BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003F08

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAJ38386.1|  alpha tubulin                                          420   2e-145   Plantago major [cart-track plant]
gb|AHM93474.1|  alpha-tubulin                                           422   4e-145   Camellia chekiangoleosa
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              417   5e-145   Solanum lycopersicum
gb|KJB58759.1|  hypothetical protein B456_009G224800                    419   5e-144   Gossypium raimondii
gb|EPS62716.1|  alpha-tubulin                                           421   6e-144   Genlisea aurea
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              422   2e-143   
emb|CAD13176.1|  alpha-tubulin                                          422   2e-143   Nicotiana tabacum [American tobacco]
gb|AHJ80819.1|  Tua1                                                    414   2e-143   Eragrostis tef [tef]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     422   2e-143   Nicotiana tomentosiformis
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              422   3e-143   Solanum lycopersicum
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                421   3e-143   Solanum tuberosum [potatoes]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     421   3e-143   Nicotiana sylvestris
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   421   3e-143   Nicotiana tomentosiformis
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              421   3e-143   Nicotiana tomentosiformis
gb|ABB02631.1|  unknown                                                 421   3e-143   Solanum tuberosum [potatoes]
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               412   3e-143   Erythranthe guttata [common monkey flower]
gb|AAW57309.1|  alpha-tubulin                                           414   3e-143   Ceratopteris richardii
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     421   3e-143   
gb|ACH68563.1|  alpha-tubulin                                           421   3e-143   Solanum tuberosum [potatoes]
gb|ABP65320.1|  alpha tubulin                                           421   3e-143   Capsicum annuum
gb|AAW57310.1|  alpha-tubulin                                           414   4e-143   Ceratopteris richardii
gb|KJB32211.1|  hypothetical protein B456_005G229600                    418   4e-143   Gossypium raimondii
gb|AAW57305.1|  alpha-tubulin                                           416   5e-143   Ceratopteris richardii
gb|ABC59068.2|  alpha tubulin 1                                         420   9e-143   Camellia sinensis [black tea]
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                420   9e-143   Erythranthe guttata [common monkey flower]
ref|WP_039310890.1|  hypothetical protein                               420   1e-142   
dbj|BAB19779.1|  alpha tubulin                                          420   1e-142   Nicotiana tabacum [American tobacco]
emb|CAA52158.1|  alpha tubulin                                          412   1e-142   Zea mays [maize]
emb|CDP02221.1|  unnamed protein product                                420   1e-142   Coffea canephora [robusta coffee]
ref|NP_001291325.1|  tubulin alpha chain-like                           419   2e-142   Sesamum indicum [beniseed]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     419   2e-142   Sesamum indicum [beniseed]
ref|NP_001275271.1|  alpha-tubulin-like protein                         419   2e-142   Solanum tuberosum [potatoes]
emb|CAB76917.1|  alpha-tubulin 4                                        413   2e-142   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB58756.1|  hypothetical protein B456_009G224800                    418   2e-142   Gossypium raimondii
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       418   2e-142   Cucumis sativus [cucumbers]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                419   3e-142   Solanum lycopersicum
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   415   3e-142   Citrus sinensis [apfelsine]
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                419   3e-142   Nicotiana tomentosiformis
dbj|BAH19954.1|  AT1G50010                                              411   3e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            409   9e-142   
gb|AAW57306.1|  alpha-tubulin                                           410   1e-141   Ceratopteris richardii
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            414   1e-141   Oryza sativa Japonica Group [Japonica rice]
gb|AFW67749.1|  alpha tubulin4                                          412   1e-141   
gb|ADW83724.1|  alpha-tubulin                                           416   1e-141   Musa acuminata AAA Group [Cavendish banana]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              417   2e-141   Medicago truncatula
gb|AFW67748.1|  alpha tubulin4                                          414   2e-141   
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   416   2e-141   Citrus sinensis [apfelsine]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              417   2e-141   Cucumis sativus [cucumbers]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     416   2e-141   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                416   2e-141   Cucumis sativus [cucumbers]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        416   3e-141   Cucumis melo [Oriental melon]
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          416   3e-141   Malus domestica [apple tree]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     416   3e-141   Eucalyptus grandis [rose gum]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     416   3e-141   Vitis vinifera
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                416   3e-141   Cucumis sativus [cucumbers]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   416   3e-141   Fragaria vesca subsp. vesca
ref|XP_001764722.1|  predicted protein                                  416   3e-141   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              416   3e-141   
gb|ABX57816.1|  alpha tubulin                                           416   3e-141   Picea wilsonii
gb|ABO47739.1|  alpha-tubulin                                           416   3e-141   Gossypium hirsutum [American cotton]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             416   3e-141   Citrus clementina [clementine]
gb|AAV92352.1|  alpha tubulin 1                                         416   3e-141   Pseudotsuga menziesii var. menziesii
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                416   3e-141   Vitis vinifera
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     416   3e-141   Nelumbo nucifera [Indian lotus]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     416   3e-141   Phoenix dactylifera
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     416   3e-141   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     416   3e-141   Pyrus x bretschneideri [bai li]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         416   3e-141   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           416   3e-141   Betula pendula [white birch]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Phoenix dactylifera
gb|ACN40181.1|  unknown                                                 416   4e-141   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     416   4e-141   Vitis vinifera
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Elaeis guineensis
gb|KHG18997.1|  Tubulin alpha chain                                     416   4e-141   Gossypium arboreum [tree cotton]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Elaeis guineensis
ref|XP_002510010.1|  tubulin alpha chain, putative                      416   4e-141   Ricinus communis
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Tarenaya hassleriana [spider flower]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                416   4e-141   Prunus dulcis [sweet almond]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             416   4e-141   Prunus persica
gb|ABO47740.1|  alpha-tubulin                                           416   4e-141   Gossypium hirsutum [American cotton]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Tarenaya hassleriana [spider flower]
gb|AIX10966.1|  tubulin                                                 416   4e-141   Ornithogalum longebracteatum [sea-onion]
ref|NP_001289660.1|  tubulin alpha chain-like                           416   4e-141   Eucalyptus grandis [rose gum]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             416   4e-141   Citrus clementina [clementine]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   416   4e-141   Nelumbo nucifera [Indian lotus]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              416   4e-141   Theobroma cacao [chocolate]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             416   4e-141   Selaginella moellendorffii
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Nelumbo nucifera [Indian lotus]
gb|ABO47736.1|  alpha-tubulin                                           416   4e-141   Gossypium hirsutum [American cotton]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              416   4e-141   Medicago truncatula
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          416   4e-141   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Pyrus x bretschneideri [bai li]
gb|AID52921.1|  tubulin alpha chain                                     416   4e-141   Carthamus tinctorius
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Cicer arietinum [garbanzo]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               416   4e-141   Pisum sativum [garden pea]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    416   4e-141   Gossypium hirsutum [American cotton]
ref|XP_010093625.1|  Tubulin alpha chain                                416   4e-141   Morus notabilis
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         416   4e-141   Jatropha curcas
ref|XP_002522104.1|  tubulin alpha chain, putative                      416   4e-141   Ricinus communis
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                416   4e-141   Nelumbo nucifera [Indian lotus]
gb|KIY91712.1|  Tubulin alpha chain                                     408   4e-141   Monoraphidium neglectum
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   416   5e-141   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    416   5e-141   Citrus sinensis [apfelsine]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             416   5e-141   Prunus persica
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                416   5e-141   Elaeis guineensis
ref|XP_007042689.1|  Tubulin alpha-2 chain                              416   5e-141   Theobroma cacao [chocolate]
ref|XP_010099392.1|  Tubulin alpha chain                                416   5e-141   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             416   5e-141   Phaseolus vulgaris [French bean]
ref|XP_002517492.1|  tubulin alpha chain, putative                      416   5e-141   Ricinus communis
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        416   5e-141   Glycine max [soybeans]
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         416   5e-141   Jatropha curcas
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             416   5e-141   Populus trichocarpa [western balsam poplar]
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              416   5e-141   Setaria italica
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     416   6e-141   Vitis vinifera
gb|ABK92520.1|  unknown                                                 416   6e-141   Populus trichocarpa [western balsam poplar]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   416   6e-141   Populus euphratica
gb|AHJ80823.1|  Tua1                                                    416   6e-141   Eragrostis tef [tef]
gb|AGG37283.1|  alpha-tubulin 1                                         416   6e-141   Salix arbutifolia
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    416   6e-141   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          416   6e-141   Miscanthus sinensis
dbj|BAJ06362.1|  alpha-tubulin                                          416   6e-141   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   416   6e-141   Brachypodium distachyon [annual false brome]
gb|AIX10773.1|  alpha tubulin                                           416   6e-141   Panax notoginseng [san-qi]
gb|KHN08201.1|  Tubulin alpha chain                                     416   7e-141   Glycine soja [wild soybean]
gb|AGG37285.1|  alpha-tubulin 3                                         416   7e-141   Salix arbutifolia
ref|XP_008621874.1|  tubulin alpha                                      409   7e-141   Saprolegnia diclina VS20
ref|NP_001167663.1|  tubulin alpha-3 chain                              416   7e-141   Zea mays [maize]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              416   7e-141   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   416   7e-141   Zea mays [maize]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             415   8e-141   Hordeum vulgare [barley]
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             415   8e-141   Anemia phyllitidis
gb|ABQ59633.1|  alpha-tubulin 3                                         415   8e-141   Populus tremuloides
gb|AGG37289.1|  alpha-tubulin 7                                         415   8e-141   Salix arbutifolia
gb|AEQ75493.1|  alpha-tubulin                                           415   8e-141   Rosa multiflora [Japanese rose]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     415   8e-141   Populus euphratica
gb|ABO47742.1|  alpha-tubulin                                           415   9e-141   Gossypium hirsutum [American cotton]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              415   1e-140   Fragaria vesca subsp. vesca
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 415   1e-140   Populus trichocarpa [western balsam poplar]
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             415   1e-140   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              415   1e-140   Oryza brachyantha
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              414   1e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                415   1e-140   Phoenix dactylifera
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             415   1e-140   Prunus persica
gb|AAB36609.1|  alpha-tubulin                                           412   1e-140   Eucalyptus globulus subsp. bicostata
tpg|DAA51109.1|  TPA: alpha tubulin                                     415   1e-140   
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          415   1e-140   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          415   1e-140   Citrus sinensis [apfelsine]
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   415   1e-140   Malus domestica [apple tree]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        415   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              415   1e-140   Oryza brachyantha
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                415   1e-140   Fragaria vesca subsp. vesca
ref|XP_002959708.1|  alpha tubulin                                      407   1e-140   Volvox carteri f. nagariensis
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             415   1e-140   Phaseolus vulgaris [French bean]
dbj|BAG99724.1|  unnamed protein product                                414   1e-140   Oryza sativa Japonica Group [Japonica rice]
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   414   1e-140   Citrus sinensis [apfelsine]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              415   1e-140   Populus euphratica
gb|KEH43997.1|  tubulin beta-1 chain                                    414   1e-140   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                414   1e-140   Cicer arietinum [garbanzo]
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     414   1e-140   Glycine max [soybeans]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    414   1e-140   Gossypium hirsutum [American cotton]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     414   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    415   1e-140   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             414   1e-140   Prunus persica
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              414   1e-140   Oryza brachyantha
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    414   1e-140   Glycine max [soybeans]
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                414   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   414   1e-140   Citrus sinensis [apfelsine]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             414   2e-140   Phaseolus vulgaris [French bean]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              414   2e-140   Glycine max [soybeans]
gb|AAB08791.1|  alpha tubulin                                           414   2e-140   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN42598.1|  Tubulin alpha-2 chain                                   414   2e-140   Glycine soja [wild soybean]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    414   2e-140   Glycine max [soybeans]
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                414   2e-140   Eucalyptus grandis [rose gum]
gb|AAO73546.1|  alpha-tubulin                                           414   2e-140   Ceratopteris richardii
gb|ABD92930.1|  alpha tubulin-2A                                        414   2e-140   Triticum aestivum [Canadian hard winter wheat]
emb|CDO97305.1|  unnamed protein product                                414   2e-140   Coffea canephora [robusta coffee]
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                414   3e-140   Triticum aestivum [Canadian hard winter wheat]
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             414   3e-140   Hordeum vulgare [barley]
gb|ABQ59634.1|  alpha-tubulin 5                                         414   3e-140   Populus tremuloides
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             414   3e-140   Selaginella moellendorffii
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    414   3e-140   Tarenaya hassleriana [spider flower]
gb|AHJ80817.1|  Tua1                                                    414   4e-140   Eragrostis tef [tef]
ref|XP_007515802.1|  alpha-tubulin                                      412   4e-140   Bathycoccus prasinos
emb|CAA06619.1|  alpha-tubulin 1                                        413   4e-140   Eleusine indica [crabgrass]
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     413   4e-140   Sesamum indicum [beniseed]
emb|CAB66336.1|  alpha-tubulin                                          413   4e-140   Betula pendula [white birch]
dbj|BAC24800.1|  alpha tubulin                                          413   4e-140   Physcomitrella patens
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             413   4e-140   Eutrema salsugineum [saltwater cress]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             413   4e-140   Populus trichocarpa [western balsam poplar]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   413   5e-140   Vitis vinifera
dbj|BAP59012.1|  alpha tubulin                                          413   5e-140   Taxus cuspidata [ichii]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             413   5e-140   Capsella rubella
gb|ACU20294.1|  unknown                                                 409   5e-140   Glycine max [soybeans]
gb|AGG37287.1|  alpha-tubulin 5                                         413   5e-140   Salix arbutifolia
ref|XP_007047652.1|  Tubulin alpha-2 chain                              415   6e-140   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                413   7e-140   Populus euphratica
gb|KHG20487.1|  Tubulin alpha chain                                     413   8e-140   Gossypium arboreum [tree cotton]
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    412   8e-140   Gossypium hirsutum [American cotton]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                411   8e-140   Erythranthe guttata [common monkey flower]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                412   9e-140   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA62916.1|  alpha-tubulin                                          412   1e-139   Oryza sativa Japonica Group [Japonica rice]
gb|AEW46684.1|  beta-tubulin                                            412   1e-139   Ulva linza
gb|ABV55999.1|  alpha-tubulin 7                                         412   1e-139   Populus tremuloides
gb|ABL61201.1|  alpha-tubulin                                           407   1e-139   Oxymonadida environmental sample
ref|XP_011398411.1|  Tubulin alpha chain                                410   1e-139   Auxenochlorella protothecoides
gb|AAO46127.1|  alpha-tubulin                                           405   1e-139   Streblomastix strix
gb|ACK76232.1|  alpha-tubulin                                           412   1e-139   Dimocarpus longan [longan]
ref|NP_001051132.1|  Os03g0726100                                       412   1e-139   
gb|AHJ80815.1|  Tua1                                                    412   1e-139   Eragrostis tef [tef]
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              412   2e-139   
emb|CAD20821.1|  alpha tubulin                                          405   2e-139   Zea mays [maize]
emb|CDY66630.1|  BnaCnng51680D                                          411   2e-139   Brassica napus [oilseed rape]
gb|AFK33477.1|  unknown                                                 408   2e-139   Lotus japonicus
emb|CDY29334.1|  BnaA05g16010D                                          411   2e-139   Brassica napus [oilseed rape]
gb|ABL61216.1|  alpha-tubulin                                           407   2e-139   Oxymonadida environmental sample
gb|ACU19580.1|  unknown                                                 411   2e-139   Glycine max [soybeans]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          411   2e-139   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ06364.1|  alpha-tubulin                                          411   3e-139   Alopecurus aequalis
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              411   3e-139   Brachypodium distachyon [annual false brome]
gb|ABL61215.1|  alpha-tubulin                                           406   3e-139   Oxymonadida environmental sample
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    411   3e-139   Arabis alpina [alpine rockcress]
gb|ABK92552.1|  unknown                                                 411   3e-139   Populus trichocarpa [western balsam poplar]
gb|ABL61212.1|  alpha-tubulin                                           406   3e-139   Oxymonadida environmental sample
gb|ABR25510.1|  tubulin alpha-1 chain                                   404   3e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        411   3e-139   Camelina sativa [gold-of-pleasure]
ref|NP_171974.1|  tubulin alpha-4 chain                                 411   4e-139   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             411   4e-139   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193232.1|  tubulin alpha-6 chain                                 411   4e-139   Arabidopsis thaliana [mouse-ear cress]
gb|ABD92937.1|  alpha tubulin-4A                                        411   4e-139   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92936.1|  alpha tubulin-4D                                        411   4e-139   Triticum aestivum [Canadian hard winter wheat]
gb|AFR42026.1|  alpha-tubulin                                           401   4e-139   Populus trichocarpa [western balsam poplar]
ref|XP_005851144.1|  alpha-tubulin                                      410   4e-139   Chlorella variabilis
gb|KJB29387.1|  hypothetical protein B456_005G097800                    410   5e-139   Gossypium raimondii
gb|ABG78593.1|  alpha-tubulin                                           410   5e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    410   5e-139   Brassica rapa
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   410   5e-139   Monoraphidium neglectum
ref|XP_001777110.1|  predicted protein                                  407   5e-139   
gb|ETM52928.1|  tubulin alpha chain                                     409   6e-139   Phytophthora parasitica
gb|AFR42020.1|  alpha-tubulin                                           401   6e-139   Populus trichocarpa [western balsam poplar]
ref|NP_001067613.1|  Os11g0247300                                       410   6e-139   
gb|ABL61202.1|  alpha-tubulin                                           405   6e-139   Oxymonadida environmental sample
ref|XP_005651460.1|  tubulin alpha chain                                410   7e-139   Coccomyxa subellipsoidea C-169
gb|ABL61224.1|  alpha-tubulin                                           405   7e-139   Oxymonadida environmental sample
ref|XP_005643073.1|  tubulin alpha chain                                410   7e-139   Coccomyxa subellipsoidea C-169
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     410   7e-139   Helicosporidium sp. ATCC 50920
gb|AAO46130.1|  alpha-tubulin                                           402   8e-139   Streblomastix strix
gb|KIZ03400.1|  Tubulin alpha chain                                     410   9e-139   Monoraphidium neglectum
gb|ABL61219.1|  alpha-tubulin                                           405   9e-139   Oxymonadida environmental sample
emb|CAL35827.1|  alpha-2 tubulin                                        402   9e-139   Plantago major [cart-track plant]
gb|AAO46128.1|  alpha-tubulin                                           402   1e-138   Streblomastix strix
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   409   1e-138   Brassica rapa
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  409   1e-138   Ostreococcus tauri
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                410   1e-138   
gb|ABL61213.1|  alpha-tubulin                                           404   2e-138   Oxymonadida environmental sample
ref|XP_010104543.1|  Tubulin alpha chain                                409   2e-138   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    409   2e-138   Glycine max [soybeans]
gb|ABL61227.1|  alpha-tubulin                                           404   2e-138   Oxymonadida environmental sample
gb|ADJ00012.1|  tubulin alpha chain                                     401   2e-138   Chromera velia
gb|KHN01709.1|  Tubulin alpha chain                                     409   2e-138   Glycine soja [wild soybean]
emb|CDP12358.1|  unnamed protein product                                409   2e-138   Coffea canephora [robusta coffee]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              409   2e-138   Camelina sativa [gold-of-pleasure]
emb|CDW82295.1|  alpha tubulin                                          409   2e-138   Stylonychia lemnae
gb|EJY81124.1|  Alpha tubulin,putative                                  409   2e-138   Oxytricha trifallax
gb|ABL61217.1|  alpha-tubulin                                           404   2e-138   Oxymonadida environmental sample
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              409   2e-138   Camelina sativa [gold-of-pleasure]
gb|AAT09063.1|  alpha tubulin 1                                         409   2e-138   Bigelowiella natans
gb|ABL61203.1|  alpha-tubulin                                           404   2e-138   Oxymonadida environmental sample
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                409   2e-138   Oxytricha granulifera
ref|XP_002508010.1|  alpha tubulin 2                                    409   2e-138   Micromonas commoda
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             409   2e-138   Phaseolus vulgaris [French bean]
gb|AFR42035.1|  alpha-tubulin                                           399   2e-138   Populus alba [abele]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             409   2e-138   
gb|ABL61214.1|  alpha-tubulin                                           404   2e-138   Oxymonadida environmental sample
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              402   2e-138   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  409   3e-138   Brassica napus [oilseed rape]
ref|XP_001419217.1|  predicted protein                                  409   3e-138   Ostreococcus lucimarinus CCE9901
ref|XP_001770881.1|  predicted protein                                  409   3e-138   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             409   3e-138   Citrus clementina [clementine]
gb|AIA82435.1|  alpha-tubulin-like protein 03                           409   3e-138   Stentor coeruleus
gb|AIA82433.1|  alpha-tubulin-like protein 01                           409   3e-138   
gb|ETW27380.1|  tubulin alpha chain                                     403   4e-138   
ref|XP_003058621.1|  alpha tubulin                                      408   4e-138   
gb|EPR58771.1|  alpha tubulin TUBA1                                     407   4e-138   
ref|XP_010096739.1|  Tubulin alpha chain                                408   5e-138   
gb|ABL61204.1|  alpha-tubulin                                           402   5e-138   
ref|XP_002951007.1|  alpha tubulin                                      408   5e-138   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              408   5e-138   
gb|ABL61218.1|  alpha-tubulin                                           403   5e-138   
gb|ABO47737.1|  alpha-tubulin                                           408   5e-138   
emb|CAA62917.1|  alfa-tubulin                                           408   6e-138   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             407   6e-138   
emb|CDJ60085.1|  tubulin alpha chain, putative                          407   6e-138   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             408   6e-138   
emb|CAE52514.1|  alpha tubulin                                          408   6e-138   
gb|AHJ80816.1|  Tua1                                                    408   6e-138   
gb|EWC76931.1|  tubulin alpha chain                                     403   6e-138   
gb|ABL61226.1|  alpha-tubulin                                           403   7e-138   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                408   7e-138   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    399   9e-138   
gb|AAO46126.1|  alpha-tubulin                                           400   9e-138   
gb|ABP65323.1|  alpha tubulin                                           407   1e-137   
ref|XP_002675196.1|  alpha-tubulin                                      407   1e-137   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           407   1e-137   
gb|AFR42036.1|  alpha-tubulin                                           397   1e-137   
ref|XP_007512064.1|  alpha-tubulin                                      407   1e-137   
gb|ETM30643.1|  tubulin alpha chain                                     407   1e-137   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             407   1e-137   
gb|AAT09064.1|  alpha tubulin 2                                         407   1e-137   
gb|ABU93324.1|  tubulin alpha subunit                                   407   1e-137   
gb|ABL61209.1|  alpha-tubulin                                           406   1e-137   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           408   1e-137   
tpg|DAA41189.1|  TPA: alpha tubulin5                                    402   1e-137   
gb|ABL61205.1|  alpha-tubulin                                           406   1e-137   
ref|XP_008872990.1|  tubulin alpha chain                                407   1e-137   
emb|CCI41153.1|  unnamed protein product                                407   1e-137   
ref|XP_008900864.1|  tubulin alpha chain                                407   1e-137   
gb|ABL61086.1|  alpha-tubulin                                           402   1e-137   
gb|ABL61206.1|  alpha-tubulin                                           406   1e-137   
gb|ABL61208.1|  alpha-tubulin                                           406   1e-137   
gb|ABU93323.1|  tubulin alpha subunit                                   407   1e-137   
ref|XP_002904195.1|  alpha-tubulin, putative                            407   1e-137   
tpg|DAA63280.1|  TPA: alpha tubulin6                                    402   1e-137   
gb|KJB83378.1|  hypothetical protein B456_013G244600                    405   1e-137   
ref|XP_002364807.1|  tubulin alpha chain                                407   2e-137   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      402   2e-137   
ref|XP_002904194.1|  alpha-tubulin                                      407   2e-137   
emb|CDJ42547.1|  tubulin alpha chain, putative                          407   2e-137   
gb|ABL61210.1|  alpha-tubulin                                           406   2e-137   
gb|ETM52951.1|  tubulin alpha chain                                     407   2e-137   
emb|CDJ53173.1|  tubulin alpha chain, putative                          407   2e-137   
dbj|BAH20267.1|  AT5G19780                                              400   2e-137   
gb|ADP08782.1|  alpha tubulin                                           407   2e-137   
emb|CDI81818.1|  tubulin alpha chain, putative                          407   2e-137   
ref|XP_001691876.1|  alpha tubulin 1                                    406   2e-137   
gb|AFR42049.1|  alpha-tubulin                                           397   2e-137   
gb|AHJ80821.1|  Tua3                                                    405   2e-137   
gb|AEG74028.1|  alpha-tubulin                                           406   2e-137   
gb|AAZ23863.1|  alpha-tubulin                                           406   2e-137   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             406   3e-137   
ref|XP_009842456.1|  tubulin alpha chain                                406   3e-137   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 406   3e-137   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                406   3e-137   
emb|CCD11782.1|  unnamed protein product                                399   3e-137   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   404   3e-137   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             406   3e-137   
gb|ABL61228.1|  alpha-tubulin                                           401   3e-137   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             406   3e-137   
gb|AEF79970.1|  alpha-tubulin protein                                   406   3e-137   
gb|ETO82054.1|  tubulin alpha chain                                     406   3e-137   
ref|XP_001777081.1|  predicted protein                                  406   4e-137   
ref|XP_001782790.1|  predicted protein                                  406   4e-137   
emb|CBH08958.1|  alpha tubulin, (fragment)                              400   4e-137   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              406   4e-137   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              405   4e-137   
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     403   4e-137   
gb|ACN40824.1|  unknown                                                 405   4e-137   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   405   5e-137   
emb|CDP00974.1|  unnamed protein product                                405   5e-137   
gb|AHJ80820.1|  Tua3                                                    404   5e-137   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             400   5e-137   
gb|ETM53018.1|  tubulin alpha chain                                     398   6e-137   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          405   7e-137   
gb|AFR42042.1|  alpha-tubulin                                           395   7e-137   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                405   7e-137   
emb|CDP17586.1|  unnamed protein product                                405   7e-137   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   405   7e-137   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   405   8e-137   
gb|ETW61813.1|  tubulin alpha chain                                     403   8e-137   
gb|AHJ80822.1|  Tua1                                                    405   8e-137   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              405   9e-137   
gb|AAD11425.1|  alpha tubulin                                           402   9e-137   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             405   9e-137   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              405   9e-137   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             405   1e-136   
gb|EKF29047.1|  epsilon tubulin, putative                               397   1e-136   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 405   1e-136   
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like              405   1e-136   
gb|ABU93321.1|  tubulin alpha subunit                                   405   1e-136   
gb|AFR42054.1|  alpha-tubulin                                           395   1e-136   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              404   1e-136   
gb|AAB86648.1|  alpha-tubulin                                           404   1e-136   
gb|EPY33355.1|  tubulin alpha                                           399   1e-136   
emb|CAL80740.1|  alpha-tubulin                                          404   1e-136   
gb|AGY80453.1|  tubulin                                                 404   1e-136   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             404   1e-136   
gb|EKF28172.1|  epsilon tubulin, putative                               397   1e-136   
gb|AAB86649.1|  alpha-tubulin                                           404   1e-136   
emb|CAA61255.1|  alpha tubulin                                          404   1e-136   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              404   1e-136   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             404   1e-136   
gb|AAX63396.1|  alpha-tubulin                                           404   1e-136   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   404   2e-136   
ref|XP_008877307.1|  tubulin alpha chain                                401   2e-136   
gb|ABB16994.1|  unknown                                                 405   2e-136   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             404   2e-136   
dbj|BAJ06363.1|  alpha-tubulin                                          404   2e-136   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              404   2e-136   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   404   2e-136   
ref|NP_001105324.1|  tubulin alpha-5 chain                              404   2e-136   
gb|ABC97356.1|  alpha tubulin                                           404   2e-136   
gb|AGD80034.1|  alpha-tubulin 1                                         404   2e-136   
ref|NP_001105588.1|  tubulin alpha-6 chain                              404   2e-136   
emb|CAD26891.1|  alpha-tubulin                                          404   2e-136   
gb|ABD92942.1|  alpha tubulin-1D                                        404   2e-136   
gb|ETP23198.1|  tubulin alpha chain                                     401   2e-136   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    404   2e-136   
ref|NP_001060075.1|  Os07g0574800                                       404   2e-136   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                404   2e-136   
gb|EUR72656.1|  hypothetical protein PFBG_02365                         402   2e-136   
gb|ETW20218.1|  tubulin alpha chain                                     402   2e-136   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     404   2e-136   
emb|CAD24765.1|  alpha-tubulin                                          404   2e-136   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    404   2e-136   
gb|EUT86396.1|  tubulin alpha chain                                     402   2e-136   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   404   2e-136   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              404   2e-136   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   404   2e-136   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   404   2e-136   
dbj|BAJ98211.1|  predicted protein                                      404   2e-136   
gb|ETW45898.1|  tubulin alpha chain                                     402   2e-136   
gb|AAO23139.1|  alpha tubulin                                           404   2e-136   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              404   3e-136   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   404   3e-136   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              404   3e-136   
gb|ETW56906.1|  tubulin alpha chain                                     402   3e-136   
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               399   3e-136   
emb|CAD24768.1|  alpha-tubulin                                          403   3e-136   
ref|XP_002532068.1|  tubulin alpha chain, putative                      403   3e-136   
gb|ABO47735.1|  alpha-tubulin                                           403   3e-136   
gb|AAU10519.1|  alpha tubulin                                           396   3e-136   
ref|XP_001427643.1|  hypothetical protein                               396   3e-136   
gb|AGG37284.1|  alpha-tubulin 2                                         403   3e-136   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              403   4e-136   
gb|ABO47741.1|  alpha-tubulin                                           403   4e-136   
gb|ETW57405.1|  tubulin alpha chain                                     402   4e-136   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   403   5e-136   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     403   5e-136   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             403   5e-136   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             403   5e-136   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              403   6e-136   
gb|ABL61230.1|  alpha-tubulin                                           402   6e-136   
ref|XP_001420620.1|  predicted protein                                  403   6e-136   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             400   6e-136   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   403   6e-136   
gb|ETW30983.1|  tubulin alpha chain                                     404   8e-136   
gb|ABR67425.1|  alpha-tubulin 4                                         402   9e-136   
gb|KJB48791.1|  hypothetical protein B456_008G087400                    400   1e-135   
ref|XP_003082284.1|  TBA_CHLVU Tubulin alpha chain (ISS)                402   1e-135   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              402   1e-135   
emb|CEF99848.1|  Tubulin/FtsZ, 2-layer sandwich domain                  402   1e-135   
gb|ETW38327.1|  tubulin alpha chain                                     402   1e-135   
ref|XP_002779172.1|  Tubulin alpha chain, putative                      401   1e-135   
ref|XP_008818311.1|  tubulin alpha chain                                402   1e-135   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   402   1e-135   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   402   1e-135   
emb|CAD26887.1|  alpha-tubulin                                          402   1e-135   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              402   1e-135   
gb|EUD70907.1|  tubulin alpha chain                                     402   1e-135   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              402   1e-135   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              402   1e-135   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        402   1e-135   
emb|CAA65330.1|  alpha-tubulin                                          402   1e-135   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   402   1e-135   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   402   1e-135   
ref|XP_004221286.1|  tubulin alpha chain                                402   1e-135   
emb|CCI45804.1|  unnamed protein product                                402   1e-135   
ref|XP_001615123.1|  tubulin alpha chain                                402   1e-135   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        402   1e-135   
ref|XP_001351526.1|  alpha-tubulin ii                                   402   2e-135   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              402   2e-135   
gb|AGG37286.1|  alpha-tubulin 4                                         402   2e-135   
ref|XP_008625823.1|  tubulin alpha chain                                402   2e-135   
emb|CAA65329.1|  alpha-tubulin                                          401   2e-135   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     401   2e-135   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   400   2e-135   
ref|XP_724313.1|  hypothetical protein                                  401   2e-135   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             401   2e-135   
emb|CCA20146.1|  alpha tubulin 1 putative                               401   2e-135   
emb|CCW60849.1|  unnamed protein product                                399   2e-135   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                401   2e-135   
ref|XP_002258308.1|  alpha tubulin                                      401   3e-135   
emb|CAD26886.1|  alpha-tubulin                                          401   3e-135   
gb|AFR42047.1|  alpha-tubulin                                           391   3e-135   
ref|XP_001351911.1|  alpha tubulin                                      401   3e-135   
ref|XP_001614576.1|  tubulin alpha chain                                401   3e-135   
ref|XP_007014666.1|  Tubulin alpha-5                                    401   3e-135   
emb|CDR11405.1|  alpha tubulin 1, putative                              401   3e-135   
ref|XP_728879.1|  tubulin subunit alpha                                 401   4e-135   
gb|EWM25815.1|  alpha tubulin 1                                         401   4e-135   
gb|AAO63773.2|  alpha-tubulin 2                                         400   4e-135   
gb|EPY40479.1|  tubulin alpha                                           393   4e-135   
gb|AIC33057.1|  tubulin alpha-1 chain                                   400   4e-135   
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         400   5e-135   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              400   5e-135   
gb|ETO12554.1|  hypothetical protein RFI_24821                          402   5e-135   
gb|ACJ04933.1|  alpha tubulin                                           392   6e-135   
ref|XP_002788269.1|  Tubulin alpha chain, putative                      400   6e-135   
gb|EPY39349.1|  tubulin alpha                                           395   6e-135   
emb|CDX88875.1|  BnaA03g07740D                                          400   6e-135   
emb|CAD24766.1|  alpha-tubulin                                          400   6e-135   



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   420 bits (1080),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  51   ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  110

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  111  ITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  170

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  171  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  230

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  231  EGMEEGEFSEAREDLAALEKDY  252



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   422 bits (1084),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  108  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  167

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  168  ITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  227

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  228  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  287

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  288  EGMEEGEFSEAREDLAALEKDY  309



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   417 bits (1073),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 197/201 (98%), Positives = 199/201 (99%), Gaps = 0/201 (0%)
 Frame = -2

Query  756  SQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI  577
            +QVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI
Sbjct  8    TQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI  67

Query  576  TNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF  397
            TNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct  68   TNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF  127

Query  396  KCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGE  217
            KCGINYQPPTVVPGGDLAKVQ+AVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGE
Sbjct  128  KCGINYQPPTVVPGGDLAKVQKAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGE  187

Query  216  GMEEGEFSEAREDLAALEKDY  154
            GMEEGEFSEAREDLAALEKDY
Sbjct  188  GMEEGEFSEAREDLAALEKDY  208



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   419 bits (1077),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  121  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  180

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  181  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  240

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  241  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  300

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  301  EGMEEGEFSEAREDLAALEKDY  322



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   421 bits (1083),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  185  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  244

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  245  ITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  304

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  305  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  364

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  365  EGMEEGEFSEAREDLAALEKDY  386



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   422 bits (1084),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   422 bits (1084),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   414 bits (1063),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  23   VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  82

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  83   ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  142

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  143  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  202

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  203  EGMEEGEFSEAREDLAALEKDY  224



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   422 bits (1084),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   422 bits (1084),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   421 bits (1083),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   421 bits (1083),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   421 bits (1083),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   421 bits (1083),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   421 bits (1083),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   412 bits (1060),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = -2

Query  750  VIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN  571
            VI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITN
Sbjct  1    VISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITN  60

Query  570  SAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC  391
            +AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC
Sbjct  61   TAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC  120

Query  390  GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGM  211
            GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGM
Sbjct  121  GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGM  180

Query  210  EEGEFSEAREDLAALEKDY  154
            EEGEFSEAREDLAALEKDY
Sbjct  181  EEGEFSEAREDLAALEKDY  199



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   414 bits (1065),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  46   VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  105

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  106  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  165

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVG
Sbjct  166  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVG  225

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  226  EGMEEGEFSEAREDLAALEKDY  247



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   421 bits (1083),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   421 bits (1083),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  230  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  289

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  290  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  349

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  350  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  409

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  410  EGMEEGEFSEAREDLAALEKDY  431



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   421 bits (1083),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/202 (99%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   414 bits (1065),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  47   VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  106

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  107  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  166

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVG
Sbjct  167  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVG  226

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  227  EGMEEGEFSEAREDLAALEKDY  248



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   418 bits (1074),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  142  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  201

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  202  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  261

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  262  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  321

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  322  EGMEEGEFSEAREDLAALEKDY  343



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   416 bits (1068),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  87   VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  146

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  147  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  206

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYVG
Sbjct  207  FKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVG  266

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  267  EGMEEGEFSEAREDLAALEKDY  288



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   420 bits (1080),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   420 bits (1080),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  235  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  294

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  295  ITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  354

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  355  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  414

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  415  EGMEEGEFSEAREDLAALEKDY  436



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/202 (99%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRA VHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRALVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   412 bits (1060),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  36   VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  95

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  96   ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  155

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  156  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  215

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDL ALEKDY
Sbjct  216  EGMEEGEFSEAREDLRALEKDY  237



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 199/202 (99%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLT SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  232  ISQVISSLTTSLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  291

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  292  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  351

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  352  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  411

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  412  EGMEEGEFSEAREDLAALEKDY  433



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   413 bits (1062),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+E
Sbjct  69   VSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSE  128

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  129  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  188

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  189  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  248

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  249  EGMEEGEFSEAREDLAALEKDY  270



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   418 bits (1074),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  196  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  255

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  256  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  315

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  316  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  375

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  376  EGMEEGEFSEAREDLAALEKDY  397



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   418 bits (1074),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  196  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  255

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  256  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  315

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  316  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  375

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  376  EGMEEGEFSEAREDLAALEKDY  397



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   415 bits (1067),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  135  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  194

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  195  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  254

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  255  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  314

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  315  EGMEEGEFSEAREDLAALEKDY  336



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   411 bits (1056),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  29   VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  88

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  89   ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  148

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  149  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  208

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  209  EGMEEGEFSEAREDLAALEKDY  230



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   409 bits (1051),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = -2

Query  750  VIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN  571
            VI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITN
Sbjct  1    VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITN  60

Query  570  SAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC  391
            SAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC
Sbjct  61   SAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC  120

Query  390  GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGM  211
            GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGM
Sbjct  121  GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGM  180

Query  210  EEGEFSEAREDLAALEKDY  154
            EEGEFSEAREDLAALEKDY
Sbjct  181  EEGEFSEAREDLAALEKDY  199



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   410 bits (1054),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  37   ISQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  96

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACC+M+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTG
Sbjct  97   ITNSAFEPASMMAKCDPRHGKYMACCMMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTG  156

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS+AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  157  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSIAEVFSRLDHKFDLMYAKRAFVHWYVG  216

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKD+
Sbjct  217  EGMEEGEFSEAREDLAALEKDF  238



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   414 bits (1063),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  126  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  185

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  186  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  245

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVG
Sbjct  246  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVG  305

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  306  EGMEEGEFSEAREDLAALEKDY  327



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  101  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  160

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  161  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  220

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  221  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  280

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  281  EGMEEGEFSEAREDLAALEKDY  302



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   416 bits (1070),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  203  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  262

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  263  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  322

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  323  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  382

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  383  EGMEEGEFSEAREDLAALEKDY  404



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   414 bits (1063),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  144  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  203

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  204  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  263

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  264  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  323

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  324  EGMEEGEFSEAREDLAALEKDY  345



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   416 bits (1069),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  212  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  271

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  272  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  331

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  332  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  391

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  392  EGMEEGEFSEAREDLAALEKDY  413



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   416 bits (1068),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  216  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  275

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  276  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  335

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  336  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  395

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  396  EGMEEGEFSEAREDLAALEKDY  417



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLA+VQRAVC ISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLARVQRAVCKISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   408 bits (1049),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ++QVI SLT SLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  29   VAQVISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  88

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTG
Sbjct  89   ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTG  148

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  149  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVG  208

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  209  EGMEEGEFSEAREDLAALEKDY  230



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            IT SAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITTSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   416 bits (1070),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  247  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  306

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  307  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  366

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  367  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  426

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  427  EGMEEGEFSEAREDLAALEKDY  448



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+E
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   416 bits (1068),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  236  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  295

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  296  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  355

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  356  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  415

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  416  EGMEEGEFSEAREDLAALEKDY  437



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   416 bits (1068),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   409 bits (1050),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  51   IAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  110

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  111  ITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  170

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  171  FKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVG  230

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  231  EGMEEGEFSEAREDLAALEKDY  252



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   416 bits (1068),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   416 bits (1068),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   416 bits (1068),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            +TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  VTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   415 bits (1066),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  220  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  279

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  280  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  339

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  340  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  399

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  400  EGMEEGEFSEAREDLAALEKDY  421



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            +TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  VTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   415 bits (1067),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            IT+SAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITSSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  234  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  293

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            +TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  294  VTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  353

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  354  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  413

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  414  EGMEEGEFSEAREDLAALEKDY  435



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABF98641.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG95437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   414 bits (1063),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  196  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  255

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  256  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  315

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  316  FKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVG  375

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  376  EGMEEGEFSEAREDLAALEKDY  397



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+E
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   412 bits (1059),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  161  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  220

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
             TNSAFEPSS+M KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  221  TTNSAFEPSSLMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  280

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST +AEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  281  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTRLAEVFSRIDHKFDLMYAKRAFVHWYVG  340

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  341  EGMEEGEFSEAREDLAALEKDY  362



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  232  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  291

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  292  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  351

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  352  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  411

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  412  EGMEEGEFSEAREDLAALEKDY  433



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  232  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  291

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  292  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  351

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  352  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  411

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  412  EGMEEGEFSEAREDLAALEKDY  433



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP++VPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSIVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   407 bits (1047),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAP+ISAEKAYHEQLSVAE
Sbjct  35   IAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAE  94

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEP+SMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  95   ITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  154

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++ E+FSR+DHKFDLMY KRAFVHWYVG
Sbjct  155  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYVG  214

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKD+
Sbjct  215  EGMEEGEFSEAREDLAALEKDF  236



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFV+WCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVEWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>dbj|BAG99724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   414 bits (1063),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  196  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  255

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  256  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  315

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  316  FKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVG  375

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  376  EGMEEGEFSEAREDLAALEKDY  397



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  227  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  286

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  287  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  346

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  347  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  406

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  407  EGMEEGEFSEAREDLAALEKDY  428



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAF+HWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFIHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP++VPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSIVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVA+VFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVADVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AAB08791.1| alpha tubulin [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>emb|CDO97305.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDG+LNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGSLNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDL+ VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLSGVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   414 bits (1064),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   414 bits (1064),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   414 bits (1064),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   414 bits (1064),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   414 bits (1063),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV+TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   414 bits (1063),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQ NLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQANLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   412 bits (1059),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  196  IAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  255

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTG
Sbjct  256  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTG  315

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  316  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVG  375

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  376  EGMEEGEFSEAREDLAALEKDY  397



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   413 bits (1062),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SL ASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLIASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   413 bits (1062),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAP ISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPAISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   413 bits (1062),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   413 bits (1062),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKF LMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFGLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   413 bits (1062),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   413 bits (1062),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   413 bits (1062),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   413 bits (1062),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDRKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   413 bits (1062),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ACU20294.1| unknown [Glycine max]
Length=339

 Score =   409 bits (1051),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSV E
Sbjct  120  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVGE  179

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV  IKTKRTIQFVDWCPTG
Sbjct  180  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGIIKTKRTIQFVDWCPTG  239

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  240  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  299

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEG+FSEAREDLAALEKDY
Sbjct  300  EGMEEGKFSEAREDLAALEKDY  321



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   413 bits (1062),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   415 bits (1066),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  281  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  340

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  341  ITNSTFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  401  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  460

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  461  EGMEEGEFSEAREDLAALEKDY  482



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   413 bits (1061),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   413 bits (1061),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   412 bits (1060),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EF+TNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFRTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQF DWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFADWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   411 bits (1057),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 194/201 (97%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  756  SQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI  577
            + VI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI
Sbjct  198  TDVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI  257

Query  576  TNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF  397
            TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct  258  TNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF  317

Query  396  KCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGE  217
            KCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGE
Sbjct  318  KCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGE  377

Query  216  GMEEGEFSEAREDLAALEKDY  154
            GMEEGEFSEAREDLAALEKDY
Sbjct  378  GMEEGEFSEAREDLAALEKDY  398



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   412 bits (1060),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFE SSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFETSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>emb|CAA62916.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   412 bits (1060),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AEW46684.1| beta-tubulin [Ulva linza]
Length=452

 Score =   412 bits (1060),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  IAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   412 bits (1059),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            +TNSAFEPSSMM KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  VTNSAFEPSSMMAKCDPRRGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   407 bits (1045),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  79   IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  138

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  139  ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  198

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVG
Sbjct  199  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVG  258

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  259  EGMEEGEFSEAREDLAALEKDY  280



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   410 bits (1054),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  175  IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  234

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPTG
Sbjct  235  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPTG  294

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  295  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVG  354

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  355  EGMEEGEFSEAREDLAALEKDY  376



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   405 bits (1040),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  30   IGQVISSLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  89

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  90   ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  149

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FK GINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  150  FKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVG  209

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  210  EGMEEGEFSEAREDLAALEKDY  231



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   412 bits (1059),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGA NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGAPNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   412 bits (1059),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   412 bits (1059),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +S VI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSXVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   412 bits (1058),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRXGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   405 bits (1041),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQ+I SLT SLRFDGA+NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV E
Sbjct  55   ISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPE  114

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTG
Sbjct  115  ITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTG  174

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  175  FKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVG  234

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  235  EGMEEGEFSEAREDLAALEKDY  256



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   411 bits (1057),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AFK33477.1| unknown [Lotus japonicus]
Length=352

 Score =   408 bits (1049),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  133  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  192

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV +IKTKRTIQFVDWCPTG
Sbjct  193  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGSIKTKRTIQFVDWCPTG  252

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVG
Sbjct  253  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDVKFDLMYSKRAFVHWYVG  312

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  313  EGMEEGEFSEAREDLAALEKDY  334



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   411 bits (1056),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  212  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  271

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  272  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  331

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  332  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  391

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  392  EGMEEGEFSEAREDLAALEKDY  413



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   407 bits (1045),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  94   IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  153

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  154  ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  213

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVG
Sbjct  214  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVG  273

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  274  EGMEEGEFSEAREDLAALEKDY  295



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   411 bits (1057),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEF EAREDLAALEKDY
Sbjct  411  EGMEEGEFFEAREDLAALEKDY  432



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   411 bits (1057),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   411 bits (1057),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+E
Sbjct  231  VSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   411 bits (1057),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+E
Sbjct  231  VSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   406 bits (1043),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  94   IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  153

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  154  ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  213

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVG
Sbjct  214  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVG  273

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  274  EGMEEGEFSEAREDLAALEKDY  295



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   411 bits (1056),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   411 bits (1056),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  ISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRA CMISNSTSVAEVFSRID KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAFCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   406 bits (1043),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  94   IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  153

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  154  ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  213

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVG
Sbjct  214  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVG  273

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  274  EGMEEGEFSEAREDLAALEKDY  295



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   404 bits (1037),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQ+I SLT SLRFDGA+NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV E
Sbjct  36   ISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPE  95

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTG
Sbjct  96   ITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTG  155

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  156  FKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVG  215

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  216  EGMEEGEFSEAREDLAALEKDY  237



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   411 bits (1056),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+E
Sbjct  231  VSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+E
Sbjct  231  VSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   401 bits (1031),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 189/193 (98%), Positives = 190/193 (98%), Gaps = 0/193 (0%)
 Frame = -2

Query  732  ASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  553
            ASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS
Sbjct  1    ASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  60

Query  552  SMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  373
            SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP
Sbjct  61   SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  120

Query  372  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFS  193
            PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFS
Sbjct  121  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS  180

Query  192  EAREDLAALEKDY  154
            EAREDLAALEKDY
Sbjct  181  EAREDLAALEKDY  193



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   410 bits (1055),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   410 bits (1055),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABG78593.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   410 bits (1055),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   410 bits (1055),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KIZ01406.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=451

 Score =   410 bits (1055),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ++QVI SLT SLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VAQVISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   407 bits (1045),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQ+I SLT SLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV E
Sbjct  126  ISQIISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPE  185

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTG
Sbjct  186  ITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTG  245

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  246  FKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVG  305

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  306  EGMEEGEFSEAREDLAALEKDY  327



>gb|ETM52928.1| tubulin alpha chain, partial [Phytophthora parasitica]
 gb|ETM52931.1| tubulin alpha chain, partial [Phytophthora parasitica]
Length=398

 Score =   409 bits (1050),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  176  IAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  235

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  236  ITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  295

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  296  FKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVG  355

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  356  EGMEEGEFSEAREDLAALEKDY  377



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   401 bits (1030),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 189/193 (98%), Positives = 190/193 (98%), Gaps = 0/193 (0%)
 Frame = -2

Query  732  ASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  553
            ASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS
Sbjct  1    ASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS  60

Query  552  SMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  373
            SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP
Sbjct  61   SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP  120

Query  372  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFS  193
            PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFS
Sbjct  121  PTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS  180

Query  192  EAREDLAALEKDY  154
            EAREDLAALEKDY
Sbjct  181  EAREDLAALEKDY  193



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   410 bits (1055),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            +SQVI SLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61202.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   405 bits (1040),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  79   IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  138

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  139  ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  198

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KF+LMY KRAFVHWYVG
Sbjct  199  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFELMYAKRAFVHWYVG  258

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  259  EGMEEGEFSEAREDLAALEKDY  280



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   410 bits (1054),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSY+PVISAEKAYHEQLSVAE
Sbjct  231  IAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYSPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   405 bits (1041),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI S+TASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  94   IAQVISSMTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  153

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  154  ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  213

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVG
Sbjct  214  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVG  273

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  274  EGMEEGEFSEAREDLAALEKDY  295



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   410 bits (1054),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSY+PVISAEKAYHEQLSVAE
Sbjct  231  IAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYSPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|KDD76276.1| tubulin/FtsZ GTPase [Helicosporidium sp. ATCC 50920]
Length=450

 Score =   410 bits (1054),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|AAO46130.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   402 bits (1034),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSY PVISAEKAYHEQLSVAE
Sbjct  30   IGQVISSLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSSYTPVISAEKAYHEQLSVAE  89

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  90   ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  149

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FK GINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  150  FKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVG  209

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  210  EGMEEGEFSEAREDLAALEKDY  231



>gb|KIZ03400.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=451

 Score =   410 bits (1054),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ++QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  231  VAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  290

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTG
Sbjct  291  ITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTG  350

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYVG
Sbjct  351  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVG  410

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  411  EGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61219.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   405 bits (1040),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I+QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  94   IAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  153

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  154  ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  213

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSRID KFDLMY KRAF HWYVG
Sbjct  214  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRIDRKFDLMYAKRAFAHWYVG  273

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  274  EGMEEGEFSEAREDLAALEKDY  295



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   402 bits (1034),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            ISQ+I SLT SLRFDGA+NVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLS+ E
Sbjct  30   ISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPE  89

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPTG
Sbjct  90   ITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTG  149

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVG
Sbjct  150  FKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVG  209

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  210  EGMEEGEFSEAREDLAALEKDY  231



>gb|AAO46128.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   402 bits (1033),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  759  ISQVIXSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  580
            I QVI SLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE
Sbjct  30   IGQVISSLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE  89

Query  579  ITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  400
            ITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
Sbjct  90   ITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG  149

Query  399  FKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVG  220
            FK GINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFD MY KRAFVHWYVG
Sbjct  150  FKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDSMYAKRAFVHWYVG  209

Query  219  EGMEEGEFSEAREDLAALEKDY  154
            EGMEEGEFSEAREDLAALEKDY
Sbjct  210  EGMEEGEFSEAREDLAALEKDY  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680