVAMDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY+ F   MESTLKELLG E S+++ I HSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  444  FEHYSHFSASMESTLKELLGDEVSDNIEIIHSNDGSGIGAALLAASHSQYLEVEDS  499



>ref|XP_004513053.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=499

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL K+AE+A+ FGD VPPKL+IPFILRTPDMSAMH DTS+DLKVV NKL+ I E
Sbjct  325  GDIVRRVLLKLAEQADFFGDNVPPKLRIPFILRTPDMSAMHHDTSSDLKVVENKLRAIFE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VVE+CDIV+ R ARL+AAGI GILKKLGRD+ KAGE  K SV+A+DGGL
Sbjct  385  IHNTSLKRRKIVVELCDIVSVRGARLAAAGIFGILKKLGRDTVKAGEKQK-SVIALDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR CMESTLKELLG E ++++ IEHSNDGSGIGAALLAAA S+Y   +ES
Sbjct  444  FEHYTKFRSCMESTLKELLGDEVAKTIGIEHSNDGSGIGAALLAAAQSKYSGGEES  499



>gb|KFK29465.1| hypothetical protein AALP_AA7G137600 [Arabis alpina]
Length=498

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGDTVP KL+IPFI+RTP MSAMH D S DLK+VG+K+KDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDTVPSKLRIPFIIRTPHMSAMHNDASPDLKIVGSKMKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P++SLKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K  E  ++SV+A+DGGL
Sbjct  384  LPSTSLKMRKVVITLCNIIATRGARLSAAGIYGILKKLGRDTNK-DEPIQKSVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HSQYLE ++S
Sbjct  443  FEHYTQFSECMESSLKELLGDEASGSIEVIHSNDGSGIGAALLAASHSQYLELEDS  498



>ref|XP_010489125.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKL+IPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P SSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GE+ K SV+A+DGGL
Sbjct  384  VPTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDAAKDGETQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHYT+F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE +E
Sbjct  443  FEHYTQFSETMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLEPEE  497



>ref|XP_006853711.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
 gb|ERN15178.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
Length=500

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+I+RRVL KMAEEA LFGDTVP  L IPF+LRTPDMSA+H DTS+DL++VG+KLKDIL 
Sbjct  324  GDILRRVLLKMAEEAALFGDTVPANLSIPFVLRTPDMSAIHHDTSSDLRIVGSKLKDILG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +  +SLK RKVVVE+C+IVA+R ARLSAAGI+GILKKLGRD+  +  + +R+V+A+DGGL
Sbjct  384  VTTTSLKTRKVVVELCEIVASRGARLSAAGILGILKKLGRDTISSSGTKERTVIAMDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKF DC+E TLKELLG E +E +VI H+NDGSGIGA+LLAA+HSQY+E +ES
Sbjct  444  FEHYTKFSDCLEKTLKELLGEEVAEHVVIVHANDGSGIGASLLAASHSQYVELEES  499



>ref|XP_010467922.1| PREDICTED: hexokinase-2 isoform X1 [Camelina sativa]
Length=502

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKL+IPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P SSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GES K SV+A+DGGL
Sbjct  384  VPTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDAAKDGESQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHYT+F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE  E
Sbjct  443  FEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLEPGE  497



>ref|XP_003516783.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   247 bits (630),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEEA+ FGDTVPPKL+IPFILRT  +  MH DTS+DLKVVGNKLKDILE
Sbjct  322  GDIVRRVLLKMAEEADFFGDTVPPKLRIPFILRTYHIVVMHHDTSSDLKVVGNKLKDILE  381

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SLKMRK+VV++CDIVATR ARLSAAGI GILKK+GRD+ KAGE  K SVVA+DGGL
Sbjct  382  INSTSLKMRKIVVQLCDIVATRGARLSAAGIFGILKKIGRDTIKAGEKQK-SVVALDGGL  440

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FE Y KFR  +ESTLKELLG EA+E + IE SNDGSGIGAALLAA+HSQYL   ES
Sbjct  441  FEGYKKFRSSLESTLKELLGDEAAEMIGIEQSNDGSGIGAALLAASHSQYLGVPES  496



>gb|EYU27268.1| hypothetical protein MIMGU_mgv1a019208mg [Erythranthe guttata]
Length=489

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 153/176 (87%), Gaps = 7/176 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MAEEA  FGD++PPKLKI FILRTPDMSAMH DTS+DLKVVG KLKDILE
Sbjct  320  GEIVRRVLLRMAEEASFFGDSIPPKLKISFILRTPDMSAMHHDTSSDLKVVGKKLKDILE  379

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + +SSLKMR++VVEVCD+VA+R ARL+ AGIVGILKKL R     GE  +RSV+AVDG L
Sbjct  380  VTSSSLKMRRMVVEVCDVVASRGARLATAGIVGILKKLER-----GE-KERSVIAVDGAL  433

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            F HYT+FR+CM+STLKELLGE AS+ +++EHSNDGSGIGAAL+AA+HSQYL  +ES
Sbjct  434  FVHYTEFRNCMKSTLKELLGEAASDRVILEHSNDGSGIGAALIAASHSQYLPVEES  489



>gb|AAA60333.1| hexokinase [Arabidopsis thaliana]
 prf||2118367A hexokinase
Length=435

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAE+A  FGDTVP KL+IPFI+RTP MSAMH DTS DLK+VG+K+KDILE
Sbjct  263  GEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILE  322

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K  E  ++SV+A+DGGL
Sbjct  323  VPTTSLKMRKVVISLCNIIATRGARLSAAGIYGILKKLGRDTTK-DEEVQKSVIAMDGGL  381

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  382  FEHYTQFSECMESSLKELLGDEASGSVEVTHSNDGSGIGAALLAASHSLYLE  433



>gb|KHG28915.1| Hexokinase-1 [Gossypium arboreum]
Length=497

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR+VL +MAEEA  FGDTVPPKLK+PFIL TP +SAMH+DTS DLKVV N+LKDILE
Sbjct  324  GEIVRKVLRRMAEEAAFFGDTVPPKLKVPFILGTPIISAMHQDTSPDLKVVANRLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+C+IVATR ARLSAAGI+ ILKK+GRD+ + GE  +R+V+A+DGGL
Sbjct  384  ISNTSLKMRKVIVELCNIVATRGARLSAAGILSILKKMGRDTMREGE-KQRTVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYT++R+C+E+TL EL+G E SE++V+E +NDGSGIGAA+LAA HS+YLE DE
Sbjct  443  YEHYTEYRNCLENTLNELVGKEVSETVVLELANDGSGIGAAILAACHSKYLETDE  497



>ref|XP_002867423.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43682.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
Length=496

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAE+A  FGDTVP KL+IPFI+RTP MSAMH DTS DLK+VG+K+KDILE
Sbjct  324  GEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K  E  ++SV+A+DGGL
Sbjct  384  VPTTSLKMRKVVLSLCNIIATRGARLSAAGIYGILKKLGRDTTK-DEEMQKSVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F DCMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  443  FEHYTQFSDCMESSLKELLGDEASGSIEVTHSNDGSGIGAALLAASHSLYLE  494



>gb|KJB70380.1| hypothetical protein B456_011G070700 [Gossypium raimondii]
Length=497

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR+VL +MAEEA  FGDTVPPKLK+PFIL TP +SAMH+DTS DLKVV N+LKDILE
Sbjct  324  GEIVRKVLRRMAEEAAFFGDTVPPKLKVPFILGTPIISAMHQDTSPDLKVVANRLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+VE+C IVATR ARLSAAGI+ ILKK+GRD+ + GE  +R+V+A+DGGL
Sbjct  384  ISNTSLKMRKVIVELCYIVATRGARLSAAGILSILKKMGRDTMREGE-KQRTVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYT++R+C+E+TL ELLG E SE++V+E +NDGSGIGAA+LAA HS+YLE DE
Sbjct  443  YEHYTEYRNCLENTLNELLGKEVSETVVLELANDGSGIGAAILAACHSKYLETDE  497



>ref|NP_001077921.1| hexokinase 2 [Arabidopsis thaliana]
 gb|AEC06935.1| hexokinase 2 [Arabidopsis thaliana]
Length=393

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKLKIPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  215  GEILRRVLLKMAEEAAFFGDIVPPKLKIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  274

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +  SSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GE+ K SV+A+DGGL
Sbjct  275  VQTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDATKDGEAQK-SVIAMDGGL  333

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHYT+F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE ++
Sbjct  334  FEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELED  388



>ref|XP_010416617.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKL+IPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDVVPPKLRIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P SSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GE+ K SV+A+DGGL
Sbjct  384  VPTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDAAKDGETQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYT+F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE  E
Sbjct  443  YEHYTQFSEIMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLEPGE  497



>pdb|4QS9|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S177a Structure 
In Glucose- Bound Form
Length=474

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAE+A  FGDTVP KL+IPFI+RTP MSAMH DTS DLK+VG+K+KDILE
Sbjct  302  GEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILE  361

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K  E  ++SV+A+DGGL
Sbjct  362  VPTTSLKMRKVVISLCNIIATRGARLSAAGIYGILKKLGRDTTK-DEEVQKSVIAMDGGL  420

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  421  FEHYTQFSECMESSLKELLGDEASGSVEVTHSNDGSGIGAALLAASHSLYLE  472



>pdb|4QS7|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Glucose-bound 
Form
 pdb|4QS8|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Ligand-free 
Form
Length=474

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAE+A  FGDTVP KL+IPFI+RTP MSAMH DTS DLK+VG+K+KDILE
Sbjct  302  GEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILE  361

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K  E  ++SV+A+DGGL
Sbjct  362  VPTTSLKMRKVVISLCNIIATRGARLSAAGIYGILKKLGRDTTK-DEEVQKSVIAMDGGL  420

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  421  FEHYTQFSECMESSLKELLGDEASGSVEVTHSNDGSGIGAALLAASHSLYLE  472



>ref|NP_194642.1| hexokinase 1 [Arabidopsis thaliana]
 sp|Q42525.2|HXK1_ARATH RecName: Full=Hexokinase-1; AltName: Full=Protein GLUCOSE INSENSITIVE 
2 [Arabidopsis thaliana]
 gb|AAB49908.1| hexokinase 1 [Arabidopsis thaliana]
 emb|CAB43927.1| hexokinase [Arabidopsis thaliana]
 emb|CAB79671.1| hexokinase [Arabidopsis thaliana]
 gb|AAL77665.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 gb|AAM70518.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 dbj|BAF02067.1| hexokinase [Arabidopsis thaliana]
 gb|AEE85590.1| hexokinase 1 [Arabidopsis thaliana]
Length=496

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAE+A  FGDTVP KL+IPFI+RTP MSAMH DTS DLK+VG+K+KDILE
Sbjct  324  GEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +C+I+ATR ARLSAAGI GILKKLGRD+ K  E  ++SV+A+DGGL
Sbjct  384  VPTTSLKMRKVVISLCNIIATRGARLSAAGIYGILKKLGRDTTK-DEEVQKSVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F +CMES+LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  443  FEHYTQFSECMESSLKELLGDEASGSVEVTHSNDGSGIGAALLAASHSLYLE  494



>ref|XP_007135629.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
 gb|ESW07623.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
Length=495

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 154/173 (89%), Gaps = 2/173 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLCKMAEEA LFGD VPPKLK PFILRTPDMSAMH D+SADL VVG+KLK++  
Sbjct  324  GEIVRRVLCKMAEEALLFGDDVPPKLKDPFILRTPDMSAMHHDSSADLTVVGSKLKNVFG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL++RKVVVE+C+IVATR ARLSAAGI+GILKKLG+D+   G+  K +V+A+DGGL
Sbjct  384  ISDTSLEVRKVVVEICNIVATRGARLSAAGILGILKKLGKDTISDGKGEK-NVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            +EHYT++  C+E+T+KEL+G + SES++IEHSNDGSGIGAALLAA+HSQYL+A
Sbjct  443  YEHYTEYSKCLENTVKELVGDDVSESIIIEHSNDGSGIGAALLAASHSQYLDA  495



>ref|XP_002515958.1| hexokinase, putative [Ricinus communis]
 gb|EEF46378.1| hexokinase, putative [Ricinus communis]
Length=494

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 151/171 (88%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA LFGDT+P KLK+PFILRTPDMSAMH DTS+DLKVVGNKLKDILE
Sbjct  325  GEIIRRVLLKMAEEAALFGDTIPLKLKVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RKVVVE+C+IVATR ARL+AAGI+GILKK+G+D+ K G++ K +V+A+DGGL
Sbjct  385  ISNTSLKTRKVVVELCNIVATRGARLAAAGILGILKKMGKDTVKEGDTQK-TVIAMDGGL  443

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYL  212
            +EHY+++  CME+TL ELLGE   +S+ I HSNDGSGIGAALLAA+HS YL
Sbjct  444  YEHYSEYSKCMENTLNELLGEDVPKSIEIVHSNDGSGIGAALLAASHSLYL  494



>gb|AHY84734.1| hexokinase [Manihot esculenta]
Length=494

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL  MAEEA  FGDTVP KLKIPFILRTPDMSAMH DTS+DLKVVGNKLKDILE
Sbjct  325  GEIVRRVLLNMAEEAAFFGDTVPSKLKIPFILRTPDMSAMHHDTSSDLKVVGNKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN+SLK  +VVVE+C+IVATR A+L+AAGI+GILKK+G+D+ K G+ N R+V+A+DGGL
Sbjct  385  IPNTSLKAIRVVVELCNIVATRGAQLAAAGILGILKKMGKDTVKEGDKN-RTVIALDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            +EHY+++  CME TL ELLG E S+S+ I HSNDGSGIGAALLAA+HS Y
Sbjct  444  YEHYSEYSKCMEDTLNELLGEEVSKSIEIVHSNDGSGIGAALLAASHSHY  493



>ref|XP_006285258.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
 gb|EOA18156.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
Length=496

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGDTVP KL+IPFI+RTP MSA+H DTS DLK+VG+K+KDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDTVPSKLRIPFIIRTPHMSAIHNDTSPDLKIVGSKIKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +CDI+ATR ARLSAAGI GILKKLGRD+ K  E  ++SVVA+DGGL
Sbjct  384  VPTTSLKMRKVVISLCDIIATRGARLSAAGIYGILKKLGRDTNKE-EEMQKSVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT+F +CME +LKELLG EAS S+ + HSNDGSGIGAALLAA+HS YLE
Sbjct  443  FEHYTQFSECMERSLKELLGNEASGSIEVIHSNDGSGIGAALLAASHSLYLE  494



>gb|AAO24584.1| At2g19860 [Arabidopsis thaliana]
 dbj|BAE99655.1| hexokinase [Arabidopsis thaliana]
Length=502

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKLKIPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDIVPPKLKIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +  SSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GE+ K SV+A+DGGL
Sbjct  384  VQTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDATKDGEAQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHYT+F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE ++
Sbjct  443  FEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELED  497



>ref|NP_179576.1| hexokinase 2 [Arabidopsis thaliana]
 sp|P93834.1|HXK2_ARATH RecName: Full=Hexokinase-2 [Arabidopsis thaliana]
 gb|AAB49911.1| hexokinase 2 [Arabidopsis thaliana]
 gb|AAC62130.1| hexokinase (ATHXK2) [Arabidopsis thaliana]
 gb|AEC06934.1| hexokinase 2 [Arabidopsis thaliana]
Length=502

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGD VPPKLKIPFI+RTP+MSAMH DTS DLKVVG+KLKDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDIVPPKLKIPFIIRTPNMSAMHSDTSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +  SSLKMRKVV+ +C+I+A+R ARLSAAGI GILKK+GRD+ K GE+ K SV+A+DGGL
Sbjct  384  VQTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKKIGRDATKDGEAQK-SVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            FEHYT+F + M+S+LKELLG E SES+ +  SNDGSG+GAALLAA+HSQYLE ++
Sbjct  443  FEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGVGAALLAASHSQYLELED  497



>ref|XP_008778615.1| PREDICTED: hexokinase-2-like isoform X2 [Phoenix dactylifera]
Length=303

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRRVL KMAEEA LFGD+VPPKL+I FILRTP MSAMH DTS+DL+VVG KLK+IL 
Sbjct  126  GELVRRVLLKMAEEAALFGDSVPPKLEIQFILRTPVMSAMHHDTSSDLRVVGTKLKEILG  185

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA--GESNKRSVVAVDG  368
            I N+SLK RK+VVEVCDI+A R ARL+AAGI+GILKK GRD   A  G   +R+V+A+DG
Sbjct  186  ISNTSLKTRKLVVEVCDIIAKRGARLAAAGILGILKKQGRDGGAARDGGDMQRTVIAMDG  245

Query  367  GLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            GL+EHYT F +C+E+TL+E++G EA+ S+VI+ + DGSGIGA+LLAA+HSQYLE DES
Sbjct  246  GLYEHYTIFSNCLETTLREMIGEEAAASIVIKLATDGSGIGASLLAASHSQYLELDES  303



>ref|XP_010447886.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447887.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447888.1| PREDICTED: hexokinase-1 [Camelina sativa]
Length=496

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGDTVP KL+IPFI+RTP MSAMH DTS DLK+VG+K+KDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P +SLKMRKVV+ +CDI+ATR ARLSAAGI GILKKLGRD+  + E  ++SV+A+DGGL
Sbjct  384  VPTTSLKMRKVVISLCDIIATRGARLSAAGIYGILKKLGRDT-TSKEEVQKSVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHY +F +CMES+LKELLG EAS ++ + HSNDGSGIGAALLAA+HS YLE
Sbjct  443  FEHYKQFSECMESSLKELLGDEASGTIEVIHSNDGSGIGAALLAASHSLYLE  494



>ref|XP_004510315.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=495

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLCKMAEEA  FG+TVP KLK+PFILRTPDMSAMH DTSADL VV +KLK+I E
Sbjct  324  GEIVRRVLCKMAEEAFFFGETVPQKLKVPFILRTPDMSAMHHDTSADLNVVESKLKNIFE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SL +RK +VE+C+IVATR ARLSAAGI+GILKKLG+D+   GE NK +V+A+DGGL
Sbjct  384  ISNTSLVVRKAIVELCNIVATRGARLSAAGILGILKKLGKDTVSDGEGNK-NVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            +EHYT++R C+E+TLKEL+GE  S+S+V+EHSNDGSG GAALLAA+ S YL+ 
Sbjct  443  YEHYTEYRKCLENTLKELVGEDLSDSIVVEHSNDGSGTGAALLAASQSHYLDG  495



>ref|XP_010438337.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 148/174 (85%), Gaps = 3/174 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGDTVP KL+IPFI+RTP MSAMH DTS DLK+VG+K+KDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAG--ESNKRSVVAVDG  368
            +P +SLKMRKVV+ +CDI+ATR ARLSAAGI GILKKLGRD+      E  ++SV+A+DG
Sbjct  384  VPTTSLKMRKVVISLCDIIATRGARLSAAGIYGILKKLGRDTTSKDKEEEMQKSVIAMDG  443

Query  367  GLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            GLFEHY +F +CMES+LKELLG EAS ++ + HSNDGSGIGAALLAA+HS YLE
Sbjct  444  GLFEHYKQFSECMESSLKELLGDEASGTIEVIHSNDGSGIGAALLAASHSLYLE  497



>ref|XP_010433133.1| PREDICTED: hexokinase-1-like [Camelina sativa]
 ref|XP_010433134.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 148/174 (85%), Gaps = 3/174 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA  FGDTVP KL+IPFI+RTP MSAMH DTS DLK+VG+K+KDILE
Sbjct  324  GEILRRVLLKMAEEAAFFGDTVPSKLRIPFIIRTPHMSAMHNDTSPDLKIVGSKIKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAG--ESNKRSVVAVDG  368
            +P +SLKMRKVV+ +CDI+ATR ARLSAAGI GILKKLGRD+      E  ++SV+A+DG
Sbjct  384  VPTTSLKMRKVVISLCDIIATRGARLSAAGIYGILKKLGRDTTSKDKEEEVQKSVIAMDG  443

Query  367  GLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            GLFEHY +F +CMES+LKELLG EAS ++ + HSNDGSGIGAALLAA+HS YLE
Sbjct  444  GLFEHYKQFSECMESSLKELLGDEASGTIEVIHSNDGSGIGAALLAASHSLYLE  497



>ref|XP_010665886.1| PREDICTED: hexokinase-1-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=448

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGDT+PPKL IPFILRTPDMSAMH D+S DL++VG+ +KDILE
Sbjct  259  GEIVRRVLCRMAEEASFFGDTIPPKLHIPFILRTPDMSAMHHDSSPDLEIVGSTMKDILE  318

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IP  SLK RKV+ ++C IVATR ARL+AAGI GILK +GRD+  + +  ++SV+A+DGGL
Sbjct  319  IPMLSLKKRKVIYDLCKIVATRGARLAAAGISGILKIVGRDTLSSNDEKRKSVIAMDGGL  378

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY +FR C+E TLKELLG+   E + IEH+NDGSGIGAALLAA+HS+YLE +E+
Sbjct  379  YEHYEEFRKCLEHTLKELLGDKVWERISIEHANDGSGIGAALLAASHSRYLEDNET  434



>ref|XP_008778614.1| PREDICTED: hexokinase-2-like isoform X1 [Phoenix dactylifera]
Length=366

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRRVL KMAEEA LFGD+VPPKL+I FILRTP MSAMH DTS+DL+VVG KLK+IL 
Sbjct  189  GELVRRVLLKMAEEAALFGDSVPPKLEIQFILRTPVMSAMHHDTSSDLRVVGTKLKEILG  248

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA--GESNKRSVVAVDG  368
            I N+SLK RK+VVEVCDI+A R ARL+AAGI+GILKK GRD   A  G   +R+V+A+DG
Sbjct  249  ISNTSLKTRKLVVEVCDIIAKRGARLAAAGILGILKKQGRDGGAARDGGDMQRTVIAMDG  308

Query  367  GLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            GL+EHYT F +C+E+TL+E++G EA+ S+VI+ + DGSGIGA+LLAA+HSQYLE DES
Sbjct  309  GLYEHYTIFSNCLETTLREMIGEEAAASIVIKLATDGSGIGASLLAASHSQYLELDES  366



>ref|XP_003533038.1| PREDICTED: hexokinase-1-like isoform X1 [Glycine max]
 gb|KHN05328.1| Hexokinase-1 [Glycine soja]
Length=492

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 152/173 (88%), Gaps = 2/173 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLCK+AEEA  F D VPPKLKIPFIL TPDM AMH D+S DL VVG+KLK+ILE
Sbjct  321  GEIVRRVLCKIAEEAFFFADNVPPKLKIPFILSTPDMCAMHHDSSTDLNVVGSKLKNILE  380

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL++RKVVVE+C+I+ATR ARLSAAGI+GILKKLG+D+ K+    +++V+A+DGGL
Sbjct  381  ISDTSLEVRKVVVEICNIIATRGARLSAAGILGILKKLGKDT-KSEVEGQKNVIAMDGGL  439

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            +EHYT++  C+E+TLKEL+GE  SES++IEH NDGSG+GAALLAA+HSQYL+A
Sbjct  440  YEHYTEYSKCLENTLKELVGEDISESIIIEHFNDGSGVGAALLAASHSQYLDA  492



>gb|KDP40854.1| hypothetical protein JCGZ_24853 [Jatropha curcas]
Length=501

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 154/176 (88%), Gaps = 3/176 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MAEEA  FGD VPPKL++PFILRTPDMSAMH DTS+DLKVVGNKLKDILE
Sbjct  325  GEIVRRVLLRMAEEASFFGDAVPPKLRVPFILRTPDMSAMHHDTSSDLKVVGNKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RKVV+E+C+IVA+R A+L+AAGI+ ILKK+G+D+ K G+  K +V+A+DGGL
Sbjct  385  ISNTSLKTRKVVIELCNIVASRGAQLAAAGILSILKKMGKDTVKEGDKQK-TVIALDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY+++  CME+TL ELLG E S+++ I HSNDGSGIGAALLAA+HS+YL+ DE+
Sbjct  444  YEHYSEYSKCMENTLNELLGEEVSKNIEIVHSNDGSGIGAALLAASHSRYLK-DET  498



>ref|XP_010924444.1| PREDICTED: hexokinase-2-like isoform X2 [Elaeis guineensis]
Length=500

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA LFGD++PPKL++ FILRTPDMSAMH DTS+DL+VVG KLKDIL 
Sbjct  324  GEIVRRVLLKMAEEAALFGDSIPPKLEVQFILRTPDMSAMHHDTSSDLRVVGTKLKDILG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDS-WKAGESNKRSVVAVDGG  365
            I N+SLK RK+VV+VCDI+A R ARL+AAGI+G+LKK GRD+  + G   +R+V+A+DGG
Sbjct  384  ISNTSLKTRKLVVKVCDIIAKRGARLAAAGILGVLKKQGRDTALRDGSDMQRTVIAMDGG  443

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            L+EHYT F +C+E+TL+E+LG EA+ S+VI+ ++DGSGIGAALLAA+HSQYLE +ES
Sbjct  444  LYEHYTIFSNCLETTLREMLGEEATASIVIKLASDGSGIGAALLAASHSQYLELEES  500



>ref|NP_001233957.1| hexokinase [Solanum lycopersicum]
 emb|CAC81350.1| hexokinase [Solanum lycopersicum]
Length=498

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL ++AEEA +FGD VPPKLK PF+LRTPDMSAMH DTS+DLKVVG KLKDILE
Sbjct  324  GEILRRVLLRVAEEAGVFGDEVPPKLKEPFVLRTPDMSAMHHDTSSDLKVVGEKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VVE+C+IVATR ARL+AAG++GILKK+GRD+ K G S +R+V+A+DGGL
Sbjct  384  ISNTSLKTRKLVVELCNIVATRGARLAAAGVLGILKKMGRDTPKQGGS-ERTVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E++LK+LLGE  + S+V  HSNDGSGIGAALLAA+HS YLE
Sbjct  443  YEHYTEYRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLAASHSMYLE  494



>ref|XP_010665885.1| PREDICTED: hexokinase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVLC+MAEEA  FGDT+PPKL IPFILRTPDMSAMH D+S DL++VG+ +KDILE
Sbjct  324  GEIVRRVLCRMAEEASFFGDTIPPKLHIPFILRTPDMSAMHHDSSPDLEIVGSTMKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IP  SLK RKV+ ++C IVATR ARL+AAGI GILK +GRD+  + +  ++SV+A+DGGL
Sbjct  384  IPMLSLKKRKVIYDLCKIVATRGARLAAAGISGILKIVGRDTLSSNDEKRKSVIAMDGGL  443

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY +FR C+E TLKELLG+   E + IEH+NDGSGIGAALLAA+HS+YLE +E+
Sbjct  444  YEHYEEFRKCLEHTLKELLGDKVWERISIEHANDGSGIGAALLAASHSRYLEDNET  499



>ref|XP_010924442.1| PREDICTED: hexokinase-2-like isoform X1 [Elaeis guineensis]
Length=526

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA LFGD++PPKL++ FILRTPDMSAMH DTS+DL+VVG KLKDIL 
Sbjct  350  GEIVRRVLLKMAEEAALFGDSIPPKLEVQFILRTPDMSAMHHDTSSDLRVVGTKLKDILG  409

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDS-WKAGESNKRSVVAVDGG  365
            I N+SLK RK+VV+VCDI+A R ARL+AAGI+G+LKK GRD+  + G   +R+V+A+DGG
Sbjct  410  ISNTSLKTRKLVVKVCDIIAKRGARLAAAGILGVLKKQGRDTALRDGSDMQRTVIAMDGG  469

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            L+EHYT F +C+E+TL+E+LG EA+ S+VI+ ++DGSGIGAALLAA+HSQYLE +ES
Sbjct  470  LYEHYTIFSNCLETTLREMLGEEATASIVIKLASDGSGIGAALLAASHSQYLELEES  526



>gb|AAP40021.1| hexokinase [Nicotiana benthamiana]
Length=497

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA +FGD VPPKLK PF+LRTPDMSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMAEEAGIFGDEVPPKLKSPFVLRTPDMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE+C+IVATR ARL+AAG++GILKK+GRD+ + G   K  VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVELCNIVATRGARLAAAGVLGILKKMGRDTPRQGGPQKM-VVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHY ++R C+E+TLKELLG E + S+V EHSNDGSGIGAALLAA++S YLE
Sbjct  443  YEHYAEYRTCLENTLKELLGDELATSIVFEHSNDGSGIGAALLAASNSMYLE  494



>ref|XP_008795842.1| PREDICTED: hexokinase-2-like isoform X2 [Phoenix dactylifera]
Length=500

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MAEEA LFGD+VPP L++ FILRTPDMSAMH DTS+DL+VVG KLKDIL 
Sbjct  324  GEIVRRVLLRMAEEAALFGDSVPPNLEVQFILRTPDMSAMHHDTSSDLRVVGTKLKDILG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRD-SWKAGESNKRSVVAVDGG  365
            I N+SLK RK+VV+VCDI+A+R ARL+AAGI+G+LKK  RD + + G   +R+V+A+DGG
Sbjct  384  ISNTSLKTRKLVVKVCDIIASRGARLAAAGILGVLKKQDRDNAARDGSDMQRTVIAMDGG  443

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            L+EHYT+FR+C+E+TL+E+LG EA+ S+VI+ ++DGSGIGAALLAA+HSQYLE +ES
Sbjct  444  LYEHYTRFRNCLETTLREMLGEEAAPSIVIKLASDGSGIGAALLAASHSQYLELEES  500



>ref|XP_010915190.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=500

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRRVL KMAEEA LFGD+VPPKL+I FILRTPDMSAMH DTS+DL+VVG KLK+IL 
Sbjct  324  GELVRRVLLKMAEEAALFGDSVPPKLEIQFILRTPDMSAMHHDTSSDLRVVGTKLKEILG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDS-WKAGESNKRSVVAVDGG  365
            I N+SLK RK+VVEVCDI+A R ARL+AAGI+G+LKK GRDS  + G   +R+V+A+DGG
Sbjct  384  ISNTSLKTRKLVVEVCDIIAKRGARLAAAGILGVLKKQGRDSAARDGGEMQRTVIAMDGG  443

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            L+EHYT F +C+E+TLKE++G EA+ S+VI+ + DGSGIGAALLAA+HSQYLE +ES
Sbjct  444  LYEHYTIFSNCLETTLKEMIGEEAAASIVIKLATDGSGIGAALLAASHSQYLELEES  500



>ref|XP_003627048.1| Hexokinase [Medicago truncatula]
 gb|AET01524.1| hexokinase [Medicago truncatula]
Length=494

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA  FG+TVP KLK+PFILRTPDMSAMH D+SADL VV  KLK+ILE
Sbjct  323  GEIVRRVLYKMAEEAWFFGETVPSKLKVPFILRTPDMSAMHHDSSADLNVVKTKLKEILE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL++RKVVV +C+IVATR ARLSAAGIVGILKKLG+D+   GE  K +V+A+DGGL
Sbjct  383  ISDTSLEVRKVVVALCNIVATRGARLSAAGIVGILKKLGKDTITNGEGQK-NVIAMDGGL  441

Query  361  FEHYTKFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            +EHYT++R C+E+TLKELLGE  S+S+++EHSNDGSG GAALLAA+HS YL+ 
Sbjct  442  YEHYTEYRKCLENTLKELLGEGVSDSVIVEHSNDGSGTGAALLAASHSFYLDG  494



>gb|AFK48467.1| unknown [Lotus japonicus]
Length=182

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL +MAEEA+ FGDTVP KL+IPFILRTPD+SAMH DTS+DLKVVGNKLKD+LE
Sbjct  8    GDIVRRVLFRMAEEADFFGDTVPRKLRIPFILRTPDISAMHHDTSSDLKVVGNKLKDVLE  67

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRK+VV++CDI+A RAAR++AAG   ILKK+GRD+  AG+  K +V+++DGGL
Sbjct  68   IDNTSLKMRKIVVKLCDIIAIRAARVAAAGNFSILKKIGRDTVNAGKKQK-TVISLDGGL  126

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY KFR C+EST+KELLG + +E++ IEHSNDGSGIGAALLAA+HSQYL  ++S
Sbjct  127  FEHYNKFRTCLESTIKELLGDDGAETIGIEHSNDGSGIGAALLAASHSQYLAMEDS  182



>ref|XP_009352555.1| PREDICTED: hexokinase-1 [Pyrus x bretschneideri]
Length=498

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+EA+ FGD VPPKLKIPF+LRTPDMSA+H D+S DLKVVG+KLKDILE
Sbjct  324  GEIVRRVLLKMAQEADFFGDVVPPKLKIPFVLRTPDMSAIHHDSSPDLKVVGSKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKVVV VCD+VATR ARLSAAGI+G+LKKLGRD+ K GE  K SVVA+DGGL
Sbjct  384  ISNTSLKMRKVVVAVCDVVATRGARLSAAGILGVLKKLGRDTVKDGEKQK-SVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHYT+FR  ME TLKELLG E +E + +EHSNDGSGIGAALLAA+HSQY E +ES
Sbjct  443  YEHYTEFRTSMECTLKELLGDEVAEHISVEHSNDGSGIGAALLAASHSQYHEVEES  498



>ref|XP_008795834.1| PREDICTED: hexokinase-2-like isoform X1 [Phoenix dactylifera]
Length=526

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MAEEA LFGD+VPP L++ FILRTPDMSAMH DTS+DL+VVG KLKDIL 
Sbjct  350  GEIVRRVLLRMAEEAALFGDSVPPNLEVQFILRTPDMSAMHHDTSSDLRVVGTKLKDILG  409

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRD-SWKAGESNKRSVVAVDGG  365
            I N+SLK RK+VV+VCDI+A+R ARL+AAGI+G+LKK  RD + + G   +R+V+A+DGG
Sbjct  410  ISNTSLKTRKLVVKVCDIIASRGARLAAAGILGVLKKQDRDNAARDGSDMQRTVIAMDGG  469

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            L+EHYT+FR+C+E+TL+E+LG EA+ S+VI+ ++DGSGIGAALLAA+HSQYLE +ES
Sbjct  470  LYEHYTRFRNCLETTLREMLGEEAAPSIVIKLASDGSGIGAALLAASHSQYLELEES  526



>ref|XP_002283574.1| PREDICTED: hexokinase-2 [Vitis vinifera]
Length=498

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA  FG TVPPKLKIPFILRTPDMS+MH DTS +LKVVG K+K+IL 
Sbjct  324  GEILRRVLLRMAEEAAFFGATVPPKLKIPFILRTPDMSSMHHDTSVNLKVVGIKMKEILG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++ LKMRK+VV++C+IVATR ARL+AA I G+LKK+GRD+ + GE  K +V+A+DGGL
Sbjct  384  ISDTPLKMRKIVVQLCNIVATRGARLAAAAIFGVLKKMGRDTVRPGEKQK-TVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHY+++  C+E+TL+EL+GE  SESL IEH+NDGSGIGAALLAA+HSQY+  +ES
Sbjct  443  FEHYSEYSKCLENTLRELVGEQVSESLFIEHANDGSGIGAALLAASHSQYIGVEES  498



>dbj|BAP47497.1| hexokinase [Gentiana triflora]
Length=497

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR +L +MAEEA  FGDTVPPKL+ PFILR+PDMSAMH D S+DLKVV +KL+D+LE
Sbjct  323  GEIVRIILLRMAEEAAFFGDTVPPKLRTPFILRSPDMSAMHHDDSSDLKVVDSKLRDVLE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPNSSLK+RKV+V++CDIVA+R ARLSAAG VGILKKLGRD  +     + SV+A+DG L
Sbjct  383  IPNSSLKIRKVMVKLCDIVASRGARLSAAGTVGILKKLGRDKSRKEGEKQTSVIAIDGAL  442

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            FEHYTKFR C E TL+ELLG+  E++ +  S+DGSGIGAALLAA++SQY+  +ES
Sbjct  443  FEHYTKFRQCFEGTLEELLGDVYETISVVQSHDGSGIGAALLAASYSQYIGLEES  497



>gb|EYU21451.1| hypothetical protein MIMGU_mgv1a005070mg [Erythranthe guttata]
Length=498

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 153/172 (89%), Gaps = 3/172 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMA EA  FGD VPPKL+IPF+LRTPDMSA+H D+S+DL+VVG+KLKDILE
Sbjct  328  GEILRRVLLKMAVEASFFGDVVPPKLEIPFVLRTPDMSAIHNDSSSDLRVVGSKLKDILE  387

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R+V+VE+C+IVATR ARL+AAG++G+LKK+GRDS    E  +++V+A+DGGL
Sbjct  388  ISNTSLKTRRVIVELCNIVATRGARLAAAGVLGVLKKMGRDSLT--EGGEKTVIAMDGGL  445

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R+C+ESTL EL+G EA+ ++V+EHSNDGSGIGAALLAA++S YL+
Sbjct  446  YEHYTEYRECLESTLNELIGEEAAATIVVEHSNDGSGIGAALLAASNSLYLD  497



>ref|XP_009803252.1| PREDICTED: hexokinase-1 [Nicotiana sylvestris]
 gb|AAS60192.1| hexokinase 1a [Nicotiana tabacum]
Length=497

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL ++AE+A +FGD VPPKLK PF+LRTPDMSAMH D S+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRVAEDAGIFGDEVPPKLKSPFVLRTPDMSAMHHDISSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE+C+IVATR ARL+AAGI+GILKK+GRD+ + G   K +VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVELCNIVATRGARLAAAGILGILKKMGRDTPRQGGPEK-TVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E+TLKELLG E + S+V EHSNDGSGIGAALLAA++S YLE
Sbjct  443  YEHYTEYRTCLENTLKELLGDELATSIVFEHSNDGSGIGAALLAASNSMYLE  494



>emb|CBI36049.3| unnamed protein product [Vitis vinifera]
Length=448

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA  FG TVPPKLKIPFILRTPDMS+MH DTS +LKVVG K+K+IL 
Sbjct  263  GEILRRVLLRMAEEAAFFGATVPPKLKIPFILRTPDMSSMHHDTSVNLKVVGIKMKEILG  322

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++ LKMRK+VV++C+IVATR ARL+AA I G+LKK+GRD+ + GE  K +V+A+DGGL
Sbjct  323  ISDTPLKMRKIVVQLCNIVATRGARLAAAAIFGVLKKMGRDTVRPGEKQK-TVIAMDGGL  381

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYL  212
            FEHY+++  C+E+TL+EL+GE  SESL IEH+NDGSGIGAALLAA+HSQY+
Sbjct  382  FEHYSEYSKCLENTLRELVGEQVSESLFIEHANDGSGIGAALLAASHSQYI  432



>ref|XP_009606563.1| PREDICTED: hexokinase-1 [Nicotiana tomentosiformis]
Length=497

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL ++AEEA +FGD VPPKLK PF+LRTPDMSAMH D S+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRVAEEAGIFGDEVPPKLKSPFVLRTPDMSAMHHDASSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++V+E+C+IVATR ARL+AAG++GILKK+GRD+ + G   K +VVA+DGGL
Sbjct  384  ISNTSLKTRRLVIELCNIVATRGARLAAAGVLGILKKMGRDTPRQGGLEK-TVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E+TLKELLG E + S+V EHSNDGSGIGAALLAA++S YLE
Sbjct  443  YEHYTEYRTCLENTLKELLGDELATSIVFEHSNDGSGIGAALLAASNSMYLE  494



>gb|KJB35041.1| hypothetical protein B456_006G096800 [Gossypium raimondii]
Length=496

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI RRVLC+MA+EA  FGD VPPKLK PFIL TP MSAMH DTS DLKVV N LKDILE
Sbjct  324  GEIFRRVLCRMAKEA-FFGDIVPPKLKEPFILGTPVMSAMHHDTSPDLKVVANNLKDILE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLKMRKV+V++CDIVATR ARLSAAG++GILKK+GRD+ K GE  K +V+A+DGGL
Sbjct  383  ISNTSLKMRKVIVQLCDIVATRGARLSAAGLLGILKKMGRDTIKEGEKQK-TVIAMDGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY ++R+ +E+ LKELLG E  +++ IEHSNDGSGIGAALLAA+HSQYL+ DES
Sbjct  442  YEHYEEYRNSLENCLKELLGEEVFKTIKIEHSNDGSGIGAALLAASHSQYLK-DES  496



>ref|XP_006343033.1| PREDICTED: hexokinase-1-like [Solanum tuberosum]
Length=497

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL ++AEEA +FGD VPPKLK  F+LRTPDMSAMH DTS DLKVVG KLKDILE
Sbjct  324  GEILRRVLLRVAEEAGVFGDEVPPKLKDSFVLRTPDMSAMHHDTSPDLKVVGEKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VVE+C+IVATR ARL+AAG++GILKK+GRD+ K G S +R+V+A+DGGL
Sbjct  384  ISNTSLKTRKLVVELCNIVATRGARLAAAGVLGILKKMGRDTPKQGGS-ERTVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E++LK+LLGE  + S+V  HSNDGSGIGAALLAA+HS YLE
Sbjct  443  YEHYTEYRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLAASHSMYLE  494



>sp|Q9SEK2.1|HXK1_TOBAC RecName: Full=Hexokinase-1; AltName: Full=NtHxK1 [Nicotiana tabacum]
 gb|AAF18585.1|AF118133_1 chloroplast outer envelope hexokinase 1 [Nicotiana tabacum]
Length=497

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL ++AEEA +FGD VPPKLK PF+LRTPDMSAMH D S+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRVAEEAGIFGDEVPPKLKSPFVLRTPDMSAMHHDASSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++V+E+C+IVATR ARL+AAG++GILKK+GRD+ + G   K +VVA+DGGL
Sbjct  384  ISNTSLKTRRLVIELCNIVATRGARLAAAGVLGILKKMGRDTPRQGGLEK-TVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E+TLKELLG E + S+V EHSNDGSGIGAALLAA++S YLE
Sbjct  443  YEHYTEYRMCLENTLKELLGDELATSIVFEHSNDGSGIGAALLAASNSMYLE  494



>gb|AAT77515.1| hexokinase 7 [Nicotiana tabacum]
Length=497

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +++EEA +FGD VPPKLK  F+LRTPDMSAMH DTS DLKVVG KLKDILE
Sbjct  324  GEILRRVLLRVSEEAGVFGDEVPPKLKDSFVLRTPDMSAMHHDTSPDLKVVGEKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK RK+VVE+C+IVATR ARL+AAG++GILKK+GRD+ K G S +R+V+A+DGGL
Sbjct  384  ISNTSLKTRKLVVELCNIVATRGARLAAAGVLGILKKMGRDTPKQGGS-ERTVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E++LK+LLGE  + S+V  HSNDGSGIGAALLAA+HS YLE
Sbjct  443  YEHYTEYRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLAASHSMYLE  494



>emb|CDO97969.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 143/170 (84%), Gaps = 4/170 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA  FGD VPPKLK PF+LRTPDMSAMH DTSADL+VV NKLKDI E
Sbjct  324  GEILRRVLLRMAEEAAFFGDEVPPKLKTPFVLRTPDMSAMHHDTSADLRVVSNKLKDIFE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + N++LK R+ VVE+C+I+ATR ARL+AAGI G+LKK+G+D+    E   ++V+A+DGGL
Sbjct  384  VSNTTLKTRRAVVELCNIIATRGARLAAAGIFGVLKKMGKDTSTGAE---KTVIAMDGGL  440

Query  361  FEHYTKFRDCMESTLKELL-GEASESLVIEHSNDGSGIGaallaaAHSQY  215
            +EHYT++R C+E+TL ELL G+ S S+  EHSNDGSGIGAALLAA+HSQY
Sbjct  441  YEHYTEYRKCLENTLIELLGGDGSSSIAFEHSNDGSGIGAALLAASHSQY  490



>ref|XP_011000949.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=494

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA  FGD VPPKLKIPFILRTPD+SAMH DTS+DL VV  KLKDILE
Sbjct  325  GEIVRRVLLKMAEEAAFFGDIVPPKLKIPFILRTPDLSAMHHDTSSDLIVVDKKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + N+SL+ RKVVVE+C+IVATR +RL+AAGI+GILKK+GRD+ K  +  K +V+A+DGGL
Sbjct  385  VSNASLQTRKVVVELCNIVATRGSRLAAAGILGILKKIGRDTVKDMDEQK-TVIAMDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            FEHY+++  C+E+TL ELLG E S+++ IEH+NDGSG+GAALLAA+HS YL
Sbjct  444  FEHYSEYSKCLENTLNELLGEEVSKTISIEHANDGSGLGAALLAASHSLYL  494



>gb|EYU45835.1| hypothetical protein MIMGU_mgv1a005054mg [Erythranthe guttata]
Length=498

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MAEEA  FGD VPPKLKIPFILRTP+MSAMH+DTS+DL+VV  KLK+ILE
Sbjct  324  GEIVRRVLLRMAEEAFFFGDEVPPKLKIPFILRTPEMSAMHQDTSSDLRVVDEKLKNILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R+VVVE+C+I ATR ARL+AAGI G+LKK GRD  K  E  +++V+A+DGGL
Sbjct  384  ISNTSLKKRRVVVELCNIAATRGARLAAAGIFGVLKKTGRDIPK--EGGEKTVIAMDGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E+T+ EL+G E+S ++  EHSNDGSGIGAALLAA+HS YL+
Sbjct  442  YEHYTEYRKCLENTVGELIGDESSSAITFEHSNDGSGIGAALLAASHSLYLD  493



>ref|XP_002299739.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
 gb|EEE84544.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
Length=494

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA  FGD VPPKLKIPFILRTPD+SAMH D+S+DL +V  KLKDILE
Sbjct  325  GEIVRRVLLKMAEEAAFFGDIVPPKLKIPFILRTPDLSAMHHDSSSDLILVDKKLKDILE  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SL+ RKVVVE+C+IVATR +RL+AAGI+GILKK+GRD+ K  +  K +V+A+DGGL
Sbjct  385  ISNASLQTRKVVVELCNIVATRGSRLAAAGILGILKKIGRDTVKDMDEQK-TVIAMDGGL  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            FEHY+++  C+E+TL ELLG E S+++ IEH+NDGSG+GAALLAA+HS YL
Sbjct  444  FEHYSEYSKCLENTLNELLGEEVSKTISIEHANDGSGLGAALLAASHSLYL  494



>ref|XP_011072439.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=514

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMA+EA LFGDTVPPKLK P ILRTPDMSAMH D S+DL+VV + LKD+ E
Sbjct  328  GEILRRVLLKMAQEASLFGDTVPPKLKTPSILRTPDMSAMHHDQSSDLRVVASTLKDVFE  387

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R+VVVE+C+I+ATR ARL+AAGI G+LKK+GRD+ +  E   ++ +A+DGGL
Sbjct  388  ISNTSLKTRRVVVELCNIIATRGARLAAAGIFGVLKKMGRDTLR--EGGGKTAIAMDGGL  445

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            +EHYTK+R+C+E TL+ELLG E + ++V+EH+NDGSGIGAALLAA++S Y
Sbjct  446  YEHYTKYRECLEKTLQELLGTETAATIVVEHANDGSGIGAALLAASNSHY  495



>ref|XP_009406171.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 146/177 (82%), Gaps = 2/177 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+R VL ++A EA LFGD+VPPKL+ PFILRTP MSAMH D S DLKVVG KLK++L 
Sbjct  324  GEILRNVLLRLANEAALFGDSVPPKLETPFILRTPVMSAMHHDNSPDLKVVGTKLKELLG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDS-WKAGESNKRSVVAVDGG  365
            IPN+SLK RKVVV+ CDI+A R ARL+AAGIVGILKK+GRDS  K G    R+VVA+DGG
Sbjct  384  IPNTSLKTRKVVVQACDIIAKRGARLAAAGIVGILKKIGRDSAAKDGGDTPRTVVAIDGG  443

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            L+EHY  F +C+ ST+KE+LG EAS S+VI+ +NDGS IGAALLAA+HSQYL+ +ES
Sbjct  444  LYEHYNIFSECLRSTVKEMLGEEASASVVIKLANDGSSIGAALLAASHSQYLDVEES  500



>ref|XP_008789199.1| PREDICTED: hexokinase-2-like [Phoenix dactylifera]
Length=493

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 146/171 (85%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K+AEE  LFGDTVP KL+ PFILRTP+MSAMH D ++DL++VGNKL DIL 
Sbjct  320  GEIVRRVLVKLAEETSLFGDTVPSKLRTPFILRTPEMSAMHHDATSDLRIVGNKLNDILG  379

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++S++ RK+VVE+CDI+A R ARL+AAG+VG+LKK GRD+   G+  +R+VVA+DGGL
Sbjct  380  IASTSMETRKLVVEICDIIAKRGARLAAAGVVGVLKKQGRDAACGGK--QRTVVAMDGGL  437

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHY  F +C++ TL+ELLGEAS+S+VI+ +NDGSGIGAALLAA+HSQY E
Sbjct  438  FEHYKIFSECLDGTLRELLGEASQSVVIKLANDGSGIGAALLAASHSQYKE  488



>ref|XP_009415191.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 149/172 (87%), Gaps = 3/172 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL ++++EA  FGD+VPPKL++PFILRTP MSAMH DTSADLKVVG KL ++L 
Sbjct  325  GEILRRVLLRLSKEASFFGDSVPPKLEVPFILRTPVMSAMHHDTSADLKVVGKKLNEVLG  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IP++SLK RKVV+++CDI+A R ARL+AAGIVGILKK+GRD+  A +   R+V+A+DGGL
Sbjct  385  IPDTSLKTRKVVIQICDIIAKRGARLAAAGIVGILKKIGRDN--AVKDGGRTVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT F +C++ TLKE+LG EAS S+V++ ++DGSGIGAALLAA+HSQYL+
Sbjct  443  YEHYTIFSECLQCTLKEMLGEEASSSVVVKLASDGSGIGAALLAASHSQYLQ  494



>ref|XP_009777315.1| PREDICTED: hexokinase-2 [Nicotiana sylvestris]
Length=497

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA +FGD VPPKLK  FILRTP+MSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMAEEAAIFGDEVPPKLKNQFILRTPEMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE+C+IVATR ARL+AAG++GI+KK+GRD+ +     ++ VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVELCNIVATRGARLAAAGVLGIVKKMGRDTPRE-SGQEKIVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E+TL ELLG E + S+V EH+NDGSGIGAALLAA++S Y+E
Sbjct  443  YEHYTEYRKCLENTLVELLGEEMATSIVFEHANDGSGIGAALLAASNSLYVE  494



>ref|XP_009622660.1| PREDICTED: hexokinase-2 [Nicotiana tomentosiformis]
Length=497

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA +FGD VPPKLK  FILRTP+MSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMAEEAGIFGDEVPPKLKNQFILRTPEMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE+C+IVATR ARL+AAG++GI+KK+GRD+ +     ++ VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVELCNIVATRGARLAAAGVLGIVKKMGRDTPRE-SGQEKIVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E+TL ELLG E + S+V EH+NDGSGIGAALLAA++S Y+E
Sbjct  443  YEHYTEYRKCLENTLVELLGEEMATSIVFEHANDGSGIGAALLAASNSLYVE  494



>gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum]
Length=497

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +M+EEA +FGD VPPKLK  FILRTP+MSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMSEEAAIFGDEVPPKLKNQFILRTPEMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE+C+IVATR ARL+AAG++GI+KK+GRD+ +     ++ VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVELCNIVATRGARLAAAGVLGIVKKMGRDTPRE-SGQEKIVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++R C+E+TL ELLG E + S+V EH+NDGSGIGAALLAA++S Y+E
Sbjct  443  YEHYTEYRKCLENTLVELLGEEMATSIVFEHANDGSGIGAALLAASNSLYVE  494



>gb|KDO51804.1| hypothetical protein CISIN_1g0115052mg, partial [Citrus sinensis]
Length=294

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MA+EA  FGDTVPPKL++PF LRTPDMSAMH DTS+DLKVV  KLKDILE
Sbjct  122  GEIVRRVLLRMAQEAAFFGDTVPPKLEVPFALRTPDMSAMHHDTSSDLKVVETKLKDILE  181

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL MRK +VE+C+IVATR ARL+AAGI+G+LKK+GRD+ K G+  K +V+A+DGGL
Sbjct  182  ISSTSLSMRKTIVELCNIVATRGARLAAAGILGVLKKMGRDAAKDGDKQK-TVIAMDGGL  240

Query  361  FEHYTKFRDCMESTLKELLGEAS-ESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHY ++  C+E+TL+ELLGE   +++VIEHSNDGSGIGAALLAA+HS+YL+
Sbjct  241  YEHYAEYSKCLENTLEELLGEELFKNIVIEHSNDGSGIGAALLAASHSKYLQ  292



>ref|XP_010915379.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=507

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K+AEE  LFGDTVP KL+ PFILRTP+MSAMH D ++DL++VG+KL +IL 
Sbjct  324  GEIVRRVLLKLAEETYLFGDTVPSKLRTPFILRTPEMSAMHHDATSDLRIVGSKLNNILG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SLK RK+VV+ CDI+A R ARL+AAG+ G+LKK GRD+  AG   +R+VVA+DGGL
Sbjct  384  ITDTSLKTRKLVVKTCDIIAKRGARLAAAGVAGVLKKQGRDT--AGGGKQRTVVAMDGGL  441

Query  361  FEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHYT F   ++STL+ELLGEAS S+VI+ +NDGSGIGAALL A+HSQY E
Sbjct  442  FEHYTIFSKSLDSTLRELLGEASPSVVIKLANDGSGIGAALLGASHSQYKE  492



>gb|AEB00838.1| hexokinase 2 [Hordeum vulgare subsp. vulgare]
Length=472

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KM EEA LFGD +PPKLKIPFILRTP MS MH DTS DL+ VG KLKD+L 
Sbjct  300  GEIVRRVLLKMTEEASLFGDDIPPKLKIPFILRTPHMSMMHHDTSPDLRTVGAKLKDVLG  359

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I  +SLK R++VV VCDIVA R ARL+AAGI G+LKKLGRD         R+V+A+DGGL
Sbjct  360  IQGTSLKTRRLVVAVCDIVAKRGARLAAAGIHGVLKKLGRD--IPSSDKHRTVIAMDGGL  417

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            +EHYT F + +ESTL+E+LG E S S+VI+ +NDGSGIGAALLAAAHSQYLEA+
Sbjct  418  YEHYTIFSETLESTLREMLGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLEAE  471



>ref|XP_009394175.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL ++A +  LFGD VPP+L+IPF+LRTP MSAMH DTSADLKVVG KLK+ L 
Sbjct  324  GEIVRRVLLRLAVQTALFGDNVPPQLEIPFVLRTPVMSAMHHDTSADLKVVGAKLKEFLG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SLK RKVVV++CD+VA R ARL+AAGIVGILKKLGRD    G   +R+V+A+DGGL
Sbjct  384  ISSTSLKARKVVVQICDVVAKRGARLAAAGIVGILKKLGRD----GSGMRRTVIAMDGGL  439

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT FR+C+   L E+LG EAS S+V+  +NDGSG+GA+LLAA+HS+YLE
Sbjct  440  YEHYTVFRECLHGALNEMLGDEASSSVVVNLTNDGSGLGASLLAASHSRYLE  491



>dbj|BAJ89593.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KM EEA LFGD +PPKLKIPFILRTP MS MH DTS DL+ VG KLKD+L 
Sbjct  323  GEIVRRVLLKMTEEASLFGDDIPPKLKIPFILRTPHMSMMHHDTSPDLRTVGAKLKDVLG  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I  +SLK R++VV VCDIVA R ARL+AAGI G+LKKLGRD         R+V+A+DGGL
Sbjct  383  IQGTSLKTRRLVVAVCDIVAKRGARLAAAGIHGVLKKLGRDI--PSSDKHRTVIAMDGGL  440

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            +EHYT F + +ESTL+E+LG E S S+VI+ +NDGSGIGAALLAAAHSQYLEA+
Sbjct  441  YEHYTIFSETLESTLREMLGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLEAE  494



>ref|XP_009392524.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL ++A+EA LFGD+VPPKL+IPF+LRTP MSAMH DTS DLKVVG KLKD+L 
Sbjct  324  GEILRRVLLRLAKEASLFGDSVPPKLEIPFMLRTPVMSAMHHDTSPDLKVVGAKLKDLLG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSW-KAGESNKRSVVAVDGG  365
            IPN+SLK RKVVV++CDIVA R ARL+AAG+ GILKK+GRD+  K GES  R+VVA+DGG
Sbjct  384  IPNTSLKARKVVVQICDIVARRGARLAAAGVAGILKKVGRDTAVKGGESVPRTVVAMDGG  443

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            L+EHYT FR+C+++T +E+LG EA+ S+VI+ +NDGSGIGAALLAA+HSQY E ++S
Sbjct  444  LYEHYTIFRECLQATFEEMLGAEAAASVVIKLANDGSGIGAALLAASHSQYRELEQS  500



>ref|XP_010231125.1| PREDICTED: hexokinase-2 isoform X2 [Brachypodium distachyon]
Length=417

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 142/175 (81%), Gaps = 3/175 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L KM +EA LFGD +PPKLKIP+IL TP MS MH D S+DL+ VG +L+DIL 
Sbjct  244  GEIVRRILLKMTQEASLFGDDIPPKLKIPYILTTPHMSMMHHDGSSDLRTVGAQLRDILG  303

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VV VCDIVA R +RL+AAGI GILKKLGRD        +R+V+A+DGGL
Sbjct  304  IQNTSLKTRRLVVAVCDIVAKRGSRLAAAGIHGILKKLGRDI--PSSDKQRTVIAMDGGL  361

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYT F + +ESTL+E+LG E S S+VI+ +NDGSGIGAALLAAAHSQYL+A+E
Sbjct  362  YEHYTIFSESLESTLQEILGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLDAEE  416



>gb|AAT77513.1| hexokinase 3 [Nicotiana sylvestris]
Length=496

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA +FG+ VPPKLK  FILRTP+MSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMAEEAGIFGEEVPPKLKNSFILRTPEMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE+C+IVATR ARL+AAGI+GI+KK+G+D+ +  +  K  VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVELCNIVATRGARLAAAGILGIIKKMGKDTPRESDPEK-IVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++  C+E+TL ELLG E + S+V +H+NDGSGIGAALLAA++S Y+E
Sbjct  443  YEHYTEYSKCLENTLVELLGKEMATSIVFKHANDGSGIGAALLAASNSVYVE  494



>ref|NP_001274841.1| hexokinase-2 [Solanum tuberosum]
 sp|Q9SQ76.1|HXK2_SOLTU RecName: Full=Hexokinase-2; AltName: Full=StHK2 [Solanum tuberosum]
 gb|AAF14186.1| hexokinase 2 [Solanum tuberosum]
Length=496

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 147/172 (85%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA +FG+ VPPKLK  FILRTP+MSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMAEEAGIFGEEVPPKLKNSFILRTPEMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NSSLK R++VVE+C+IVATR ARL+AAGI+GI+KK+G+D+ +     K  VVA+DGGL
Sbjct  384  ISNSSLKTRRLVVELCNIVATRGARLAAAGILGIIKKMGKDTPRESGPEK-IVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++  C+E+TL ELLG E + S+V +H+NDGSGIGAALLAA++S Y+E
Sbjct  443  YEHYTEYSKCLENTLVELLGKEMATSIVFKHANDGSGIGAALLAASNSVYVE  494



>ref|XP_004969912.1| PREDICTED: hexokinase-6-like [Setaria italica]
Length=505

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VPPKL+  F+LRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  332  GEIVRRILLKLAHDASLFGDVVPPKLEQLFVLRTPDMSAMHHDTSHDLKHLGAKLKDILG  391

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P++SL+ R + + VCD+VA R ARL+AAGI GILKKLG+D      S +R+VVA+DGGL
Sbjct  392  VPDTSLEARYITLHVCDLVAERGARLAAAGIYGILKKLGKDKLPNDFSQQRTVVAMDGGL  451

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            +EHY KF  C+E+TL +LLG EA+ S+V++ +NDGSGIGAALLAA+HSQY EA
Sbjct  452  YEHYKKFSACLEATLTDLLGEEAASSVVVKLANDGSGIGAALLAASHSQYAEA  504



>gb|ABA01010.1| hexokinase [Solanum chacoense]
Length=496

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 147/172 (85%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA +FG+ VPPKLK  FILRTP+MSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMAEEAGIFGEEVPPKLKNSFILRTPEMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE+C+IVATR ARL+AAGI+GI+KK+G+D+ +     K  VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVELCNIVATRGARLAAAGILGIIKKMGKDTPRESGPEK-IVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++  C+E+TL ELLG E + S+V +H+NDGSGIGAALLAA++S Y+E
Sbjct  443  YEHYTEYSKCLENTLVELLGKEMATSIVFKHANDGSGIGAALLAASNSVYVE  494



>ref|XP_006465701.1| PREDICTED: hexokinase-1-like [Citrus sinensis]
Length=496

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MA+EA  FGDTVPPKL++PF LRTPDMSAMH DTS+DLKVV  KLKDILE
Sbjct  324  GEIVRRVLLRMAQEAAFFGDTVPPKLEVPFALRTPDMSAMHHDTSSDLKVVETKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL MRK +VE+C+IVATR ARL+AAGI+G+LKK+GRD+ K G+  K +V+A+DGGL
Sbjct  384  ISSTSLSMRKTIVELCNIVATRGARLAAAGILGVLKKMGRDAAKDGDKQK-TVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEAS-ESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHY ++  C+E+TL+ELLGE   +++VIEHSNDGSGIGAALLAA+HS+YL+
Sbjct  443  YEHYAEYSKCLENTLEELLGEELFKNIVIEHSNDGSGIGAALLAASHSKYLQ  494



>ref|XP_006426867.1| hypothetical protein CICLE_v10025452mg [Citrus clementina]
 gb|ESR40107.1| hypothetical protein CICLE_v10025452mg [Citrus clementina]
Length=496

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MA+EA  FGDTVPPKL++PF LRTPDMSAMH DTS+DLKVV  KLKDILE
Sbjct  324  GEIVRRVLLRMAQEAAFFGDTVPPKLEVPFALRTPDMSAMHHDTSSDLKVVETKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL MRK +VE+C+IVATR ARL+AAGI+G+LKK+GRD+ K G+  K +V+A+DGGL
Sbjct  384  ISSTSLSMRKTIVELCNIVATRGARLAAAGILGVLKKMGRDAAKDGDKQK-TVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGEAS-ESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHY ++  C+E+TL+ELLGE   +++VIEHSNDGSGIGAALLAA+HS+YL+
Sbjct  443  YEHYAEYSKCLENTLEELLGEELFKNIVIEHSNDGSGIGAALLAASHSKYLQ  494



>ref|XP_003568034.1| PREDICTED: hexokinase-2 isoform X1 [Brachypodium distachyon]
Length=494

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 142/175 (81%), Gaps = 3/175 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L KM +EA LFGD +PPKLKIP+IL TP MS MH D S+DL+ VG +L+DIL 
Sbjct  321  GEIVRRILLKMTQEASLFGDDIPPKLKIPYILTTPHMSMMHHDGSSDLRTVGAQLRDILG  380

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VV VCDIVA R +RL+AAGI GILKKLGRD        +R+V+A+DGGL
Sbjct  381  IQNTSLKTRRLVVAVCDIVAKRGSRLAAAGIHGILKKLGRDI--PSSDKQRTVIAMDGGL  438

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYT F + +ESTL+E+LG E S S+VI+ +NDGSGIGAALLAAAHSQYL+A+E
Sbjct  439  YEHYTIFSESLESTLQEILGEEVSSSVVIKLANDGSGIGAALLAAAHSQYLDAEE  493



>dbj|BAJ93240.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEB00841.1| hexokinase 5 [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL++PF+LRTPDMSAMH D S DLK++G+KLKDI+ 
Sbjct  333  GEIVRRILLKLAHDAALFGDVVPAKLELPFVLRTPDMSAMHHDASHDLKILGSKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL++R +   +CDIVA R ARL+AAGI GILKKLGRD   A G    R+VVA+DGG
Sbjct  393  VADTSLEVRYITRHICDIVAERGARLAAAGIYGILKKLGRDKVPADGSPMPRTVVALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+E+TL +LLG EAS SLV + +NDGSGIGAALLAA+HSQY E D
Sbjct  453  LYEHYKKFSSCLEATLSDLLGEEASSSLVAKLANDGSGIGAALLAASHSQYAEVD  507



>ref|XP_006654666.1| PREDICTED: hexokinase-5-like [Oryza brachyantha]
Length=437

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VPPKL+ PF+LRTPDMSAMH D+S DLK VG KLKDI+ 
Sbjct  263  GEIVRRILLKLAHDAALFGDVVPPKLEQPFVLRTPDMSAMHHDSSHDLKTVGAKLKDIVG  322

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL++R +   +CDIVA R ARL+AAGI GILKKLGRD     G    R+V+A+DGG
Sbjct  323  VADTSLEVRYITSHICDIVAERGARLAAAGIYGILKKLGRDKLPGDGSKMPRTVIALDGG  382

Query  364  LFEHYTKFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+ESTL +LLG+A + S+V + +NDGSGIGAALLAA+HSQY E D
Sbjct  383  LYEHYKKFSSCLESTLTDLLGDAVASSVVTKLANDGSGIGAALLAASHSQYAEID  437



>ref|XP_010322313.1| PREDICTED: hexokinase isoform X1 [Solanum lycopersicum]
Length=496

 Score =   215 bits (548),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 147/172 (85%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MA+EA +FG+ VPPKLK  FILRTP+MSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMAKEAGIFGEEVPPKLKNSFILRTPEMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE+C+IVATR ARL+AAGI+GI+KK+G+D+ +     K  VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVELCNIVATRGARLAAAGILGIIKKMGKDTPRESGPEK-IVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++  C+E+TL ELLG E + S+V +H+NDGSGIGAALLAA++S Y+E
Sbjct  443  YEHYTEYSKCLENTLVELLGKEMATSIVFKHANDGSGIGAALLAASNSVYVE  494



>ref|XP_003568072.1| PREDICTED: LOW QUALITY PROTEIN: hexokinase-5-like [Brachypodium 
distachyon]
Length=506

 Score =   215 bits (548),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VPPKL+ PF+LRTPDMSAMH D S DLKV+G KLKDI+ 
Sbjct  332  GEIVRRILLKLAHDASLFGDVVPPKLEQPFVLRTPDMSAMHHDASHDLKVLGTKLKDIVG  391

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL++R +   +CDIVA R ARL+AAGI GILKKLGRD   + G    R+V+A+DGG
Sbjct  392  VADTSLEVRYITRHICDIVAERGARLAAAGIXGILKKLGRDKVPSDGSPMPRTVIALDGG  451

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY E D
Sbjct  452  LYEHYKKFSSCLEATLADLLGEEASSSMVAKLANDGSGIGAALLAASHSQYAEVD  506



>emb|CAN74362.1| hypothetical protein VITISV_016381 [Vitis vinifera]
Length=533

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MAEEA  FG TVPPKLKIPFILRTPDMS+MH DTS +LKVVG K+K+IL 
Sbjct  324  GEILRRVLLRMAEEAAFFGATVPPKLKIPFILRTPDMSSMHHDTSVNLKVVGIKMKEILG  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++ LKMRK+VV++C+IVATR ARL+AA I G+LKK+GRD+ + GE  K +V+A+DGGL
Sbjct  384  ISDTPLKMRKIVVQLCNIVATRGARLAAAAIFGVLKKMGRDTVRPGEKQK-TVIAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDG  260
            FEHY+++  C+E+TL+EL+GE  SESL IEH+NDG
Sbjct  443  FEHYSEYSKCLENTLRELVGEQVSESLFIEHANDG  477



>ref|NP_001234406.1| hexokinase [Solanum lycopersicum]
 gb|AAG35735.1|AF208543_1 hexokinase [Solanum lycopersicum]
Length=496

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 146/172 (85%), Gaps = 2/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL +MA+EA +FG+ VPPKLK  FILRTP+MSAMH DTS+DL+VVG+KLKDILE
Sbjct  324  GEILRRVLLRMAKEAGIFGEEVPPKLKNSFILRTPEMSAMHHDTSSDLRVVGDKLKDILE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+SLK R++VVE C+IVATR ARL+AAGI+GI+KK+G+D+ +     K  VVA+DGGL
Sbjct  384  ISNTSLKTRRLVVEXCNIVATRGARLAAAGILGIIKKMGKDTPRESGPEK-IVVAMDGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHYT++  C+E+TL ELLG E + S+V +H+NDGSGIGAALLAA++S Y+E
Sbjct  443  YEHYTEYSKCLENTLVELLGKEMATSIVFKHANDGSGIGAALLAASNSVYVE  494



>gb|KCW79624.1| hypothetical protein EUGRSUZ_C00983 [Eucalyptus grandis]
Length=456

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR  L +MAEE+ LFGD +P KLKIPFILRTPDMSAMH DTS DL VVG KL D+LE
Sbjct  285  GEIVRIALLRMAEESALFGD-IPLKLKIPFILRTPDMSAMHHDTSPDLTVVGKKLSDVLE  343

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RKVVV++CDIV TRAARL+AAGI GILKKLGRD+ + GE  +RSV+A+DGGL
Sbjct  344  ISDTSLRTRKVVVDLCDIVTTRAARLAAAGIFGILKKLGRDTLRDGE-KQRSVIALDGGL  402

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            FEHY KFR+C+E+TL+ELLG E +ES +I  SNDGSGIGAALLAA+HSQYL
Sbjct  403  FEHYAKFRNCVEATLRELLGPEVAESTLIVLSNDGSGIGAALLAASHSQYL  453



>gb|EMT08969.1| Hexokinase-5 [Aegilops tauschii]
Length=410

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL++PF+LRTPDMSAMH D S DLK++G+KLKDI+ 
Sbjct  236  GEIVRRILLKLAHDAALFGDVVPAKLEMPFVLRTPDMSAMHHDASHDLKILGSKLKDIVG  295

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSW-KAGESNKRSVVAVDGG  365
            + ++SL++R +   +CDIVA R ARL+AAGI GILKKLGRD   + G    R+VVA+DGG
Sbjct  296  VADTSLEVRYITRHICDIVAERGARLAAAGIYGILKKLGRDKVPRDGSPMPRTVVALDGG  355

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KF  C+E+TL +LLG EAS SLV + +NDGSGIGAALLAA+HSQY
Sbjct  356  LYEHYKKFSSCLEATLSDLLGDEASSSLVAKLANDGSGIGAALLAASHSQY  406



>gb|EMS55979.1| Hexokinase-5 [Triticum urartu]
Length=410

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL++PF+LRTPDMSAMH D S DLK++G+KLKDI+ 
Sbjct  236  GEIVRRILLKLAHDAALFGDVVPAKLELPFVLRTPDMSAMHHDASHDLKILGSKLKDIVG  295

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL++R +   +CDIVA R ARL+AAGI GILKKLGRD     G    R+VVA+DGG
Sbjct  296  VADTSLEVRYITRHICDIVAERGARLAAAGIYGILKKLGRDKVPTDGSPIPRTVVALDGG  355

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KF  C+E+TL +LLG EAS SLV + +NDGSGIGAALLAA+HSQY
Sbjct  356  LYEHYKKFSSCLEATLSDLLGDEASSSLVAKLANDGSGIGAALLAASHSQY  406



>ref|XP_010047252.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
 gb|KCW79118.1| hypothetical protein EUGRSUZ_C00559 [Eucalyptus grandis]
Length=508

 Score =   213 bits (542),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 148/172 (86%), Gaps = 3/172 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR  L +MAEE+ LFGD +P KLKIPFILRTPDMSAMH DTS DL VVG KL D+LE
Sbjct  337  GEIVRIALLRMAEESALFGD-IPLKLKIPFILRTPDMSAMHHDTSPDLTVVGKKLSDVLE  395

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RKVVV++C+IVATRAARL+AAGI GILKKLGRD+ + GE  +RSV+A+DGGL
Sbjct  396  ISDTSLRTRKVVVDLCNIVATRAARLAAAGIFGILKKLGRDTLRDGE-KQRSVIALDGGL  454

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            FEHY KFR+C+E+TL+ELLG E +E+ VI  SNDGSGIGAALLAA+HSQYLE
Sbjct  455  FEHYAKFRNCVEATLRELLGPEVAENTVIVLSNDGSGIGAALLAASHSQYLE  506



>ref|XP_010047667.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=510

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVR  L +MAEE+ LFGD +P KLKIPFILRTPDMSAMH DTS DL VVG KL D+LE
Sbjct  339  GEIVRIALLRMAEESALFGD-IPLKLKIPFILRTPDMSAMHHDTSPDLTVVGKKLSDVLE  397

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RKVVV++CDIV TRAARL+AAGI GILKKLGRD+ + GE  +RSV+A+DGGL
Sbjct  398  ISDTSLRTRKVVVDLCDIVTTRAARLAAAGIFGILKKLGRDTLRDGE-KQRSVIALDGGL  456

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            FEHY KFR+C+E+TL+ELLG E +ES +I  SNDGSGIGAALLAA+HSQYL
Sbjct  457  FEHYAKFRNCVEATLRELLGPEVAESTLIVLSNDGSGIGAALLAASHSQYL  507



>gb|EAZ13494.1| hypothetical protein OsJ_03410 [Oryza sativa Japonica Group]
Length=462

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+  FILRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  288  GEIVRRILLKLAHDASLFGDVVPTKLEQRFILRTPDMSAMHHDTSHDLKHLGAKLKDILG  347

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL+ R + + VCD+VA R ARL+AAGI GILKKLGRD   + G   +R+V+A+DGG
Sbjct  348  VADTSLEARYITLHVCDLVAERGARLAAAGIYGILKKLGRDRVPSDGSQKQRTVIALDGG  407

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KFR C+E+TL +LLG EA+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  408  LYEHYKKFRTCLEATLADLLGEEAASSVVVKLANDGSGIGAALLAASHSQY  458



>ref|XP_006646311.1| PREDICTED: hexokinase-6-like [Oryza brachyantha]
Length=513

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VPPKL+  F+LRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  339  GEIVRRILLKLAHDASLFGDVVPPKLEQRFVLRTPDMSAMHHDTSHDLKHLGAKLKDILG  398

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL+ R + + VCD+VA R A L+AAGI GILKKLGRDS  + G   +R+V+A+DGG
Sbjct  399  VADTSLEARYITLHVCDLVAERGAHLAAAGIYGILKKLGRDSVPSDGSQKQRTVIALDGG  458

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KFR C+E+TL +LLG +A+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  459  LYEHYKKFRTCLEATLTDLLGDDAASSVVVKLANDGSGIGAALLAASHSQY  509



>ref|XP_011080413.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=489

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE++RRVL +MA EA  FGD VP KLK PFIL TPDMSAMH+DTS+DL+ V NKL+ +LE
Sbjct  323  GEVLRRVLLRMATEASFFGDEVPSKLKDPFILSTPDMSAMHQDTSSDLREVDNKLRTVLE  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I N+ LK R+VVVE+C+IVATR ARL+AAGI+GILKK+GRD+ +  E ++++ +A+DGGL
Sbjct  383  IRNTPLKTRRVVVELCNIVATRGARLAAAGILGILKKMGRDTPQ--EGDRKTGIAIDGGL  440

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIG  248
            +EHYT++R C+E+T+ +LLGE  + S+V EHS DGSGIG
Sbjct  441  YEHYTEYRKCLENTVGQLLGEKTASSIVFEHSTDGSGIG  479



>ref|NP_001044214.1| Os01g0742500 [Oryza sativa Japonica Group]
 sp|Q8LQ68.1|HXK6_ORYSJ RecName: Full=Hexokinase-6; AltName: Full=Hexokinase-2 [Oryza 
sativa Japonica Group]
 dbj|BAB91930.1| putative hexokinase [Oryza sativa Japonica Group]
 gb|AAX68418.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|AAZ93623.1| hexokinase 6 [Oryza sativa Japonica Group]
 dbj|BAF06128.1| Os01g0742500 [Oryza sativa Japonica Group]
 gb|EAY75775.1| hypothetical protein OsI_03691 [Oryza sativa Indica Group]
 dbj|BAG89607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=506

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+  FILRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  332  GEIVRRILLKLAHDASLFGDVVPTKLEQRFILRTPDMSAMHHDTSHDLKHLGAKLKDILG  391

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL+ R + + VCD+VA R ARL+AAGI GILKKLGRD   + G   +R+V+A+DGG
Sbjct  392  VADTSLEARYITLHVCDLVAERGARLAAAGIYGILKKLGRDRVPSDGSQKQRTVIALDGG  451

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KFR C+E+TL +LLG EA+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  452  LYEHYKKFRTCLEATLADLLGEEAASSVVVKLANDGSGIGAALLAASHSQY  502



>ref|XP_004961448.1| PREDICTED: hexokinase-5-like [Setaria italica]
Length=507

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+ PF+LRTPDMSAMH D+S DLK++G KLKDI+ 
Sbjct  333  GEIVRRILLKLAHDASLFGDVVPSKLEQPFVLRTPDMSAMHHDSSHDLKILGAKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL++R +   +CD+VA R ARL+AAGI  ILKK+GRD   + G    R+V+A+DGG
Sbjct  393  VADTSLEVRYITRHICDLVAERGARLAAAGIYSILKKIGRDKVPSNGSKMPRTVIALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY EAD
Sbjct  453  LYEHYKKFSSCVETTLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYAEAD  507



>sp|Q2KNB9.1|HXK2_ORYSJ RecName: Full=Hexokinase-2; AltName: Full=Hexokinase-3 [Oryza 
sativa Japonica Group]
 gb|AAX68419.1| hexokinase 3 [Oryza sativa Japonica Group]
 gb|AAZ93619.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|EEE64471.1| hypothetical protein OsJ_19321 [Oryza sativa Japonica Group]
Length=494

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA LFGD VPPKLKIPFI+RTP MS MH D S DL+ VG KLKDIL 
Sbjct  321  GEIVRRVLLKMAEEASLFGDEVPPKLKIPFIIRTPYMSMMHCDRSPDLRTVGAKLKDILG  380

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + N+SLK R++VV+VCDIVA RAA L+AAGI GILKKLGRD        +R+V+AVDGGL
Sbjct  381  VQNTSLKTRRLVVDVCDIVAKRAAHLAAAGIHGILKKLGRDV--PNTDKQRTVIAVDGGL  438

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYT F +C+ESTL+++LGE  S ++VI+ + DGSGIGAALLAAAHSQY EA+E
Sbjct  439  YEHYTIFAECVESTLRDMLGEDVSSTIVIKLAKDGSGIGAALLAAAHSQYREAEE  493



>gb|AFW78822.1| hexokinase-2 [Zea mays]
Length=507

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+ PFILRTPDMSAMH D+S DLK +G+KLKDI+ 
Sbjct  333  GEIVRRILLKLAHDASLFGDVVPTKLEQPFILRTPDMSAMHHDSSHDLKTLGSKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSW-KAGESNKRSVVAVDGG  365
            + ++SL++R +   +CD+VA R ARL+AAGI  ILKK+GRD    +G    R+V+A+DGG
Sbjct  393  VADTSLEVRYITRHICDLVAERGARLAAAGIYSILKKIGRDKVPSSGSKMPRTVIALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY E+D
Sbjct  453  LYEHYKKFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYGESD  507



>sp|O64390.1|HXK1_SOLTU RecName: Full=Hexokinase-1; AltName: Full=StHK1 [Solanum tuberosum]
 emb|CAA63966.1| hexokinase [Solanum tuberosum]
Length=498

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 139/173 (80%), Gaps = 3/173 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELF-GDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDIL  545
            GEI+RRVL ++AEE   F        LK  F+LRTPDMSAMH DTS DLKVVG KLKDIL
Sbjct  324  GEILRRVLTRVAEEVLAFLAMRSLQSLKDSFVLRTPDMSAMHHDTSPDLKVVGEKLKDIL  383

Query  544  EIPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGG  365
            EI N+SLK RK+V+ +C+IVATR ARL AAG++GILKK+GRD+ K G S +R+V+A+DGG
Sbjct  384  EISNTSLKTRKLVLSLCNIVATRGARLDAAGVLGILKKMGRDTPKQGGS-ERTVIAMDGG  442

Query  364  LFEHYTKFRDCMESTLKELLGEA-SESLVIEHSNDGSGIGaallaaAHSQYLE  209
            L+EHYT++R C+E++LK+LLGE  + S+V  HSNDGSGIGAALL A+HS YLE
Sbjct  443  LYEHYTEYRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLRASHSMYLE  495



>gb|ACG44289.1| hexokinase-2 [Zea mays]
Length=507

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+ PFILRTPDMSAMH D+S DLK +G+KLKDI+ 
Sbjct  333  GEIVRRILLKLAHDASLFGDVVPTKLEQPFILRTPDMSAMHHDSSHDLKTLGSKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSW-KAGESNKRSVVAVDGG  365
            + ++SL++R +   +CD+VA R ARL+AAGI  ILKK+GRD    +G    R+V+A+DGG
Sbjct  393  VADTSLEVRYITRHICDLVAERGARLAAAGIYSILKKIGRDKVPSSGSKMPRTVIALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY ++D
Sbjct  453  LYEHYKKFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYGKSD  507



>ref|NP_001123599.1| hexokinase2 [Zea mays]
 gb|ACD93189.1| hexokinase [Zea mays]
Length=507

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+ PFILRTPDMSAMH D+S DLK +G+KLKDI+ 
Sbjct  333  GEIVRRILLKLAHDASLFGDVVPTKLEQPFILRTPDMSAMHHDSSHDLKTLGSKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSW-KAGESNKRSVVAVDGG  365
            + ++SL++R +   +CD+VA R ARL+AAGI  ILKK+GRD    +G    R+V+A+DGG
Sbjct  393  VADTSLEVRYITRHICDLVAERGARLAAAGIYSILKKIGRDKVPSSGSKMPRTVIALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY  +D
Sbjct  453  LYEHYKKFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYGASD  507



>ref|XP_003569773.1| PREDICTED: hexokinase-6 [Brachypodium distachyon]
Length=505

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VPPKL+  F LRTPDMSAMH DTS DL+ + +KLKDIL 
Sbjct  331  GEIVRRILLKLAHDASLFGDVVPPKLEHLFALRTPDMSAMHHDTSHDLRFMLSKLKDILG  390

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + + SL+ R + + +CD VA R ARL+AAGI GILKKLGRD   + G   KR+VVAVDGG
Sbjct  391  VADISLEARYITLHICDKVAERGARLAAAGIYGILKKLGRDRVPSDGSPKKRTVVAVDGG  450

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            LFEHY KF  C+E+TL +LLG EA+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  451  LFEHYKKFSSCVEATLADLLGKEAASSVVVKMANDGSGIGAALLAASHSQY  501



>dbj|BAK06520.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 136/171 (80%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRR+L ++A +A LFGD VPPKL+  F+LRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  335  GEVVRRILLRLAHDASLFGDVVPPKLEKLFVLRTPDMSAMHHDTSHDLKHLGAKLKDILG  394

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL+ R + + VCD VA R ARL+AAGI GILKKLGRD   + G   +R+VVA+DGG
Sbjct  395  VADTSLEARYITLHVCDKVAERGARLAAAGIYGILKKLGRDRAPSHGSPKQRTVVAIDGG  454

Query  364  LFEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KF   +E+TL ELLGE A+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  455  LYEHYKKFSSRVEATLAELLGEAAASSVVVKMANDGSGIGAALLAASHSQY  505



>ref|XP_002440104.1| hypothetical protein SORBIDRAFT_09g026080 [Sorghum bicolor]
 gb|EES18534.1| hypothetical protein SORBIDRAFT_09g026080 [Sorghum bicolor]
Length=507

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+ PFILRTPDMSAMH D+S DLK +G KLKDI+ 
Sbjct  333  GEIVRRILLKLAHDASLFGDVVPSKLEQPFILRTPDMSAMHHDSSHDLKTLGAKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSW-KAGESNKRSVVAVDGG  365
            + ++SL++R +   +CD+VA R ARL+AAGI  ILKK+GRD    +G    R+VVA+DGG
Sbjct  393  VADTSLEVRYITRHICDLVAERGARLAAAGIYSILKKIGRDKVPSSGGKMPRTVVALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY E+
Sbjct  453  LYEHYKKFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQYGES  506



>gb|EAY98804.1| hypothetical protein OsI_20748 [Oryza sativa Indica Group]
Length=494

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMAEEA LFGD VPPKLKIPFI+RTP MS MH D S DL+ VG KLKDIL 
Sbjct  321  GEIVRRVLLKMAEEASLFGDEVPPKLKIPFIIRTPYMSMMHCDRSPDLRTVGAKLKDILG  380

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + ++SLK R++VV+VCDIVA RAA L+AAGI GILKKLGRD        +R+V+AV+GGL
Sbjct  381  VQSTSLKTRRLVVDVCDIVAKRAACLAAAGIHGILKKLGRDV--PNTDKQRTVIAVNGGL  438

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +EHYT F +C+ESTL+++LG E S ++VI+ + DGSGIGAALLAAAHSQY EA+E
Sbjct  439  YEHYTIFAECVESTLRDVLGEEVSSTIVIKLAKDGSGIGAALLAAAHSQYREAEE  493



>ref|XP_008675068.1| PREDICTED: hexokinase-6 [Zea mays]
 tpg|DAA57704.1| TPA: hypothetical protein ZEAMMB73_919197 [Zea mays]
Length=506

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VPPKL+  FILRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  333  GEIVRRILLKLAHDASLFGDVVPPKLEQLFILRTPDMSAMHHDTSHDLKHLGAKLKDILG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P++SL+ R + + VCD+VA R ARL+AAGI GILKKLG+D      S +R+VVA+DGGL
Sbjct  393  VPDTSLEARYITLHVCDLVAERGARLAAAGIYGILKKLGKDKLLGDFSQQRTVVAIDGGL  452

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            +EHY KF  C+E+TL +LLG E + S+V++ +NDGSGIGAALLAA+HSQY EA
Sbjct  453  YEHYKKFSACLEATLTDLLGEEVASSVVVKLANDGSGIGAALLAASHSQYAEA  505



>gb|EMS60419.1| Hexokinase-9 [Triticum urartu]
Length=364

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 138/175 (79%), Gaps = 3/175 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L +MA+EA LFGD +PPKL+ P+IL+T  M  MH D S DL+ VG KLK+I +
Sbjct  190  GEIVRRILLQMAQEAALFGDNIPPKLETPYILKTFHMLVMHHDVSPDLETVGIKLKEIFQ  249

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++S K RK+VV+VC+++ TR ARL+AAGI GILKKLGR +       +R+V+AVDGG+
Sbjct  250  IESTSRKTRKLVVDVCEVITTRGARLAAAGIHGILKKLGRAT--DSPDKRRTVIAVDGGV  307

Query  361  FEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            +++YT F +CME TL ++LGE  + S+VI+ +NDGSG+GAALLAA +SQYL+ADE
Sbjct  308  YKYYTFFSECMERTLSDMLGEDLAPSVVIKPANDGSGLGAALLAANYSQYLQADE  362



>ref|XP_002458467.1| hypothetical protein SORBIDRAFT_03g034230 [Sorghum bicolor]
 gb|EES03587.1| hypothetical protein SORBIDRAFT_03g034230 [Sorghum bicolor]
Length=506

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VPPKL+  FILRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  333  GEIVRRILLKLAHDASLFGDVVPPKLEQLFILRTPDMSAMHHDTSHDLKHLGAKLKDILG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +P++SL+ R + + VCD+VA R ARL+AAGI GILKKLG+D   +  S +R+VVA+DGGL
Sbjct  393  VPDTSLEARYITLHVCDLVAERGARLAAAGIYGILKKLGKDKLLSDFSQQRTVVAIDGGL  452

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            +EHY KF  C+E+TL +LLG E + S+V++ +NDGSGIGAALLAA+HSQY E
Sbjct  453  YEHYKKFSACLEATLTDLLGEEVASSVVVKLANDGSGIGAALLAASHSQYAE  504



>emb|CDM84036.1| unnamed protein product [Triticum aestivum]
Length=511

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRR+L ++A +A LFGD VP KL+  F+LRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  337  GEVVRRILLRLAHDASLFGDVVPSKLEKLFVLRTPDMSAMHHDTSHDLKHLGAKLKDILG  396

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNK-RSVVAVDGG  365
            + ++SL+ R + + VCD VA R ARL+AAGI GILKKLGRD   +G   K R+VVA+DGG
Sbjct  397  VADTSLEARYITLHVCDKVAERGARLAAAGIYGILKKLGRDRAPSGGCPKQRTVVAIDGG  456

Query  364  LFEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KF   +E+TL ELLGE A+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  457  LYEHYKKFSSRVEATLAELLGEAAASSVVVKMANDGSGIGAALLAASHSQY  507



>ref|NP_001056082.1| Os05g0522500 [Oryza sativa Japonica Group]
 sp|Q5W676.1|HXK5_ORYSJ RecName: Full=Hexokinase-5; AltName: Full=Hexokinase I [Oryza 
sativa Japonica Group]
 gb|AAK51559.1|AF372831_1 hexokinase I [Oryza sativa]
 gb|AAV44032.1| hexokinase 1 [Oryza sativa Japonica Group]
 gb|AAV59322.1| hexokinase [Oryza sativa Japonica Group]
 gb|AAZ93622.1| hexokinase 5 [Oryza sativa Japonica Group]
 dbj|BAF17996.1| Os05g0522500 [Oryza sativa Japonica Group]
 gb|EEE64409.1| hypothetical protein OsJ_19253 [Oryza sativa Japonica Group]
Length=507

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+ PF+LRTPDMSAMH D+S DLK VG KLKDI+ 
Sbjct  333  GEIVRRILLKLAHDAALFGDVVPSKLEQPFVLRTPDMSAMHHDSSHDLKTVGAKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSW-KAGESNKRSVVAVDGG  365
            +P++SL++R +   +CDIVA RAARL+AAGI G+LKKLGRD   K G    R+V+A+DGG
Sbjct  393  VPDTSLEVRYITSHICDIVAERAARLAAAGIYGVLKKLGRDKMPKDGSKMPRTVIALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+ESTL +LLG + S S+V + +NDGSGIGAALLAA+HSQY E D
Sbjct  453  LYEHYKKFSSCLESTLTDLLGDDVSSSVVTKLANDGSGIGAALLAASHSQYAEID  507



>gb|EAY98739.1| hypothetical protein OsI_20669 [Oryza sativa Indica Group]
Length=511

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A +A LFGD VP KL+ PF+LRTPDMSAMH D+S DLK VG KLKDI+ 
Sbjct  337  GEIVRRILLKLAHDAALFGDVVPSKLEQPFVLRTPDMSAMHHDSSHDLKTVGAKLKDIVG  396

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSW-KAGESNKRSVVAVDGG  365
            +P++SL++R +   +CDIVA RAARL+AAGI G+LKKLGRD   K G    R+V+A+DGG
Sbjct  397  VPDTSLEVRYITSHICDIVAERAARLAAAGIYGVLKKLGRDKMPKDGSKMPRTVIALDGG  456

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEAD  203
            L+EHY KF  C+ESTL +LLG + S S+V + +NDGSGIGAALLAA+HSQY E D
Sbjct  457  LYEHYKKFSSCLESTLTDLLGDDVSSSVVTKLANDGSGIGAALLAASHSQYAEID  511



>sp|Q2KNB7.1|HXK9_ORYSJ RecName: Full=Hexokinase-9; AltName: Full=Hexokinase-5 [Oryza 
sativa Japonica Group]
 gb|AAX68421.1| hexokinase 5 [Oryza sativa Japonica Group]
 gb|AAZ93626.1| hexokinase 9 [Oryza sativa Japonica Group]
 gb|EAZ13381.1| hypothetical protein OsJ_03300 [Oryza sativa Japonica Group]
Length=502

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 139/176 (79%), Gaps = 3/176 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRR+L KMA+E  +FGD +PPKL+ P+ILRT DM  MH DTS+DL+ V NKLK++L 
Sbjct  326  GELVRRILLKMAQETRIFGDNIPPKLERPYILRTLDMLIMHHDTSSDLRTVANKLKEVLG  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I  +S   RK+V++VC+ +ATR ARL+AAGI GI++KLG+ S     S +RSV+AVDGG+
Sbjct  386  IEYTSFTTRKLVLDVCEAIATRGARLAAAGIYGIIQKLGQHS--DSPSTRRSVIAVDGGV  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +++YT F  CMESTL ++LG E + S++I+H NDGSG+GAALLAA++SQY +A+ +
Sbjct  444  YKYYTFFSQCMESTLSDMLGQELAPSVMIKHVNDGSGVGAALLAASYSQYHQAESA  499



>gb|EAY75659.1| hypothetical protein OsI_03566 [Oryza sativa Indica Group]
Length=502

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 139/176 (79%), Gaps = 3/176 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRR+L KMA+E  +FGD +PPKL+ P+ILRT DM  MH DTS+DL+ V NKLK++L 
Sbjct  326  GELVRRILLKMAQETRIFGDNIPPKLERPYILRTLDMLIMHHDTSSDLRTVANKLKEVLG  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I  +S   RK+V++VC+ +ATR ARL+AAGI GI++KLG+ S     S +RSV+AVDGG+
Sbjct  386  IEYTSFTTRKLVLDVCEAIATRGARLAAAGIYGIIQKLGQHS--DSPSTRRSVIAVDGGV  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +++YT F  CMESTL ++LG E + S++I+H NDGSG+GAALLAA++SQY +A+ +
Sbjct  444  YKYYTFFSQCMESTLSDMLGQELAPSVMIKHVNDGSGVGAALLAASYSQYHQAESA  499



>ref|XP_010271549.1| PREDICTED: probable hexokinase-like 2 protein [Nelumbo nucifera]
Length=491

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 132/176 (75%), Gaps = 7/176 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEE  LFGDTVPPKL+IP++LR+PDM+ MH+DTS D +V+G KLKDI  
Sbjct  322  GDIVRRVLLKMAEETALFGDTVPPKLRIPYVLRSPDMALMHQDTSEDREVIGEKLKDIFG  381

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I +S+  +R+VV EVCDIV  R ARL+ AGIVGILKKLGR         KRSVV V+GGL
Sbjct  382  IADSTRMVREVVAEVCDIVTERGARLAGAGIVGILKKLGR------TETKRSVVIVEGGL  435

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            +EHY  FR+ + S++ E+LG E S++++IE S  GSGIGA LL  +H Q + A +S
Sbjct  436  YEHYRLFRNYLHSSIWEMLGKEFSDNVIIEESLGGSGIGAVLLTTSHLQPISASDS  491



>gb|EMT04435.1| Hexokinase-6 [Aegilops tauschii]
Length=491

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE+VRR+L ++A +A LFGD VP KL+  F+LRTPDMSAMH DTS DLK +G KLKDIL 
Sbjct  317  GEVVRRILLRLAHDASLFGDVVPSKLEKLFVLRTPDMSAMHHDTSHDLKHLGAKLKDILG  376

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKA-GESNKRSVVAVDGG  365
            + ++SL+ R + + VCD VA R ARL+AAGI GI+KKLGRD     G   +R+VVA+DGG
Sbjct  377  VADTSLEARYITLHVCDKVAERGARLAAAGIYGIVKKLGRDRAPTDGSPKQRTVVAIDGG  436

Query  364  LFEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KF   +E+T+ ELLGE A+ S+V++ +NDGSGIGAALLAA+HSQY
Sbjct  437  LYEHYKKFSSRVEATVAELLGEAAASSVVVKMANDGSGIGAALLAASHSQY  487



>gb|ABR18277.1| unknown [Picea sitchensis]
Length=551

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 139/171 (81%), Gaps = 4/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+AE+A LFGD +P +L+ P++L TP++SAMH+DTS DLKVV N LK++  
Sbjct  379  GEIVRRLLLKLAEDAALFGDNIPSRLREPYVLTTPNISAMHQDTSPDLKVVENTLKNVFG  438

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNK-RSVVAVDGG  365
            I +  L+ RK+VVE+C IVA RAARL+ AGIVGILKKLGRD    G++ K R+VVA+DGG
Sbjct  439  ISHIPLRTRKLVVELCGIVAVRAARLAGAGIVGILKKLGRDV--IGDTGKMRTVVAIDGG  496

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY+ FR  M+S +KELLG E SE++V+E S+DGSGIGA LLAA++S+Y
Sbjct  497  LYEHYSFFRQNMQSAVKELLGSEVSETVVLELSSDGSGIGATLLAASNSRY  547



>gb|ACN35115.1| unknown [Zea mays]
Length=439

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A EA LFGD VPPKL++PFILRTPDMSAMH D+S DLK +G KLKDI+ 
Sbjct  263  GEIVRRILLKLAHEASLFGDVVPPKLELPFILRTPDMSAMHHDSSHDLKTLGAKLKDIVG  322

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESN-KRSVVAVDGG  365
            + ++SL++R +   +CD+VA RAARL+AAG+  ILKK+GRD   +G     R+VVA+DGG
Sbjct  323  VADTSLEVRYITRHICDLVAERAARLAAAGVYSILKKIGRDKVPSGGGKMPRTVVALDGG  382

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY
Sbjct  383  LYEHYKKFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQY  433



>ref|XP_003635648.1| PREDICTED: probable hexokinase-like 2 protein, partial [Vitis 
vinifera]
Length=199

 Score =   186 bits (473),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 119/159 (75%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+E  LFG+ VPPKL+ P++LR+PDM+AMH+DTS D +VV  KL +I  
Sbjct  33   GEIVRRVLLKMAQETALFGEDVPPKLRTPYLLRSPDMAAMHQDTSEDHEVVHEKLMEIFR  92

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+   R+VV EVCDIVA R ARL+ AGIVGI KKLGR        NKRS + V+GGL
Sbjct  93   ITNSTPLAREVVAEVCDIVAERGARLAGAGIVGITKKLGRI------ENKRSAITVEGGL  146

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ M S++ E+LG E S+++VIEHS+ GSG G
Sbjct  147  YEHYRVFRNYMHSSVWEMLGNELSDNVVIEHSHGGSGAG  185



>emb|CBI23561.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 119/159 (75%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+E  LFG+ VPPKL+ P++LR+PDM+AMH+DTS D +VV  KL +I  
Sbjct  36   GEIVRRVLLKMAQETALFGEDVPPKLRTPYLLRSPDMAAMHQDTSEDHEVVHEKLMEIFR  95

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+   R+VV EVCDIVA R ARL+ AGIVGI KKLGR        NKRS + V+GGL
Sbjct  96   ITNSTPLAREVVAEVCDIVAERGARLAGAGIVGITKKLGRI------ENKRSAITVEGGL  149

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ M S++ E+LG E S+++VIEHS+ GSG G
Sbjct  150  YEHYRVFRNYMHSSVWEMLGNELSDNVVIEHSHGGSGAG  188



>gb|AFW82530.1| hexokinase [Zea mays]
Length=509

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A EA LFGD VPPKL++PFILRTPDMSAMH D+S DLK +G KLKDI+ 
Sbjct  333  GEIVRRILLKLAHEASLFGDVVPPKLELPFILRTPDMSAMHHDSSHDLKTLGAKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESN-KRSVVAVDGG  365
            + ++SL++R +   +CD+VA RAARL+AAG+  ILKK+GRD   +G     R+VVA+DGG
Sbjct  393  VADTSLEVRYITRHICDLVAERAARLAAAGVYSILKKIGRDKVPSGGGKMPRTVVALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY
Sbjct  453  LYEHYKKFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQY  503



>gb|EPS70676.1| hexokinase 1a, partial [Genlisea aurea]
Length=490

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 137/172 (80%), Gaps = 7/172 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEI+RRVL KMAEEA LFGD VPPKL+IPFILRTPDMS MH+D+S DLK V   LK   E
Sbjct  324  GEILRRVLLKMAEEALLFGDEVPPKLRIPFILRTPDMSTMHKDSSPDLKTVDEILKKTFE  383

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SLK R+VVVE+C I+A R ARL+AAGI G+LKK G+++       +R+V+A+DGGL
Sbjct  384  ISSTSLKTRRVVVELCGIIAARGARLAAAGIFGVLKKTGKEN-----PRERTVIAMDGGL  438

Query  361  FEHYTKFRDCMESTLKELL--GEASESLVIEHSNDGSGIGaallaaAHSQYL  212
            +EHY ++R  +ESTL+EL+  GEA E +V EHSNDGSGIGAALLAA+HS YL
Sbjct  439  YEHYAEYRTRLESTLRELIGGGEAGEHIVFEHSNDGSGIGAALLAASHSLYL  490



>gb|EMT15586.1| Hexokinase-7 [Aegilops tauschii]
Length=430

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 133/171 (78%), Gaps = 4/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL K+A  + +FG      LK  FILRTPD+SAMH D + DL++V  KL + L+
Sbjct  262  GDIVRRVLLKIASRSSIFGHIKRTNLKTRFILRTPDISAMHHDETPDLRIVAEKLAETLK  321

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RK+VVE+CDIV +R+ARL+AAGIVGI++K+GR +       +R+V+A+DGGL
Sbjct  322  IKDTSLETRKMVVEICDIVTSRSARLAAAGIVGIIRKIGRGTPG---DKRRTVIAIDGGL  378

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            FEHY KFR C+ESTL ELLG EASE + ++ + DGSG+GAAL+AAAHSQYL
Sbjct  379  FEHYAKFRQCLESTLVELLGKEASELVAVKLTKDGSGVGAALIAAAHSQYL  429



>ref|NP_001105529.1| LOC542510 [Zea mays]
 gb|AAM80479.1| hexokinase [Zea mays]
Length=509

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L K+A EA LFGD VPPKL++PFILRTPDM+AMH D+S DLK +G KLKDI+ 
Sbjct  333  GEIVRRILLKLAHEASLFGDVVPPKLELPFILRTPDMAAMHHDSSHDLKTLGAKLKDIVG  392

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESN-KRSVVAVDGG  365
            + ++SL++R +   +CD+VA RAARL+AAG+  ILKK+GRD   +G     R+VVA+DGG
Sbjct  393  VADTSLEVRYITRHICDLVAERAARLAAAGVYSILKKIGRDKVPSGGGKMPRTVVALDGG  452

Query  364  LFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            L+EHY KF  C+E+TL +LLG EAS S+V + +NDGSGIGAALLAA+HSQY
Sbjct  453  LYEHYKKFSSCVEATLTDLLGEEASSSVVAKLANDGSGIGAALLAASHSQY  503



>ref|XP_006654122.1| PREDICTED: hexokinase-7-like [Oryza brachyantha]
Length=356

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 139/174 (80%), Gaps = 8/174 (5%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K++ ++ +FG+    KLK  FILRTPD+SAMH D + DLK+V  KL D L+
Sbjct  188  GEIVRRVLLKISLQSSIFGNVDQTKLKSHFILRTPDISAMHHDQTPDLKIVAEKLADNLK  247

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESN--KRSVVAVDG  368
            I ++SL+ RK+VVE+CDIV  R+ARL+AAGIVGIL+K+GR     G  N  ++SV+A+DG
Sbjct  248  IIDTSLETRKMVVEICDIVTRRSARLAAAGIVGILRKIGR-----GNPNDKRKSVIAIDG  302

Query  367  GLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLE  209
            GL+EHYT+FR C+ESTL EL+G EAS S+ ++ +NDGSG+GAAL+AAAHSQYL+
Sbjct  303  GLYEHYTEFRQCLESTLTELIGEEASRSVTVKLANDGSGLGAALIAAAHSQYLK  356



>gb|AAT47078.1| unknown protein [Oryza sativa Japonica Group]
Length=1142

 Score =   194 bits (494),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 141/186 (76%), Gaps = 16/186 (9%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILR-------------TPDMSAMHRDTSAD  581
            GEIVRRVL KMAEEA LFGD VPPKLKIPFI+R             TP MS MH D S D
Sbjct  296  GEIVRRVLLKMAEEASLFGDEVPPKLKIPFIIRLSLTKQIKAFISRTPYMSMMHCDRSPD  355

Query  580  LKVVGNKLKDILEIPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGE  401
            L+ VG KLKDIL + N+SLK R++VV+VCDIVA RAA L+AAGI GILKKLGRD      
Sbjct  356  LRTVGAKLKDILGVQNTSLKTRRLVVDVCDIVAKRAAHLAAAGIHGILKKLGRDV--PNT  413

Query  400  SNKRSVVAVDGGLFEHYTKFRDCMESTLKELLGE-ASESLVIEHSNDGSGIGaallaaAH  224
              +R+V+AVDGGL+EHYT F +C+ESTL+++LGE  S ++VI+ + DGSGIGAALLAAAH
Sbjct  414  DKQRTVIAVDGGLYEHYTIFAECVESTLRDMLGEDVSSTIVIKLAKDGSGIGAALLAAAH  473

Query  223  SQYLEA  206
            SQYL +
Sbjct  474  SQYLPS  479



>emb|CBI23516.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 119/159 (75%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+E  LFG+ VPPKL+ P++LR+PDM+AMH+DTS D +VV  KL +I  
Sbjct  313  GEIVRRVLLKMAQETALFGEDVPPKLRTPYLLRSPDMAAMHQDTSEDHEVVHEKLMEIFR  372

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+   R+VV EVCDIVA R ARL+ AGIVGI KKLGR        NKRS V V+GGL
Sbjct  373  ITNSTPLAREVVAEVCDIVAERGARLAGAGIVGITKKLGRI------ENKRSAVTVEGGL  426

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ M S++ E+LG E S+++VIEHS+ GSG G
Sbjct  427  YEHYRVFRNYMHSSVWEMLGNELSDNVVIEHSHGGSGAG  465



>ref|XP_003635485.1| PREDICTED: probable hexokinase-like 2 protein [Vitis vinifera]
Length=489

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 119/159 (75%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+E  LFG+ VPPKL+ P++LR+PDM+AMH+DTS D +VV  KL +I  
Sbjct  323  GEIVRRVLLKMAQETALFGEDVPPKLRTPYLLRSPDMAAMHQDTSEDHEVVHEKLMEIFR  382

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+   R+VV EVCDIVA R ARL+ AGIVGI KKLGR        NKRS V V+GGL
Sbjct  383  ITNSTPLAREVVAEVCDIVAERGARLAGAGIVGITKKLGRI------ENKRSAVTVEGGL  436

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ M S++ E+LG E S+++VIEHS+ GSG G
Sbjct  437  YEHYRVFRNYMHSSVWEMLGNELSDNVVIEHSHGGSGAG  475



>ref|XP_004960891.1| PREDICTED: hexokinase-7-like isoform X2 [Setaria italica]
Length=463

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 4/170 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K+A ++ LFG     KLK  FILRTPD+SAMH D + DL++V  KL D  +
Sbjct  295  GEIVRRVLLKIASQSTLFGKVNHTKLKTRFILRTPDISAMHHDETPDLRIVAEKLADNFK  354

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RK+VVE+CD+V +R+ARL+AAGIVGIL+K+GR         +RSVVA+DGGL
Sbjct  355  IKDTSLETRKMVVEICDVVTSRSARLAAAGIVGILRKIGR---AVPGDERRSVVAIDGGL  411

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            FEHYT+FR C+ESTL ELLG EAS S+ ++ + DGSG+GAAL+AAAHSQY
Sbjct  412  FEHYTEFRQCLESTLVELLGEEASRSVAVKLTKDGSGLGAALIAAAHSQY  461



>ref|XP_004960890.1| PREDICTED: hexokinase-7-like isoform X1 [Setaria italica]
Length=460

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 4/170 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K+A ++ LFG     KLK  FILRTPD+SAMH D + DL++V  KL D  +
Sbjct  292  GEIVRRVLLKIASQSTLFGKVNHTKLKTRFILRTPDISAMHHDETPDLRIVAEKLADNFK  351

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RK+VVE+CD+V +R+ARL+AAGIVGIL+K+GR         +RSVVA+DGGL
Sbjct  352  IKDTSLETRKMVVEICDVVTSRSARLAAAGIVGILRKIGR---AVPGDERRSVVAIDGGL  408

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            FEHYT+FR C+ESTL ELLG EAS S+ ++ + DGSG+GAAL+AAAHSQY
Sbjct  409  FEHYTEFRQCLESTLVELLGEEASRSVAVKLTKDGSGLGAALIAAAHSQY  458



>ref|XP_011021821.1| PREDICTED: probable hexokinase-like 2 protein [Populus euphratica]
Length=491

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+E  LFGD VPPKL  P+ LR+PDM+AMH+DTS D  VVG KLK+ L 
Sbjct  326  GEIVRRVLLKMAQETALFGDVVPPKLATPYQLRSPDMAAMHQDTSEDHGVVGEKLKENLG  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NSS  +R+VV EVCDIVA R ARL+ AGIVGI+KKLGR        +++SVV V+GGL
Sbjct  386  ITNSSPMVREVVAEVCDIVAERGARLAGAGIVGIIKKLGRI------ESRKSVVTVEGGL  439

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ + S++ E+LG + S+++VIEHS+ GSG G
Sbjct  440  YEHYRVFRNYLHSSVWEMLGSDHSDNVVIEHSHGGSGAG  478



>ref|XP_006380814.1| hypothetical protein POPTR_0007s14490g [Populus trichocarpa]
 gb|ERP58611.1| hypothetical protein POPTR_0007s14490g [Populus trichocarpa]
Length=451

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 121/159 (76%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+E  LFGD VPPKL  P+ LR+PDM+AMH+DTS D  VVG KLK+ L 
Sbjct  286  GEIVRRVLLKMAQETALFGDVVPPKLATPYQLRSPDMAAMHQDTSEDHGVVGEKLKENLG  345

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+  +R+VV EVCDIVA R ARL+ AGIVGI+KKLGR        +++SVV V+GGL
Sbjct  346  ITNSTPMVREVVAEVCDIVAERGARLAGAGIVGIIKKLGRI------ESRKSVVTVEGGL  399

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ + S++ E+LG + S+++VIEHS+ GSG G
Sbjct  400  YEHYRVFRNYLHSSVWEMLGSDHSDNVVIEHSHGGSGAG  438



>sp|Q1WM16.2|HXK7_ORYSJ RecName: Full=Hexokinase-7; AltName: Full=Hexokinase-6 [Oryza 
sativa Japonica Group]
 gb|AAX68422.1| hexokinase 6 [Oryza sativa Japonica Group]
Length=463

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 136/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K++ ++ +FG+    KLK  FILRTPD+S MH D + DL++V  KL D L+
Sbjct  295  GEIVRRVLLKISLQSSIFGNLDQTKLKTRFILRTPDISVMHHDGTPDLRIVAEKLADNLK  354

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RK+VVE+CDIV  R+ARL+AAGIVGIL+K+GR         ++SV+A+DGGL
Sbjct  355  ITDTSLETRKMVVEICDIVTRRSARLAAAGIVGILRKIGRG---VPGDKRKSVIAIDGGL  411

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            +EHYT+FR C+E+TL ELLG EAS+S+ ++ +NDGSG+GAAL+AAAHSQYL
Sbjct  412  YEHYTEFRQCLETTLTELLGEEASKSVAVKLANDGSGLGAALIAAAHSQYL  462



>gb|KGN60580.1| hypothetical protein Csa_2G000870 [Cucumis sativus]
Length=154

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 113/139 (81%), Gaps = 9/139 (6%)
 Frame = -2

Query  613  MSAMHRDTSADLKVVGNKLKDILEIPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILK  434
            MSAMH DTS+DLKVV +KLKD+LE         K++VE+CD+VATR ARLSAAGI GILK
Sbjct  1    MSAMHHDTSSDLKVVASKLKDVLE-------QEKIIVELCDVVATRGARLSAAGIFGILK  53

Query  433  KLGRDSWKAGESNKRSVVAVDGGLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGS  257
            KLGRD+ + GE  K SVVA+DGGL+EHYTKFR  ME+TLKELLG E + ++ +EHSN+GS
Sbjct  54   KLGRDTVRIGEKQK-SVVALDGGLYEHYTKFRTTMENTLKELLGDEVAANVFVEHSNNGS  112

Query  256  GIGaallaaAHSQYLEADE  200
            GIGAAL AA+HSQYLE DE
Sbjct  113  GIGAALFAASHSQYLEVDE  131



>gb|AAZ93624.1| hexokinase 7 [Oryza sativa Japonica Group]
Length=463

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 136/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K++ ++ +FG+    KLK  FILRTPD+S MH D + DL++V  KL D L+
Sbjct  295  GEIVRRVLLKISLQSSIFGNLDQTKLKTRFILRTPDISVMHHDGTPDLRIVAEKLADNLK  354

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RK+VVE+CDIV  R+ARL+AAGIVGIL+K+GR         ++SV+A+DGGL
Sbjct  355  ITDTSLETRKMVVEICDIVTRRSARLAAAGIVGILRKIGRG---VPGDKRKSVIAIDGGL  411

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            +EHYT+FR C+E+TL ELLG EAS+S+ ++ +NDGSG+GAAL+AAAHSQYL
Sbjct  412  YEHYTEFRQCLETTLTELLGEEASKSVAVKLANDGSGLGAALIAAAHSQYL  462



>ref|XP_002310319.2| hexokinase family protein [Populus trichocarpa]
 gb|EEE90769.2| hexokinase family protein [Populus trichocarpa]
Length=502

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 121/159 (76%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+E  LFGD VPPKL  P+ LR+PDM+AMH+DTS D  VVG KLK+ L 
Sbjct  337  GEIVRRVLLKMAQETALFGDVVPPKLATPYQLRSPDMAAMHQDTSEDHGVVGEKLKENLG  396

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+  +R+VV EVCDIVA R ARL+ AGIVGI+KKLGR        +++SVV V+GGL
Sbjct  397  ITNSTPMVREVVAEVCDIVAERGARLAGAGIVGIIKKLGRI------ESRKSVVTVEGGL  450

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ + S++ E+LG + S+++VIEHS+ GSG G
Sbjct  451  YEHYRVFRNYLHSSVWEMLGSDHSDNVVIEHSHGGSGAG  489



>gb|EPS60819.1| hexokinase, partial [Genlisea aurea]
Length=439

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 132/171 (77%), Gaps = 12/171 (7%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGD--TVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDI  548
            GE+VRRVL  +AEEA  FGD   +P  L+IPF LR+ D+SAMH D+S DL VVG KLK+I
Sbjct  279  GEMVRRVLLHLAEEASFFGDEIPIPSTLRIPFTLRSQDVSAMHHDSSPDLDVVGVKLKEI  338

Query  547  LEIPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDG  368
            LE+ N+S+K R++VV+VC+I+ TR ARL+AAGIVGILKKLGR        ++RSV+AVDG
Sbjct  339  LEVANTSVKTRRMVVKVCEIITTRGARLAAAGIVGILKKLGR-------RDQRSVIAVDG  391

Query  367  GLFEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQY  215
             L++HY +FR  +E+ L ELLG+A   +VIE S+DGS  GAAL+AA+HS+Y
Sbjct  392  ALYKHYGEFRISLENALVELLGDA---VVIELSSDGSSTGAALIAASHSRY  439



>gb|EEC78650.1| hypothetical protein OsI_18744 [Oryza sativa Indica Group]
 gb|EEE62583.1| hypothetical protein OsJ_17386 [Oryza sativa Japonica Group]
Length=477

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 136/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K++ ++ +FG+    KLK  FILRTPD+S MH D + DL++V  KL D L+
Sbjct  309  GEIVRRVLLKISLQSSIFGNLDQTKLKTRFILRTPDISVMHHDGTPDLRIVAEKLADNLK  368

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RK+VVE+CDIV  R+ARL+AAGIVGIL+K+GR         ++SV+A+DGGL
Sbjct  369  ITDTSLETRKMVVEICDIVTRRSARLAAAGIVGILRKIGRG---VPGDKRKSVIAIDGGL  425

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            +EHYT+FR C+E+TL ELLG EAS+S+ ++ +NDGSG+GAAL+AAAHSQYL
Sbjct  426  YEHYTEFRQCLETTLTELLGEEASKSVAVKLANDGSGLGAALIAAAHSQYL  476



>ref|XP_002988103.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
 gb|EFJ10895.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
Length=513

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 135/188 (72%), Gaps = 14/188 (7%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL K+A EA  FG  VP +L++PFILRTPD+SA+H D S DLK V   L+ +  
Sbjct  326  GDIVRRVLWKLAAEAAFFGGKVPSRLEVPFILRTPDVSAIHADQSPDLKEVIRVLRVVFG  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRD-------------SWKAGE  401
            I +S+L+MRK++V+VCDIVA R ARL+ AGIVGILKK+GRD             S+ A E
Sbjct  386  IQSSTLQMRKMIVDVCDIVAERGARLAGAGIVGILKKIGRDGGSLANNGGLENHSYAAAE  445

Query  400  SNKRSVVAVDGGLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAH  224
              K++VVA+DGGL+EHY KFR+ ++ ++ EL+G EA+E + +  S DGSGIGA LLAA+H
Sbjct  446  ERKKTVVAMDGGLYEHYPKFREYLKQSVVELIGKEAAEHIELRLSKDGSGIGATLLAASH  505

Query  223  SQYLEADE  200
            S ++   E
Sbjct  506  SSFVAEQE  513



>ref|XP_006426179.1| hypothetical protein CICLE_v10027315mg [Citrus clementina]
 gb|ESR39419.1| hypothetical protein CICLE_v10027315mg [Citrus clementina]
Length=491

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 134/173 (77%), Gaps = 7/173 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MA+EA+LFGDTVPPKL +P++LR+PDM+ MH+DTS D ++V  KL+++  
Sbjct  325  GEIVRRVLLRMAKEADLFGDTVPPKLMLPYLLRSPDMATMHQDTSEDHELVREKLEEVFG  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I +S+ K R+VVVEVCDIV  RAARL+AAGIVGI+KKLGR         K+SVV V+GGL
Sbjct  385  ITDSTPKAREVVVEVCDIVTERAARLAAAGIVGIIKKLGRIEL------KKSVVNVEGGL  438

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            +EHY  FR+ + S++ E+LG E S+++++E S+ GSG GA  LAA+ +Q  E+
Sbjct  439  YEHYRIFRNYLHSSVWEMLGNELSDNVIVEPSHGGSGAGALFLAASQTQNPES  491



>ref|XP_002972691.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
 gb|EFJ25912.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
Length=513

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 135/188 (72%), Gaps = 14/188 (7%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL K+A EA  FG  VP +L++PFILRTPD+SA+H D S DLK V   L+ +  
Sbjct  326  GDIVRRVLWKLAAEAAFFGGKVPSRLEVPFILRTPDVSAIHADQSPDLKEVIRVLRVVFG  385

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRD-------------SWKAGE  401
            I +S+L+MRKV+++VCDIVA R ARL+ AGIVGILKK+GRD             S+ A E
Sbjct  386  IQSSTLQMRKVIMDVCDIVAERGARLAGAGIVGILKKIGRDGGSLANNGGLENHSYAATE  445

Query  400  SNKRSVVAVDGGLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAH  224
              K++VVA+DGGL+EHY KFR+ ++ ++ EL+G EA+E + +  S DGSGIGA LLAA+H
Sbjct  446  ERKKTVVAMDGGLYEHYPKFREYLKQSVVELIGKEAAEHIELRLSKDGSGIGATLLAASH  505

Query  223  SQYLEADE  200
            S ++   E
Sbjct  506  SSFVAEQE  513



>ref|XP_008807620.1| PREDICTED: hexokinase-2, chloroplastic-like, partial [Phoenix 
dactylifera]
Length=190

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR L KMAE + LFGD VP KL +P++LRTPD+ AMH+D S DL+ V   L D + 
Sbjct  18   GEIVRRALLKMAEVSALFGDYVPDKLSVPYVLRTPDLCAMHQDDSEDLEAVDLILNDTVG  77

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            +  SS + RK+V EVCD +  R  RL+ AGIVGIL+K+ +DS K     +R+VVA+DGGL
Sbjct  78   VTRSSREARKIVAEVCDAIVKRGGRLAGAGIVGILQKMEQDS-KGLIFGRRTVVAMDGGL  136

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            +EHY ++R  ++  + ELLG EAS+++++EH+ DGSGIGAALLAA +S+Y
Sbjct  137  YEHYPQYRKYLKEAVTELLGSEASKNVIVEHTKDGSGIGAALLAATNSKY  186



>ref|XP_004172942.1| PREDICTED: LOW QUALITY PROTEIN: probable hexokinase-like 2 protein-like, 
partial [Cucumis sativus]
Length=396

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 121/159 (76%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L KMA+E  LFGD VP KL  P++LR+PDM+AMH+DTS D +VV  KLK+I  
Sbjct  224  GEIVRRILVKMAQETLLFGDPVPSKLMTPYVLRSPDMAAMHQDTSEDREVVNEKLKEIFG  283

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + +S+   R++V EVCD+V+ RAARL+ AGIVGI+KKLGR        NKR++V V+GGL
Sbjct  284  VTDSTPMAREIVAEVCDVVSERAARLAGAGIVGIVKKLGRI------ENKRNIVTVEGGL  337

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ + S++ E+LG E S+++++EHS+ GSG G
Sbjct  338  YEHYRVFRNYLNSSIWEMLGNELSDNVIVEHSHGGSGAG  376



>ref|XP_003568782.1| PREDICTED: hexokinase-7 [Brachypodium distachyon]
Length=459

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 137/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL K+A ++ +FGD    KLK  FILRTPD+SAMH D + DL+VV  KL++ L+
Sbjct  291  GDIVRRVLLKIASQSSIFGDINRTKLKTHFILRTPDISAMHHDETPDLRVVAEKLEENLK  350

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I  +SL+ RKVVVE+CDIV +R+ARL+AAGIVGI++K+GR +  AG   K +V+A+DGGL
Sbjct  351  ITGTSLETRKVVVEICDIVTSRSARLAAAGIVGIIRKIGRGT--AGNKEK-TVIAIDGGL  407

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            F+HY KFR  +ES L ELLG EAS+S+ I+ +NDGSG+GAAL+AAAHSQY+
Sbjct  408  FKHYGKFRQSLESALVELLGEEASKSVGIKLANDGSGLGAALIAAAHSQYI  458



>ref|XP_007047663.1| Hexokinase-like 3 [Theobroma cacao]
 gb|EOX91820.1| Hexokinase-like 3 [Theobroma cacao]
Length=493

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 119/159 (75%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+E  LFG+TVPPKL IP++LR PDM+AMH+DTS D +VV  KLK+I  
Sbjct  329  GEIVRRVLAKMAKETALFGETVPPKLLIPYLLRPPDMAAMHQDTSEDREVVHEKLKEIFG  388

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+   R++V EVCDIV  R ARL+ AGIV I KKLGR       +N+RSV+ ++GGL
Sbjct  389  ITNSTEMAREIVAEVCDIVTERGARLAGAGIVAIAKKLGRI------ANRRSVITIEGGL  442

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ + S++ E+LG E S +++IEH++ GSG G
Sbjct  443  YEHYRIFRNYLHSSVWEMLGDELSGNIIIEHAHGGSGAG  481



>emb|CDP03252.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 115/173 (66%), Gaps = 32/173 (18%)
 Frame = -2

Query  715  IVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILEIP  536
            +  +VLC+MAEEA  FGD VPPKL IPFILRTP+MSA+H DTS DLKVVG KLKDILE  
Sbjct  79   VFNKVLCRMAEEAAFFGDGVPPKLNIPFILRTPEMSAIHHDTSCDLKVVGAKLKDILE--  136

Query  535  NSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGLFE  356
                                       G       L     + GE  K SVVA+DGGLFE
Sbjct  137  ------------------------GTPGFYTFFPPL-----EDGEKQK-SVVALDGGLFE  166

Query  355  HYTKFRDCMESTLKELLGEASESLVIEHSNDGSGIGaallaaAHSQYLEADES  197
            HYTKFR+CM+STL+ELLG+A E++ I HSNDGSGIGAALLAA+HSQYLE +ES
Sbjct  167  HYTKFRNCMDSTLQELLGDAYENVSIIHSNDGSGIGAALLAASHSQYLEVEES  219



>ref|XP_002440735.1| hypothetical protein SORBIDRAFT_09g005840 [Sorghum bicolor]
 gb|EES19165.1| hypothetical protein SORBIDRAFT_09g005840 [Sorghum bicolor]
Length=459

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 120/156 (77%), Gaps = 4/156 (3%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL K+A ++ +FG+     LK  FILRTPD+SAMH D + DL++V  KL D L+
Sbjct  294  GEIVRRVLLKIASQSSIFGNVSHTLLKTRFILRTPDISAMHHDDTPDLRIVAQKLADNLK  353

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL  RK+VVE+CDIV +R+ARL+AAGIVGIL+K+GR         +RSVVA+DGGL
Sbjct  354  IMDTSLDTRKMVVEICDIVTSRSARLAAAGIVGILRKIGR---AVPGDERRSVVAIDGGL  410

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGS  257
            FEHY +FR C+ESTL ELLG EAS+SLV++ + DGS
Sbjct  411  FEHYAEFRKCLESTLVELLGEEASKSLVVKLTKDGS  446



>gb|AEB00837.1| hexokinase 1 [Hordeum vulgare subsp. vulgare]
Length=340

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 135/171 (79%), Gaps = 4/171 (2%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL K+A ++ +FG     +LK   ILRTPD+SAMH D + DL++V   L + L+
Sbjct  172  GDIVRRVLLKIASQSSIFGPIKHTRLKTRLILRTPDISAMHHDETPDLRIVAETLAETLK  231

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I ++SL+ RK+VVE+CDIV +R+ARL+AAGIVGI++K+GR +   G+  +++V+A+DGGL
Sbjct  232  IKDTSLETRKMVVEICDIVTSRSARLAAAGIVGIIRKIGRGT--PGD-KRKTVIAIDGGL  288

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYL  212
            FEHY KFR C+ESTL ELLG EASE + ++ + DGSG+GAAL+AAAHSQYL
Sbjct  289  FEHYAKFRQCLESTLVELLGEEASEFVAVKLTKDGSGLGAALIAAAHSQYL  339



>ref|XP_006466389.1| PREDICTED: probable hexokinase-like 2 protein-like [Citrus sinensis]
Length=491

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 132/173 (76%), Gaps = 7/173 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL +MA+EA+LFGDTVPPKL +P++LR PDM+ MH+DTS D ++V  KL+++  
Sbjct  325  GEIVRRVLLRMAKEADLFGDTVPPKLMMPYLLRPPDMATMHQDTSEDHELVREKLEEVFG  384

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I +S+ K R+ VVEVCDIV  RAARL+AAGIVGI+KKLGR         K+SVV V+GGL
Sbjct  385  ITDSTPKAREAVVEVCDIVTERAARLAAAGIVGIIKKLGRIEL------KKSVVNVEGGL  438

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEA  206
            +EHY  FR+ + S++ E+LG E S+++++E S+ GSG GA  LAA+ +Q  E+
Sbjct  439  YEHYRIFRNYLHSSVWEMLGNELSDNVIVEPSHGGSGAGALFLAASQTQNPES  491



>ref|XP_004143424.1| PREDICTED: probable hexokinase-like 2 protein-like [Cucumis sativus]
 gb|KGN48658.1| hypothetical protein Csa_6G497090 [Cucumis sativus]
Length=500

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 121/159 (76%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L KMA+E  LFGD VP KL  P++LR+PDM+AMH+DTS D +VV  KLK+I  
Sbjct  328  GEIVRRILVKMAQETLLFGDPVPSKLMTPYVLRSPDMAAMHQDTSEDREVVNEKLKEIFG  387

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            + +S+   R++V EVCD+V+ RAARL+ AGIVGI+KKLGR        NKR++V V+GGL
Sbjct  388  VTDSTPMAREIVAEVCDVVSERAARLAGAGIVGIVKKLGRI------ENKRNIVTVEGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ + S++ E+LG E S+++++EHS+ GSG G
Sbjct  442  YEHYRVFRNYLNSSIWEMLGNELSDNVIVEHSHGGSGAG  480



>ref|XP_006646274.1| PREDICTED: LOW QUALITY PROTEIN: hexokinase-9-like [Oryza brachyantha]
Length=495

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 9/177 (5%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFIL--RTPDMSAMHRDTSADLKVVGNKLKDI  548
            GEIVRR+L KMA EA +FGD     LK  F L  RT DM  +HRD S+DL+ V +KL +I
Sbjct  324  GEIVRRILLKMAXEAAIFGDIDNCHLKTRFTLHSRTIDMLMIHRDISSDLRTVADKLNEI  383

Query  547  LEIPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDG  368
            L++P S ++ RK+VV+VC+ +ATR ARL+AAGI GI+KKLGR        ++RSV+AVDG
Sbjct  384  LDVPLSKVQTRKLVVDVCEAIATRGARLAAAGIYGIMKKLGR------HPDRRSVIAVDG  437

Query  367  GLFEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQYLEADE  200
            G++++YT F  CMESTL +LLG E + S+VI+  NDGSG+GAALLAA++SQY +ADE
Sbjct  438  GVYKYYTFFSQCMESTLSDLLGQELASSVVIKPVNDGSGVGAALLAASYSQYRQADE  494



>ref|XP_008787361.1| PREDICTED: hexokinase-2-like [Phoenix dactylifera]
Length=541

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 121/159 (76%), Gaps = 6/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            G+IVRRVL KMAEE  LFGDTVP KL+IPF+LRTPD+++MH+D S DL +VG KL++ L 
Sbjct  373  GDIVRRVLLKMAEETALFGDTVPLKLRIPFVLRTPDVASMHQDLSQDLSLVGEKLEECLG  432

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            IPN++++MR++VVEVCDIVA R ARL+ A IVGILKKL RD      ++K+SVV V+G L
Sbjct  433  IPNTTVRMRQLVVEVCDIVAKRGARLAGAAIVGILKKLKRDG-----TDKKSVVMVEGAL  487

Query  361  FEHYTKFRDCMESTLKELL-GEASESLVIEHSNDGSGIG  248
            +EHY  FR  +   +K +L G   ++++IEHS DG  IG
Sbjct  488  YEHYRLFRAYLHDGVKMMLHGRNLDNVIIEHSGDGCVIG  526



>ref|XP_008440464.1| PREDICTED: probable hexokinase-like 2 protein isoform X1 [Cucumis 
melo]
Length=500

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 121/159 (76%), Gaps = 7/159 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRR+L KMA+E  LFGD VP KL  P++LR+PDM+AMH+DTS D +VV  KLK+I  
Sbjct  328  GEIVRRILVKMAQETLLFGDPVPSKLMTPYVLRSPDMAAMHQDTSEDREVVDEKLKEIFG  387

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I +S+   R++V EVCD+V+ RAARL+ AGIVGI+KKLGR        NKR++V V+GGL
Sbjct  388  ITDSTPMAREIVAEVCDVVSERAARLAGAGIVGIVKKLGRI------ENKRNIVTVEGGL  441

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIG  248
            +EHY  FR+ + S++ E+LG E S+++++EHS+ GSG G
Sbjct  442  YEHYRVFRNYLNSSIWEMLGNELSDNVIVEHSHGGSGAG  480



>ref|XP_011099434.1| PREDICTED: probable hexokinase-like 2 protein [Sesamum indicum]
Length=466

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GEIVRRVL KMA+EA LFGD +PPKL  P++L +PD++AMH+D S D +VVG KLK+I +
Sbjct  301  GEIVRRVLLKMAQEAALFGDCLPPKLTTPYLLMSPDVAAMHQDASEDYQVVGEKLKEIFD  360

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+   R++V EVCDIVA R ARL  AGIVG++KK GR       +N++SV+ ++GGL
Sbjct  361  INNSTPMAREIVSEVCDIVAERGARLVGAGIVGVVKKTGR------MANRKSVITIEGGL  414

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSGIGaallaaAHSQY  215
            +EHY  FR+ + S + E+LG + SE+++IE+S+ GSG G+  LAA+ S +
Sbjct  415  YEHYRIFRNYLHSCVWEMLGSDLSENVIIEYSHGGSGAGSVFLAASQSHF  464



>ref|XP_009771324.1| PREDICTED: probable hexokinase-like 2 protein [Nicotiana sylvestris]
Length=492

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 119/157 (76%), Gaps = 7/157 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE VRRVL KMA+E+ LFGD VPPKL IP++LR+PDM+AMH+DTS D +V+  KL +I  
Sbjct  331  GEAVRRVLLKMAQESSLFGDRVPPKLAIPYLLRSPDMAAMHQDTSEDYEVIDEKLTEIFG  390

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+   R++V EVCD+VA R ARL  AGIVGI+KKLGR       SN+ S++ V+GG+
Sbjct  391  INNSTTMARELVAEVCDVVAERGARLVGAGIVGIVKKLGR------LSNRISIITVEGGV  444

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSG  254
            +EHY  FR+ + S++ E+LG E S++++IEHS+ GSG
Sbjct  445  YEHYRVFRNYLHSSVWEMLGNELSDNVIIEHSHGGSG  481



>ref|XP_004231963.1| PREDICTED: probable hexokinase-like 2 protein [Solanum lycopersicum]
Length=491

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 119/157 (76%), Gaps = 7/157 (4%)
 Frame = -2

Query  721  GEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDMSAMHRDTSADLKVVGNKLKDILE  542
            GE VRRVL KMA+E+ LFGD VPPKL IP++LR+PDM+AMH+DTS D +++  KL +I E
Sbjct  330  GETVRRVLLKMAQESALFGDIVPPKLAIPYLLRSPDMAAMHQDTSEDYEIIDEKLGEIFE  389

Query  541  IPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKKLGRDSWKAGESNKRSVVAVDGGL  362
            I NS+   R++V E+CD+VA R ARL  AGIVGI+KKL R       SN+ S++ V+GG+
Sbjct  390  ITNSTTMARELVAEICDVVAERGARLVGAGIVGIVKKLDR------LSNRISIITVEGGV  443

Query  361  FEHYTKFRDCMESTLKELLG-EASESLVIEHSNDGSG  254
            +EHY  FR+ + S++ E+LG E S++++IEHS+ GSG
Sbjct  444  YEHYRVFRNYLHSSVWEMLGNEFSDNVIIEHSHGGSG  480



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425