BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003D09

Length=779
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006483934.1|  PREDICTED: copper amine oxidase 1-like             377   1e-121   Citrus sinensis [apfelsine]
ref|XP_009802912.1|  PREDICTED: peroxisomal primary amine oxidase...    375   5e-121   Nicotiana sylvestris
ref|XP_006438284.1|  hypothetical protein CICLE_v10030749mg             372   6e-121   
gb|KDO82258.1|  hypothetical protein CISIN_1g004080mg                   372   7e-121   Citrus sinensis [apfelsine]
ref|XP_009600855.1|  PREDICTED: copper amine oxidase 1-like             374   2e-120   Nicotiana tomentosiformis
gb|KDO82257.1|  hypothetical protein CISIN_1g004080mg                   374   2e-120   Citrus sinensis [apfelsine]
ref|XP_006438285.1|  hypothetical protein CICLE_v10030749mg             374   2e-120   Citrus clementina [clementine]
ref|XP_004239124.1|  PREDICTED: copper amine oxidase 1                  373   3e-120   Solanum lycopersicum
ref|XP_006438286.1|  hypothetical protein CICLE_v10030749mg             373   3e-120   
ref|XP_007044778.1|  Copper amine oxidase family protein isoform 2      372   5e-120   
gb|AGZ20104.1|  copper methylamine oxidase-like protein                 371   8e-120   Camellia sinensis [black tea]
ref|XP_004509661.1|  PREDICTED: copper methylamine oxidase-like i...    371   8e-120   Cicer arietinum [garbanzo]
ref|XP_010102489.1|  Putative primary amine oxidase 2                   369   2e-119   
ref|XP_010251089.1|  PREDICTED: copper amine oxidase 1-like isofo...    370   2e-119   Nelumbo nucifera [Indian lotus]
ref|XP_007044777.1|  Copper amine oxidase family protein isoform 1      371   3e-119   
ref|XP_010251088.1|  PREDICTED: copper amine oxidase 1-like isofo...    370   3e-119   Nelumbo nucifera [Indian lotus]
ref|XP_007153778.1|  hypothetical protein PHAVU_003G064200g             370   4e-119   Phaseolus vulgaris [French bean]
ref|XP_010248627.1|  PREDICTED: copper amine oxidase 1-like             370   4e-119   Nelumbo nucifera [Indian lotus]
ref|XP_006357609.1|  PREDICTED: copper amine oxidase 1-like             369   7e-119   Solanum tuberosum [potatoes]
ref|XP_003519633.1|  PREDICTED: copper amine oxidase 1-like             369   9e-119   Glycine max [soybeans]
ref|XP_011045265.1|  PREDICTED: copper amine oxidase 1-like isofo...    367   1e-118   Populus euphratica
gb|KJB50258.1|  hypothetical protein B456_008G160800                    369   2e-118   Gossypium raimondii
ref|XP_002314600.1|  copper amine oxidase family protein                366   2e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011045264.1|  PREDICTED: copper amine oxidase 1-like isofo...    368   2e-118   Populus euphratica
gb|KHN00390.1|  Copper methylamine oxidase                              368   2e-118   Glycine soja [wild soybean]
gb|KJB50254.1|  hypothetical protein B456_008G160800                    369   2e-118   Gossypium raimondii
ref|XP_004301007.1|  PREDICTED: copper amine oxidase 1-like             368   3e-118   Fragaria vesca subsp. vesca
gb|KHG02854.1|  Copper methylamine oxidase                              368   5e-118   Gossypium arboreum [tree cotton]
ref|XP_008389732.1|  PREDICTED: copper amine oxidase 1-like isofo...    367   1e-117   Malus domestica [apple tree]
ref|XP_008389733.1|  PREDICTED: copper amine oxidase 1-like isofo...    366   1e-117   
gb|KHG02564.1|  Primary amine oxidase                                   365   1e-117   Gossypium arboreum [tree cotton]
ref|XP_002277961.1|  PREDICTED: copper amine oxidase 1-like             366   2e-117   Vitis vinifera
gb|KJB15626.1|  hypothetical protein B456_002G186900                    364   6e-117   Gossypium raimondii
gb|AIS23648.1|  amine oxidase 5                                         365   6e-117   Malus domestica [apple tree]
ref|XP_010682433.1|  PREDICTED: copper amine oxidase 1-like             364   7e-117   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW86673.1|  hypothetical protein EUGRSUZ_B032971                    350   7e-117   Eucalyptus grandis [rose gum]
gb|AIS23644.1|  amine oxidase 1                                         364   1e-116   Malus domestica [apple tree]
ref|XP_008380537.1|  PREDICTED: copper amine oxidase 1-like             364   1e-116   
ref|XP_007036329.1|  Copper amine oxidase family protein isoform 1      363   3e-116   
emb|CDP13211.1|  unnamed protein product                                346   4e-116   Coffea canephora [robusta coffee]
ref|XP_002511334.1|  copper amine oxidase, putative                     361   2e-115   Ricinus communis
ref|XP_010533488.1|  PREDICTED: copper amine oxidase 1-like             360   3e-115   Tarenaya hassleriana [spider flower]
gb|KHG07734.1|  Primary amine oxidase                                   360   3e-115   Gossypium arboreum [tree cotton]
ref|XP_009362949.1|  PREDICTED: copper amine oxidase 1-like             360   3e-115   Pyrus x bretschneideri [bai li]
gb|AIS23647.1|  amine oxidase 4                                         360   4e-115   Malus domestica [apple tree]
ref|XP_008367500.1|  PREDICTED: copper amine oxidase 1-like             360   4e-115   
ref|XP_009345773.1|  PREDICTED: copper amine oxidase 1-like             360   5e-115   Pyrus x bretschneideri [bai li]
ref|XP_008464520.1|  PREDICTED: copper amine oxidase 1 isoform X2       357   5e-115   Cucumis melo [Oriental melon]
ref|XP_008464519.1|  PREDICTED: copper amine oxidase 1 isoform X1       359   1e-114   Cucumis melo [Oriental melon]
gb|KHN13432.1|  Copper methylamine oxidase                              357   2e-114   Glycine soja [wild soybean]
gb|KJB19706.1|  hypothetical protein B456_003G116000                    358   2e-114   Gossypium raimondii
ref|XP_003551224.1|  PREDICTED: peroxisomal primary amine oxidase...    357   4e-114   Glycine max [soybeans]
gb|AES96091.2|  copper amine oxidase, enzyme domain protein             356   5e-114   Medicago truncatula
ref|XP_006584631.1|  PREDICTED: peroxisomal copper-containing ami...    356   6e-114   
emb|CAN62304.1|  hypothetical protein VITISV_023689                     354   8e-114   Vitis vinifera
ref|XP_010646479.1|  PREDICTED: copper amine oxidase 1 isoform X2       354   8e-114   Vitis vinifera
ref|XP_002273532.2|  PREDICTED: copper amine oxidase 1 isoform X1       356   1e-113   Vitis vinifera
ref|XP_008239321.1|  PREDICTED: copper amine oxidase 1-like             356   1e-113   Prunus mume [ume]
ref|XP_011101289.1|  PREDICTED: copper amine oxidase 1-like             355   2e-113   Sesamum indicum [beniseed]
emb|CBI14968.3|  unnamed protein product                                366   2e-113   Vitis vinifera
ref|XP_004155025.1|  PREDICTED: copper methylamine oxidase-like         355   3e-113   
ref|XP_007158407.1|  hypothetical protein PHAVU_002G150400g             355   3e-113   Phaseolus vulgaris [French bean]
ref|XP_004138093.1|  PREDICTED: copper methylamine oxidase-like         355   4e-113   
gb|KEH20158.1|  copper amine oxidase, enzyme domain protein             352   4e-113   Medicago truncatula
ref|XP_010907652.1|  PREDICTED: copper amine oxidase 1                  354   4e-113   Elaeis guineensis
gb|AES71447.2|  copper amine oxidase, enzyme domain protein             348   4e-113   Medicago truncatula
gb|KEH20163.1|  copper amine oxidase, enzyme domain protein             353   5e-113   Medicago truncatula
ref|XP_007158406.1|  hypothetical protein PHAVU_002G150400g             353   5e-113   Phaseolus vulgaris [French bean]
gb|KEH20159.1|  copper amine oxidase, enzyme domain protein             353   6e-113   Medicago truncatula
gb|KEH20157.1|  copper amine oxidase, enzyme domain protein             354   6e-113   Medicago truncatula
ref|NP_001237782.1|  peroxisomal copper-containing amine oxidase        352   8e-113   
ref|XP_004489782.1|  PREDICTED: copper methylamine oxidase-like         352   2e-112   Cicer arietinum [garbanzo]
ref|XP_010044582.1|  PREDICTED: peroxisomal primary amine oxidase...    353   3e-112   Eucalyptus grandis [rose gum]
ref|XP_003613133.1|  Copper amine oxidase                               351   3e-112   
gb|KJB19705.1|  hypothetical protein B456_003G116000                    352   5e-112   Gossypium raimondii
ref|XP_004501882.1|  PREDICTED: copper methylamine oxidase-like         351   6e-112   Cicer arietinum [garbanzo]
gb|KEH35029.1|  copper amine oxidase, enzyme domain protein             349   7e-112   Medicago truncatula
ref|XP_003601196.1|  Primary amine oxidase                              348   7e-112   
ref|XP_006581907.1|  PREDICTED: copper amine oxidase 1-like isofo...    349   1e-111   Glycine max [soybeans]
ref|XP_003601195.1|  Primary amine oxidase                              350   1e-111   Medicago truncatula
ref|XP_006411505.1|  hypothetical protein EUTSA_v100163161mg            337   1e-111   
gb|ACN27241.1|  unknown                                                 333   1e-111   Zea mays [maize]
ref|XP_003527002.1|  PREDICTED: copper amine oxidase 1-like isofo...    350   2e-111   Glycine max [soybeans]
ref|XP_002527922.1|  copper amine oxidase, putative                     349   7e-111   Ricinus communis
gb|KDP31040.1|  hypothetical protein JCGZ_11416                         348   1e-110   Jatropha curcas
ref|XP_007138024.1|  hypothetical protein PHAVU_009G174800g             347   2e-110   Phaseolus vulgaris [French bean]
ref|XP_007225246.1|  hypothetical protein PRUPE_ppa001698mg             347   3e-110   Prunus persica
ref|XP_002322194.2|  hypothetical protein POPTR_0015s09450g             347   4e-110   
ref|XP_008221920.1|  PREDICTED: copper amine oxidase 1-like             347   4e-110   Prunus mume [ume]
gb|KHN18421.1|  Copper methylamine oxidase                              344   6e-110   Glycine soja [wild soybean]
ref|XP_011046219.1|  PREDICTED: copper amine oxidase 1-like             346   9e-110   Populus euphratica
ref|XP_008777611.1|  PREDICTED: copper amine oxidase 1-like             327   1e-109   Phoenix dactylifera
ref|NP_001169559.1|  uncharacterized protein LOC100383438               332   1e-109   
ref|XP_003550715.1|  PREDICTED: copper amine oxidase 1-like isofo...    345   1e-109   Glycine max [soybeans]
ref|XP_010678856.1|  PREDICTED: copper amine oxidase 1-like isofo...    344   1e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004309984.2|  PREDICTED: copper amine oxidase 1-like             344   4e-109   Fragaria vesca subsp. vesca
ref|XP_009403621.1|  PREDICTED: copper amine oxidase 1-like             344   5e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010322539.1|  PREDICTED: copper amine oxidase 1-like             343   5e-109   Solanum lycopersicum
ref|XP_002318664.1|  hypothetical protein POPTR_0012s08630g             343   6e-109   
ref|XP_011047815.1|  PREDICTED: copper amine oxidase 1-like isofo...    343   9e-109   Populus euphratica
ref|XP_011047814.1|  PREDICTED: copper amine oxidase 1-like isofo...    343   1e-108   Populus euphratica
emb|CAN76391.1|  hypothetical protein VITISV_023592                     343   2e-108   Vitis vinifera
ref|XP_002881856.1|  hypothetical protein ARALYDRAFT_903619             342   2e-108   Arabidopsis lyrata subsp. lyrata
dbj|BAD95322.1|  putative copper amine oxidase                          334   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100391.1|  Copper methylamine oxidase                         343   2e-108   
ref|XP_009133538.1|  PREDICTED: copper amine oxidase 1-like             341   3e-108   Brassica rapa
emb|CDP12746.1|  unnamed protein product                                341   4e-108   Coffea canephora [robusta coffee]
ref|XP_010532283.1|  PREDICTED: copper amine oxidase 1-like             341   7e-108   Tarenaya hassleriana [spider flower]
ref|XP_006293724.1|  hypothetical protein CARUB_v10022684mg             340   9e-108   Capsella rubella
ref|XP_010027284.1|  PREDICTED: copper amine oxidase 1                  340   9e-108   Eucalyptus grandis [rose gum]
ref|XP_006347431.1|  PREDICTED: copper amine oxidase 1-like             340   1e-107   Solanum tuberosum [potatoes]
ref|XP_006845257.1|  hypothetical protein AMTR_s00005p00262140          340   1e-107   Amborella trichopoda
gb|KDO69506.1|  hypothetical protein CISIN_1g004084mg                   340   1e-107   Citrus sinensis [apfelsine]
gb|KFK37100.1|  hypothetical protein AALP_AA4G213000                    339   2e-107   Arabis alpina [alpine rockcress]
ref|XP_006439904.1|  hypothetical protein CICLE_v10018950mg             339   2e-107   Citrus clementina [clementine]
ref|XP_010517774.1|  PREDICTED: copper amine oxidase 1-like             340   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010506075.1|  PREDICTED: copper amine oxidase 1-like isofo...    339   4e-107   Camelina sativa [gold-of-pleasure]
gb|AAD23730.1|  putative copper amine oxidase                           338   7e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50256.1|  hypothetical protein B456_008G160800                    338   7e-107   Gossypium raimondii
gb|KJB50255.1|  hypothetical protein B456_008G160800                    338   7e-107   Gossypium raimondii
ref|XP_006476867.1|  PREDICTED: copper amine oxidase 1-like isofo...    338   7e-107   Citrus sinensis [apfelsine]
gb|KJB50257.1|  hypothetical protein B456_008G160800                    338   8e-107   Gossypium raimondii
ref|XP_002448036.1|  hypothetical protein SORBIDRAFT_06g020020          338   9e-107   Sorghum bicolor [broomcorn]
ref|XP_010508564.1|  PREDICTED: copper amine oxidase 1-like             338   1e-106   Camelina sativa [gold-of-pleasure]
ref|NP_181777.2|  copper amine oxidase family protein                   337   1e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006476868.1|  PREDICTED: copper amine oxidase 1-like isofo...    335   1e-106   Citrus sinensis [apfelsine]
emb|CDY47975.1|  BnaA04g24530D                                          337   2e-106   Brassica napus [oilseed rape]
emb|CDY14839.1|  BnaC04g48360D                                          337   2e-106   Brassica napus [oilseed rape]
gb|EPS71193.1|  hypothetical protein M569_03564                         318   2e-106   Genlisea aurea
ref|XP_004289862.2|  PREDICTED: copper amine oxidase 1-like             336   3e-106   Fragaria vesca subsp. vesca
ref|XP_011071936.1|  PREDICTED: copper amine oxidase 1-like             336   5e-106   Sesamum indicum [beniseed]
gb|EMS63127.1|  Primary amine oxidase                                   335   7e-106   Triticum urartu
ref|XP_006652410.1|  PREDICTED: copper amine oxidase 1-like             333   7e-106   
ref|XP_003581353.1|  PREDICTED: copper amine oxidase 1-like             335   8e-106   Brachypodium distachyon [annual false brome]
ref|XP_008668433.1|  PREDICTED: uncharacterized protein LOC100383...    335   1e-105   
gb|KCW83296.1|  hypothetical protein EUGRSUZ_B00228                     345   1e-105   Eucalyptus grandis [rose gum]
gb|EYU22171.1|  hypothetical protein MIMGU_mgv1a001639mg                335   1e-105   Erythranthe guttata [common monkey flower]
emb|CDY35376.1|  BnaA03g19840D                                          341   1e-105   Brassica napus [oilseed rape]
ref|XP_009142070.1|  PREDICTED: LOW QUALITY PROTEIN: copper amine...    334   3e-105   Brassica rapa
ref|XP_004975956.1|  PREDICTED: copper amine oxidase 1-like             333   8e-105   Setaria italica
emb|CDY22564.1|  BnaC03g23740D                                          338   2e-104   Brassica napus [oilseed rape]
ref|XP_007155469.1|  hypothetical protein PHAVU_003G204000g             340   5e-104   Phaseolus vulgaris [French bean]
ref|XP_009606421.1|  PREDICTED: copper amine oxidase 1-like             328   6e-103   Nicotiana tomentosiformis
ref|XP_006600617.1|  PREDICTED: copper amine oxidase 1-like isofo...    326   9e-103   Glycine max [soybeans]
ref|XP_006351050.1|  PREDICTED: copper amine oxidase 1-like             327   1e-102   
gb|KEH27747.1|  copper amine oxidase, enzyme domain protein             325   1e-102   Medicago truncatula
ref|XP_009778427.1|  PREDICTED: copper amine oxidase 1-like             327   3e-102   Nicotiana sylvestris
ref|XP_004244763.1|  PREDICTED: copper amine oxidase 1-like             325   9e-102   Solanum lycopersicum
dbj|BAJ87935.1|  predicted protein                                      317   2e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001053078.1|  Os04g0476100                                       316   5e-101   
gb|EMT09520.1|  Copper methylamine oxidase                              323   7e-101   
ref|XP_009618867.1|  PREDICTED: copper amine oxidase 1-like isofo...    320   1e-100   Nicotiana tomentosiformis
gb|ABR16250.1|  unknown                                                 320   5e-100   Picea sitchensis
emb|CAE05498.2|  OSJNBa0022H21.18                                       318   8e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009379966.1|  PREDICTED: copper amine oxidase 1-like             319   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAH67316.1|  OSIGBa0106G07.12                                       317   1e-99    Oryza sativa [red rice]
dbj|BAF49520.1|  N-methylputrescine oxidase                             318   2e-99    Nicotiana tabacum [American tobacco]
ref|XP_009618862.1|  PREDICTED: copper amine oxidase 1-like isofo...    318   2e-99    Nicotiana tomentosiformis
ref|XP_009773282.1|  PREDICTED: copper amine oxidase 1-like             318   3e-99    Nicotiana sylvestris
ref|XP_001759255.1|  predicted protein                                  316   5e-99    
gb|EAZ31082.1|  hypothetical protein OsJ_15179                          319   6e-99    Oryza sativa Japonica Group [Japonica rice]
gb|EAY94528.1|  hypothetical protein OsI_16305                          318   6e-99    Oryza sativa Indica Group [Indian rice]
emb|CAE02362.2|  OSJNBb0016B03.15                                       318   7e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404245.1|  PREDICTED: copper amine oxidase 1-like             316   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001757203.1|  predicted protein                                  313   6e-98    
gb|EEC76708.1|  hypothetical protein OsI_14715                          306   6e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_001774529.1|  predicted protein                                  305   8e-95    
gb|EMS61925.1|  Copper methylamine oxidase                              306   1e-94    Triticum urartu
gb|EAZ29581.1|  hypothetical protein OsJ_13655                          304   1e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009618866.1|  PREDICTED: copper amine oxidase 1-like isofo...    299   2e-92    Nicotiana tomentosiformis
ref|XP_001753509.1|  predicted protein                                  296   1e-91    
gb|KDO82259.1|  hypothetical protein CISIN_1g004080mg                   290   3e-89    Citrus sinensis [apfelsine]
ref|XP_002462763.1|  hypothetical protein SORBIDRAFT_02g031550          288   7e-89    
ref|XP_007211293.1|  hypothetical protein PRUPE_ppa002116mg             286   2e-87    
ref|XP_002979456.1|  hypothetical protein SELMODRAFT_153358             282   2e-86    
gb|AFK48029.1|  unknown                                                 266   2e-86    Lotus japonicus
ref|XP_007036330.1|  Copper amine oxidase family protein isoform 2      283   7e-86    
ref|XP_007044779.1|  Copper amine oxidase family protein isoform 3      281   2e-85    
gb|KJB19704.1|  hypothetical protein B456_003G116000                    279   1e-84    Gossypium raimondii
ref|XP_002985875.1|  hypothetical protein SELMODRAFT_123165             273   2e-82    
ref|XP_002984811.1|  hypothetical protein SELMODRAFT_121227             273   2e-82    
ref|XP_002977869.1|  hypothetical protein SELMODRAFT_443642             269   2e-80    Selaginella moellendorffii
gb|KDO69507.1|  hypothetical protein CISIN_1g004084mg                   260   2e-77    Citrus sinensis [apfelsine]
ref|XP_010678857.1|  PREDICTED: copper amine oxidase 1-like isofo...    249   1e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001173054.1|  Os02g0593150                                       238   4e-73    
gb|KHN14535.1|  Histamine oxidase                                       201   2e-61    Glycine soja [wild soybean]
gb|EEE57286.1|  hypothetical protein OsJ_07344                          213   4e-60    Oryza sativa Japonica Group [Japonica rice]
ref|WP_027094208.1|  tyramine oxidase                                   201   4e-56    Cohnella thermotolerans
ref|WP_036584415.1|  tyramine oxidase                                   194   2e-53    Paenibacillus darwinianus
gb|ETX01504.1|  hypothetical protein ETSY2_37115                        185   3e-53    Candidatus Entotheonella gemina
ref|XP_006600619.1|  PREDICTED: copper amine oxidase 1-like isofo...    193   3e-53    Glycine max [soybeans]
ref|WP_025696771.1|  tyramine oxidase                                   190   3e-53    Paenibacillus durus
ref|XP_006600618.1|  PREDICTED: copper amine oxidase 1-like isofo...    193   4e-53    Glycine max [soybeans]
ref|WP_015845121.1|  tyramine oxidase                                   191   1e-52    Paenibacillus sp. JDR-2
ref|WP_036002001.1|  tyramine oxidase                                   189   1e-51    [Leptolyngbya] sp. JSC-1
ref|WP_007920030.1|  tyramine oxidase                                   185   3e-50    Ktedonobacter racemifer
ref|WP_036480875.1|  tyramine oxidase                                   184   4e-50    
ref|WP_012627324.1|  tyramine oxidase                                   184   5e-50    Cyanothece sp. PCC 7425
ref|WP_015186652.1|  Copper amine oxidase domain-containing protein     184   6e-50    Gloeocapsa sp. PCC 7428
ref|WP_008317043.1|  Cu2+-containing amine oxidase                      183   1e-49    Leptolyngbya sp. PCC 6406
ref|WP_011430198.1|  tyramine oxidase                                   180   3e-48    Synechococcus sp. JA-3-3Ab
ref|WP_036531589.1|  tyramine oxidase                                   179   3e-48    Neosynechococcus sphagnicola
ref|WP_008314860.1|  Cu2+-containing amine oxidase                      179   5e-48    Leptolyngbya sp. PCC 6406
ref|WP_015124381.1|  Cu2+-containing amine oxidase                      178   9e-48    Synechococcus sp. PCC 6312
gb|ABD03718.1|  putative copper methylamine oxidase                     177   1e-47    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_041436864.1|  tyramine oxidase                                   177   2e-47    
ref|WP_017299862.1|  tyramine oxidase                                   176   5e-47    Nodosilinea nodulosa
ref|WP_006520181.1|  Cu2+-containing amine oxidase                      175   1e-46    Leptolyngbya sp. PCC 7375
ref|WP_039728302.1|  MULTISPECIES: tyramine oxidase                     174   2e-46    Lyngbya confervoides
ref|WP_035986372.1|  tyramine oxidase                                   174   2e-46    Leptolyngbya sp. KIOST-1
ref|WP_009633550.1|  Cu2+-containing amine oxidase                      172   1e-45    Synechocystis sp. PCC 7509
ref|WP_006456034.1|  tyramine oxidase                                   172   1e-45    Synechococcus sp. PCC 7335
emb|CEG30995.1|  Primary amine oxidase precursor                        172   2e-45    Bacillus simplex
ref|WP_037709969.1|  tyramine oxidase                                   171   4e-45    Streptomyces mirabilis
ref|WP_042206338.1|  tyramine oxidase                                   169   2e-44    Paenibacillus durus
ref|WP_012935344.1|  tyramine oxidase                                   169   2e-44    Conexibacter woesei
ref|WP_034315126.1|  tyramine oxidase                                   167   4e-44    Bacillus simplex
ref|WP_012873420.1|  tyramine oxidase                                   167   4e-44    Sphaerobacter thermophilus
ref|WP_016730365.1|  tyramine oxidase                                   167   5e-44    Sulfolobus islandicus
ref|WP_014513326.1|  tyramine oxidase                                   167   6e-44    
ref|WP_027416719.1|  tyramine oxidase                                   167   7e-44    Aneurinibacillus terranovensis
ref|WP_036725089.1|  tyramine oxidase                                   167   9e-44    Paenibacillus forsythiae
ref|WP_012714637.1|  tyramine oxidase                                   166   1e-43    Sulfolobus islandicus
ref|WP_024084556.1|  tyramine oxidase                                   166   2e-43    
ref|WP_011278970.1|  tyramine oxidase                                   166   2e-43    Sulfolobus acidocaldarius
gb|AHY48354.1|  Cu2+-containing amine oxidase                           165   3e-43    Rubrobacter radiotolerans
ref|WP_041339143.1|  tyramine oxidase                                   165   3e-43    Rubrobacter radiotolerans
ref|WP_026844103.1|  tyramine oxidase                                   165   4e-43    Geodermatophilaceae bacterium URHA0031
ref|WP_040597665.1|  tyramine oxidase                                   164   7e-43    Patulibacter medicamentivorans
gb|EHN12772.1|  Monoamine oxidase                                       164   7e-43    Patulibacter medicamentivorans
ref|WP_041858942.1|  hypothetical protein                               164   7e-43    
gb|ABJ81915.1|  Amine oxidase (copper-containing)                       164   1e-42    Candidatus Solibacter usitatus Ellin6076
ref|WP_029635581.1|  hypothetical protein                               163   1e-42    
ref|WP_009075996.1|  tyramine oxidase                                   163   2e-42    Actinobacteria
ref|WP_026159538.1|  hypothetical protein                               163   2e-42    
ref|WP_028921142.1|  tyramine oxidase                                   162   3e-42    Pseudonocardia acaciae
ref|WP_039705665.1|  hypothetical protein                               162   3e-42    
ref|WP_003350826.1|  tyramine oxidase                                   162   4e-42    Bacillus methanolicus
ref|WP_016205391.1|  tyramine oxidase                                   162   4e-42    Bacillus nealsonii
ref|WP_011440032.1|  tyramine oxidase                                   161   6e-42    Rhodopseudomonas palustris
ref|WP_020471082.1|  hypothetical protein                               161   7e-42    Zavarzinella formosa
ref|WP_028930454.1|  tyramine oxidase                                   161   7e-42    Pseudonocardia asaccharolytica
ref|WP_005168021.1|  Monoamine oxidase                                  161   9e-42    Amycolatopsis azurea
ref|WP_007029111.1|  tyramine oxidase                                   160   1e-41    Amycolatopsis decaplanina
ref|WP_033288818.1|  tyramine oxidase                                   160   2e-41    Amycolatopsis jejuensis
ref|WP_028390396.1|  tyramine oxidase                                   160   2e-41    Bacillus cihuensis
ref|WP_014740127.1|  tyramine oxidase                                   160   2e-41    Modestobacter marinus
ref|WP_037817779.1|  tyramine oxidase                                   160   2e-41    Streptomyces sp. NRRL F-3213
ref|WP_043836428.1|  tyramine oxidase                                   160   2e-41    Amycolatopsis orientalis
ref|WP_034266611.1|  tyramine oxidase                                   160   2e-41    Bacillus sp. Aph1
ref|WP_035742293.1|  tyramine oxidase                                   154   3e-41    
ref|WP_034306167.1|  tyramine oxidase                                   159   3e-41    Amycolatopsis lurida
ref|WP_016333935.1|  primary-amine oxidase                              159   4e-41    Amycolatopsis keratiniphila
ref|WP_029018078.1|  hypothetical protein                               159   4e-41    
gb|EEC73513.1|  hypothetical protein OsI_07883                          158   5e-41    Oryza sativa Indica Group [Indian rice]
ref|WP_037305302.1|  tyramine oxidase                                   159   6e-41    Amycolatopsis orientalis
ref|WP_044853065.1|  tyramine oxidase                                   159   6e-41    Amycolatopsis orientalis
ref|WP_015595580.1|  tyramine oxidase                                   159   6e-41    Bacillus sp. 1NLA3E
ref|WP_026439043.1|  tyramine oxidase                                   159   6e-41    Acidocella facilis
ref|WP_037362055.1|  tyramine oxidase                                   159   6e-41    Amycolatopsis orientalis
ref|WP_008494925.1|  tyramine oxidase                                   159   6e-41    Acidocella sp. MX-AZ02
gb|EFL10175.1|  tyramine oxidase                                        159   6e-41    Streptomyces sp. AA4
ref|WP_024819190.1|  tyramine oxidase                                   159   6e-41    Arthrobacter sp. 31Y
ref|WP_033288996.1|  tyramine oxidase                                   159   7e-41    Amycolatopsis jejuensis
ref|WP_037715216.1|  tyramine oxidase                                   158   7e-41    Actinobacteria
ref|WP_037336996.1|  tyramine oxidase                                   158   7e-41    Amycolatopsis sp. MJM2582
ref|WP_043457655.1|  tyramine oxidase                                   158   8e-41    
ref|WP_035741463.1|  tyramine oxidase                                   154   8e-41    
ref|WP_035485230.1|  tyramine oxidase                                   158   1e-40    Geminicoccus roseus
ref|WP_020636390.1|  tyramine oxidase                                   158   1e-40    Amycolatopsis alba
ref|WP_038514355.1|  tyramine oxidase                                   157   1e-40    Amycolatopsis japonica
ref|WP_019310622.1|  tyramine oxidase                                   157   2e-40    Kocuria
ref|WP_014746858.1|  tyramine oxidase                                   157   3e-40    Tistrella mobilis
ref|WP_004562824.1|  tyramine oxidase                                   156   3e-40    Amycolatopsis vancoresmycina
ref|WP_028074137.1|  tyramine oxidase                                   157   3e-40    
ref|WP_028271227.1|  histamine oxidase                                  156   3e-40    Arthrobacter sp. UNC362MFTsu5.1
dbj|BAD14376.1|  hypothetical protein                                   145   4e-40    Solanum melongena [aubergine]
ref|WP_033349571.1|  tyramine oxidase                                   155   6e-40    
ref|WP_017651781.1|  tyramine oxidase                                   156   6e-40    Fortiea contorta
ref|WP_034290510.1|  tyramine oxidase                                   155   8e-40    
ref|WP_018774097.1|  tyramine oxidase                                   155   1e-39    
ref|WP_012411235.1|  tyramine oxidase                                   155   1e-39    
ref|WP_003805961.1|  copper-containing amine oxidase                    152   1e-39    
ref|WP_035743334.1|  tyramine oxidase                                   154   2e-39    
ref|WP_018685630.1|  hypothetical protein                               154   2e-39    
ref|WP_043484145.1|  histamine oxidase                                  154   2e-39    
ref|WP_026538164.1|  histamine oxidase                                  154   2e-39    
ref|WP_011693327.1|  tyramine oxidase                                   154   2e-39    
ref|WP_039243055.1|  histamine oxidase                                  154   2e-39    
ref|XP_005964261.1|  PREDICTED: copper amine oxidase 1-like             154   3e-39    
ref|WP_028276189.1|  histamine oxidase                                  154   3e-39    
ref|WP_041457930.1|  tyramine oxidase                                   154   3e-39    
ref|WP_018778238.1|  tyramine oxidase                                   154   3e-39    
gb|AFW94818.1|  amine oxidase                                           154   4e-39    
sp|Q07123.1|AMO2_ARTS1  RecName: Full=Copper methylamine oxidase;...    153   4e-39    
ref|WP_040270524.1|  tyramine oxidase                                   153   5e-39    
ref|WP_043806367.1|  histamine oxidase                                  153   5e-39    
ref|WP_014922900.1|  tyramine oxidase                                   153   5e-39    
sp|Q07121.1|AMO1_ARTS1  RecName: Full=Primary amine oxidase; AltN...    153   5e-39    
ref|WP_024818298.1|  histamine oxidase                                  153   7e-39    
ref|WP_018393282.1|  hypothetical protein                               153   7e-39    
ref|WP_035876493.1|  histamine oxidase                                  153   7e-39    
gb|AHG88986.1|  Copper amine oxidase domain-containing protein          153   7e-39    
ref|WP_028065493.1|  tyramine oxidase                                   152   9e-39    
ref|WP_043807325.1|  histamine oxidase                                  152   1e-38    
ref|WP_018760783.1|  tyramine oxidase                                   152   1e-38    
ref|WP_026556508.1|  tyramine oxidase                                   152   1e-38    
ref|WP_037122988.1|  tyramine oxidase                                   152   1e-38    
gb|ABM10664.1|  amine oxidase, copper-containing                        152   1e-38    
ref|WP_026556533.1|  tyramine oxidase                                   152   1e-38    
ref|WP_015140710.1|  Cu2+-containing amine oxidase                      152   1e-38    
ref|WP_038549924.1|  histamine oxidase                                  152   1e-38    
ref|WP_035837338.1|  histamine oxidase                                  152   1e-38    
ref|WP_034284434.1|  tyramine oxidase                                   152   2e-38    
ref|WP_024477500.1|  histamine oxidase                                  151   2e-38    
ref|WP_015320499.1|  Cu2+-containing amine oxidase                      152   2e-38    
gb|AFR27483.1|  Cu2+-containing amine oxidase                           151   2e-38    
ref|WP_037040542.1|  tyramine oxidase                                   152   2e-38    
ref|WP_034285194.1|  tyramine oxidase                                   151   2e-38    
ref|WP_024819386.1|  histamine oxidase                                  151   2e-38    
gb|ABM10002.1|  amine oxidase (copper-containing)                       151   2e-38    
ref|WP_037411516.1|  tyramine oxidase                                   151   2e-38    
ref|WP_043806482.1|  histamine oxidase                                  151   2e-38    
ref|WP_026104174.1|  tyramine oxidase                                   151   2e-38    
ref|WP_033318483.1|  hypothetical protein                               151   2e-38    
ref|WP_027749196.1|  tyramine oxidase                                   151   2e-38    
ref|WP_009990204.1|  tyramine oxidase                                   151   2e-38    
ref|WP_018330660.1|  hypothetical protein                               151   2e-38    
ref|WP_015217010.1|  Copper amine oxidase domain-containing protein     151   2e-38    
ref|WP_009881574.1|  tyramine oxidase                                   151   2e-38    
ref|WP_043470977.1|  histamine oxidase                                  151   2e-38    
gb|EWM22333.1|  copper amine oxidase                                    151   2e-38    
ref|WP_026543389.1|  histamine oxidase                                  151   3e-38    
ref|WP_026547874.1|  histamine oxidase                                  151   3e-38    
ref|WP_017200065.1|  tyramine oxidase                                   151   3e-38    
ref|WP_028267210.1|  histamine oxidase                                  150   4e-38    
ref|WP_031465870.1|  tyramine oxidase                                   150   5e-38    
ref|WP_028063099.1|  tyramine oxidase                                   150   6e-38    
ref|WP_019483707.1|  tyramine oxidase                                   150   8e-38    
ref|WP_026005433.1|  histamine oxidase                                  150   8e-38    
ref|WP_043455865.1|  histamine oxidase                                  150   9e-38    
ref|WP_026134453.1|  tyramine oxidase                                   150   9e-38    
ref|WP_028676864.1|  tyramine oxidase                                   149   9e-38    
ref|XP_005846883.1|  hypothetical protein CHLNCDRAFT_58054              150   1e-37    
ref|WP_022928833.1|  tyramine oxidase                                   149   1e-37    
ref|WP_003803495.1|  tyramine oxidase                                   150   1e-37    
pdb|2E2U|A  Chain A, Substrate Schiff-base Analogue Of Copper Ami...    149   1e-37    
pdb|2CWT|A  Chain A, Catalytic Base Deletion In Copper Amine Oxid...    149   2e-37    
pdb|3WA2|X  Chain X, High Resolution Crystal Structure Of Copper ...    149   2e-37    
pdb|1UI7|A  Chain A, Site-Directed Mutagenesis Of His433 Involved...    149   2e-37    
pdb|2YX9|A  Chain A, Crystal Structure Of D298k Copper Amine Oxid...    149   2e-37    
pdb|1IVV|A  Chain A, Crystal Structure Of Copper Amine Oxidase Fr...    149   2e-37    
ref|WP_003799421.1|  tyramine oxidase                                   149   2e-37    
ref|WP_005556120.1|  tyramine oxidase                                   149   2e-37    
ref|WP_025780611.1|  histamine oxidase                                  149   2e-37    
ref|WP_009377663.1|  tyramine oxidase                                   149   2e-37    
pdb|1SIH|A  Chain A, Agao In Covalent Complex With The Inhibitor ...    149   2e-37    
ref|WP_037078438.1|  tyramine oxidase                                   149   2e-37    
ref|WP_040728048.1|  tyramine oxidase                                   149   2e-37    
ref|WP_038497169.1|  tyramine oxidase                                   149   2e-37    
gb|EMP12147.1|  primary amine oxidase                                   148   3e-37    
ref|WP_042341482.1|  tyramine oxidase                                   149   3e-37    
gb|AFY34999.1|  Copper amine oxidase domain-containing protein          149   3e-37    
ref|WP_036548944.1|  tyramine oxidase                                   148   4e-37    
ref|WP_010997581.1|  tyramine oxidase                                   148   4e-37    
gb|AFA74340.1|  histamine oxidase                                       147   4e-37    
ref|WP_043427296.1|  tyramine oxidase                                   147   5e-37    
ref|WP_018770046.1|  tyramine oxidase                                   147   5e-37    
ref|WP_002616189.1|  nickel transporter                                 148   5e-37    
ref|WP_043456625.1|  histamine oxidase                                  147   5e-37    
ref|WP_010144585.1|  tyramine oxidase                                   148   5e-37    
ref|WP_020502057.1|  hypothetical protein                               147   5e-37    
ref|XP_005538693.1|  copper-containing amine oxidase                    147   6e-37    
ref|WP_036454811.1|  tyramine oxidase                                   147   6e-37    
gb|ELQ86689.1|  primary amine oxidase                                   147   6e-37    
ref|WP_026919970.1|  histamine oxidase                                  147   6e-37    
ref|WP_041312973.1|  tyramine oxidase                                   147   7e-37    
ref|WP_015938722.1|  tyramine oxidase                                   147   7e-37    
emb|CCH30742.1|  Histamine oxidase                                      147   7e-37    
ref|WP_035366593.1|  tyramine oxidase                                   147   8e-37    
ref|XP_005536208.1|  copper-containing amine oxidase                    147   8e-37    
ref|WP_018395580.1|  hypothetical protein                               147   8e-37    
ref|WP_044571418.1|  histamine oxidase                                  147   8e-37    
ref|WP_034485026.1|  tyramine oxidase                                   147   8e-37    
ref|WP_003626308.1|  tyramine oxidase                                   147   9e-37    
ref|WP_007144763.1|  tyramine oxidase                                   147   1e-36    
dbj|GAB31994.1|  tyramine oxidase                                       147   1e-36    
ref|XP_005539081.1|  copper-containing amine oxidase                    146   1e-36    
ref|WP_011777249.1|  tyramine oxidase                                   146   1e-36    
ref|WP_044828662.1|  tyramine oxidase                                   146   1e-36    
ref|WP_037049762.1|  tyramine oxidase                                   146   1e-36    
ref|WP_020673325.1|  hypothetical protein                               146   2e-36    
ref|WP_008973262.1|  tyramine oxidase                                   146   2e-36    
ref|WP_038993072.1|  histamine oxidase                                  146   2e-36    
ref|WP_008413752.1|  tyramine oxidase                                   146   2e-36    
ref|WP_020943896.1|  tyramine oxidase                                   147   2e-36    
sp|Q59118.3|AMOH_ARTGO  RecName: Full=Histamine oxidase; AltName:...    146   2e-36    
ref|WP_026552762.1|  histamine oxidase                                  145   2e-36    
pdb|1UI8|A  Chain A, Site-directed Mutagenesis Of His592 Involved...    145   3e-36    
gb|AIA11119.1|  Copper amine oxidase, enzyme domain protein             137   3e-36    
ref|WP_005179100.1|  putative copper-containing amine oxidase           145   3e-36    
ref|WP_014358553.1|  tyramine oxidase                                   145   3e-36    
ref|WP_006372895.1|  tyramine oxidase                                   145   3e-36    
ref|WP_039923589.1|  tyramine oxidase                                   145   4e-36    
ref|WP_015155560.1|  Copper amine oxidase domain-containing protein     145   4e-36    
ref|WP_035080202.1|  tyramine oxidase                                   145   4e-36    
gb|ERK69570.1|  histamine oxidase                                       145   4e-36    
ref|WP_013678400.1|  tyramine oxidase                                   145   5e-36    
emb|CBN75263.1|  amine oxidase                                          145   6e-36    
ref|WP_006369311.1|  tyramine oxidase                                   144   6e-36    
ref|WP_004517446.1|  tyramine oxidase                                   145   7e-36    
ref|WP_006090340.1|  tyramine oxidase                                   145   7e-36    
ref|WP_019087952.1|  tyramine oxidase                                   144   7e-36    
ref|WP_043709465.1|  tyramine oxidase                                   144   7e-36    
ref|WP_037408872.1|  tyramine oxidase                                   144   7e-36    
dbj|BAE48148.1|  histamine oxidase                                      145   8e-36    
gb|AGQ16873.1|  histamine oxidase                                       145   8e-36    
ref|WP_040167401.1|  hypothetical protein                               144   9e-36    
ref|WP_013675838.1|  tyramine oxidase                                   144   9e-36    
emb|CBN75262.1|  amine oxidase                                          144   1e-35    
ref|WP_039714126.1|  tyramine oxidase                                   144   1e-35    
ref|WP_026421607.1|  tyramine oxidase                                   143   2e-35    
ref|WP_011320170.1|  tyramine oxidase                                   143   2e-35    
ref|WP_036398013.1|  histamine oxidase                                  143   2e-35    
ref|WP_036335313.1|  tyramine oxidase                                   143   2e-35    
gb|KJF19252.1|  Histamine oxidase                                       143   2e-35    
ref|WP_041038062.1|  tyramine oxidase                                   143   2e-35    
ref|WP_039403219.1|  tyramine oxidase                                   143   2e-35    
dbj|GAB37997.1|  putative copper-containing amine oxidase               145   3e-35    
ref|WP_032385619.1|  hypothetical protein                               143   3e-35    
ref|WP_010612233.1|  tyramine oxidase                                   143   3e-35    
ref|WP_028921006.1|  hypothetical protein                               142   3e-35    
ref|WP_007694497.1|  tyramine oxidase                                   143   3e-35    
ref|WP_027133873.1|  hypothetical protein                               142   3e-35    
ref|WP_043390599.1|  tyramine oxidase                                   142   3e-35    
ref|WP_034341918.1|  hypothetical protein                               142   4e-35    
ref|XP_005647699.1|  hypothetical protein COCSUDRAFT_29142              142   4e-35    
ref|WP_029121388.1|  tyramine oxidase                                   142   5e-35    
ref|WP_029104655.1|  tyramine oxidase                                   142   5e-35    
ref|WP_040532268.1|  histamine oxidase                                  142   5e-35    
dbj|GAB91287.1|  putative copper-containing amine oxidase               142   5e-35    
ref|XP_005702395.1|  primary-amine oxidase                              142   5e-35    
ref|WP_043983925.1|  tyramine oxidase                                   142   5e-35    
ref|WP_032404441.1|  histamine oxidase                                  142   6e-35    
ref|XP_009515861.1|  hypothetical protein PHYSODRAFT_343894             142   6e-35    
gb|AJP05492.1|  tyramine oxidase                                        142   7e-35    
ref|WP_044379234.1|  tyramine oxidase                                   142   8e-35    
ref|WP_006066345.1|  tyramine oxidase                                   141   8e-35    
ref|WP_039854695.1|  tyramine oxidase                                   141   1e-34    
ref|WP_043742548.1|  tyramine oxidase                                   141   1e-34    
ref|WP_039731529.1|  tyramine oxidase                                   141   1e-34    
ref|WP_043806534.1|  tyramine oxidase                                   141   1e-34    
ref|WP_029080543.1|  tyramine oxidase                                   141   1e-34    
gb|ABM07053.1|  copper methylamine oxidase                              141   1e-34    
ref|WP_043709977.1|  tyramine oxidase                                   140   1e-34    
ref|WP_043643838.1|  tyramine oxidase                                   141   1e-34    
gb|AJT42947.1|  tyramine oxidase                                        140   1e-34    
gb|AGB23966.1|  Cu2+-containing amine oxidase                           141   1e-34    
ref|WP_027581038.1|  tyramine oxidase                                   141   1e-34    
gb|ETI44133.1|  hypothetical protein F443_11140                         141   1e-34    
ref|WP_005260964.1|  tyramine oxidase                                   140   2e-34    
gb|ETO72786.1|  hypothetical protein F444_11200                         140   2e-34    
ref|WP_005562649.1|  tyramine oxidase                                   140   2e-34    
ref|XP_008907114.1|  hypothetical protein PPTG_13290                    140   2e-34    
ref|WP_041312313.1|  tyramine oxidase                                   140   2e-34    
ref|WP_005250970.1|  tyramine oxidase                                   140   2e-34    
gb|EEB83863.1|  amine oxidase (copper-containing)                       133   2e-34    
ref|WP_011595316.1|  tyramine oxidase                                   140   2e-34    
ref|WP_040815337.1|  hypothetical protein                               140   2e-34    
ref|WP_007301564.1|  tyramine oxidase                                   140   2e-34    
ref|WP_015320488.1|  Cu2+-containing amine oxidase                      140   2e-34    
ref|WP_016882495.1|  tyramine oxidase                                   140   2e-34    
ref|WP_044440882.1|  hypothetical protein                               140   2e-34    
ref|WP_006066801.1|  tyramine oxidase                                   140   2e-34    
gb|EXF24973.1|  Histamine oxidase                                       140   2e-34    
ref|XP_009515875.1|  hypothetical protein PHYSODRAFT_343895             142   2e-34    
ref|WP_036475588.1|  tyramine oxidase                                   140   2e-34    
ref|WP_037226125.1|  tyramine oxidase                                   140   2e-34    
ref|WP_037154850.1|  histamine oxidase                                  140   2e-34    
ref|WP_043710196.1|  tyramine oxidase                                   140   3e-34    
gb|AII08562.1|  tyramine oxidase                                        140   3e-34    
ref|WP_009154039.1|  tyramine oxidase                                   139   4e-34    
ref|WP_015309179.1|  Cu2+-containing amine oxidase                      139   4e-34    
ref|WP_004268874.1|  hypothetical protein                               134   4e-34    
ref|WP_040431327.1|  tyramine oxidase                                   139   4e-34    
ref|WP_009475297.1|  tyramine oxidase                                   139   4e-34    
ref|WP_032366965.1|  tyramine oxidase                                   139   4e-34    
ref|WP_020510980.1|  hypothetical protein                               139   5e-34    
ref|WP_012433003.1|  tyramine oxidase                                   139   5e-34    
ref|WP_012689537.1|  tyramine oxidase                                   139   5e-34    
ref|WP_015113274.1|  Copper amine oxidase domain-containing protein     139   5e-34    
ref|WP_043409861.1|  tyramine oxidase                                   139   5e-34    
ref|WP_009078783.1|  tyramine oxidase                                   139   6e-34    
gb|ETI43485.1|  hypothetical protein F443_11515                         139   6e-34    
ref|WP_003895293.1|  primary amine oxidase                              139   7e-34    
ref|XP_008907589.1|  hypothetical protein PPTG_13573                    139   7e-34    
ref|WP_032379878.1|  histamine oxidase                                  139   8e-34    
ref|WP_011729366.1|  tyramine oxidase                                   139   8e-34    
ref|WP_037175730.1|  histamine oxidase                                  139   8e-34    
ref|WP_035756669.1|  histamine oxidase                                  139   8e-34    



>ref|XP_006483934.1| PREDICTED: copper amine oxidase 1-like [Citrus sinensis]
Length=775

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NVKVEEPG+NNVHNNAFYAEE LLK+EL+AMRDCNPL+ARH
Sbjct  557  MDMAVDCKPGEAHNQVVEMNVKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCNPLTARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  677  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  736

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  775



>ref|XP_009802912.1| PREDICTED: peroxisomal primary amine oxidase-like [Nicotiana 
sylvestris]
Length=779

 Score =   375 bits (963),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/220 (86%), Positives = 203/220 (92%), Gaps = 1/220 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE N +VE PGENNVHNNAFYAEERLL+TELEAMRDCNPL+ARH
Sbjct  560  MDMAVDCKPGEAHNQVVEVNARVEPPGENNVHNNAFYAEERLLRTELEAMRDCNPLTARH  619

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPY  +EMFPG
Sbjct  620  WIIRNTRTVNRTGQLTGYKLVPGTNCLPLAGSEAKFLRRAAFLKHNLWVTPYCGDEMFPG  679

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEET IVLWYVFG+ HVPRLEDWPVMPVE IGFML P
Sbjct  680  GEFPNQNPRVGEGLATWVKQNRSLEETQIVLWYVFGLIHVPRLEDWPVMPVEHIGFMLQP  739

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHP-GLVAKL  122
            HGFFNCSPAVDVPPS+AD D KENGV+TK CH  G++AKL
Sbjct  740  HGFFNCSPAVDVPPSTADSDIKENGVVTKSCHDGGIMAKL  779



>ref|XP_006438284.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51524.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=701

 Score =   372 bits (956),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NVKVEEPG+NNVHNNAFYAEE LLK+EL+AMR CNPL+ARH
Sbjct  483  MDMAVDCKPGEAHNQVVEMNVKVEEPGKNNVHNNAFYAEEELLKSELQAMRGCNPLTARH  542

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  543  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  602

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  603  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  662

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  663  HGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  701



>gb|KDO82258.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=701

 Score =   372 bits (956),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NVKVEEPG+NNVHNNAFYAEE LLK+EL+AMRDCNPL+ARH
Sbjct  483  MDMAVDCKPGEAHNQVVEMNVKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCNPLTARH  542

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PG
Sbjct  543  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPG  602

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV+QNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  603  GEFPNQNPRVGEGLATWVEQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  662

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  663  HGFFNCSPAVDVPPNESDLDLKDTAIAEKPVQNGLLAKL  701



>ref|XP_009600855.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=779

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/220 (86%), Positives = 203/220 (92%), Gaps = 1/220 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE N +VE PGENNVHNNAFYA ERLL+TELEAMRDCNPL+ARH
Sbjct  560  MDMAVDCKPGEAHNQVVEVNARVEPPGENNVHNNAFYAAERLLRTELEAMRDCNPLTARH  619

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPY+ +EMFPG
Sbjct  620  WIIRNTRTVNRTGQLTGYKLVPGTNCLPLAGSEAKFLRRAAFLKHNLWVTPYSGDEMFPG  679

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEET IVLWYVFG+ HVPRLEDWPVMPVE IGFML P
Sbjct  680  GEFPNQNPRVGEGLATWVKQNRSLEETQIVLWYVFGLIHVPRLEDWPVMPVEHIGFMLQP  739

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHP-GLVAKL  122
            HGFFNCSPAVDVPPS+AD D KENGV+TK CH  G++AKL
Sbjct  740  HGFFNCSPAVDVPPSTADSDIKENGVVTKSCHDGGIMAKL  779



>gb|KDO82257.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=775

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NVKVEEPG+NNVHNNAFYAEE LLK+EL+AMRDCNPL+ARH
Sbjct  557  MDMAVDCKPGEAHNQVVEMNVKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCNPLTARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV+QNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  677  GEFPNQNPRVGEGLATWVEQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  736

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPNESDLDLKDTAIAEKPVQNGLLAKL  775



>ref|XP_006438285.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51525.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=775

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NVKVEEPG+NNVHNNAFYAEE LLK+EL+AMR CNPL+ARH
Sbjct  557  MDMAVDCKPGEAHNQVVEMNVKVEEPGKNNVHNNAFYAEEELLKSELQAMRGCNPLTARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  677  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  736

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  775



>ref|XP_004239124.1| PREDICTED: copper amine oxidase 1 [Solanum lycopersicum]
Length=776

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 201/220 (91%), Gaps = 1/220 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE+H QVVE N +VE PGENNVHNNAFYAEERLL+TELEAMRDCNPL+ARH
Sbjct  557  MDMAVDCKSGESHNQVVEVNARVEPPGENNVHNNAFYAEERLLRTELEAMRDCNPLTARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R EMFPG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSREEMFPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV+QNR LEET IVLWY+FG+ HVPRLEDWPVMPVE IGFML P
Sbjct  677  GEFPNQNPRVGEGLATWVQQNRSLEETQIVLWYIFGLIHVPRLEDWPVMPVEHIGFMLQP  736

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCH-PGLVAKL  122
            HGFFNCSPAVDVPPS +D D KENG + K CH  G+++KL
Sbjct  737  HGFFNCSPAVDVPPSMSDSDIKENGTVAKSCHNDGVMSKL  776



>ref|XP_006438286.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51526.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=785

 Score =   373 bits (958),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NVKVEEPG+NNVHNNAFYAEE LLK+EL+AMR CNPL+ARH
Sbjct  567  MDMAVDCKPGEAHNQVVEMNVKVEEPGKNNVHNNAFYAEEELLKSELQAMRGCNPLTARH  626

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  627  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  686

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  687  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  746

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  747  HGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  785



>ref|XP_007044778.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY00610.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=769

 Score =   372 bits (955),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG++NVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  551  MDMAVDCKPGEAFNQVVEVNLKVEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLSARH  610

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PG
Sbjct  611  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPG  670

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVK+NR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  671  GEFPNQNPRVGEGLATWVKKNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  730

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D + K+N + TKP   G++AKL
Sbjct  731  HGFFNCSPAVDVPPSATDLELKDNDIATKPIQNGIIAKL  769



>gb|AGZ20104.1| copper methylamine oxidase-like protein [Camellia sinensis]
Length=751

 Score =   371 bits (953),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE H QVVE NVKVEEPG+NNVHNNAFYAEE+LL++ELEAMRDC+PLSARH
Sbjct  533  MDMAVDCKPGETHNQVVEVNVKVEEPGDNNVHNNAFYAEEKLLRSELEAMRDCDPLSARH  592

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  593  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARDEMYPG  652

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  653  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  712

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPSS D D K+N V+TKP + GLVAKL
Sbjct  713  HGFFNCSPAVDVPPSSCDSDVKDNVVVTKPINNGLVAKL  751



>ref|XP_004509661.1| PREDICTED: copper methylamine oxidase-like isoform X1 [Cicer 
arietinum]
Length=760

 Score =   371 bits (953),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVK+EEPG+NNVHNNAFYAEE+ LK+ELEAMRDC+PLSARH
Sbjct  542  MDMAVDCKPGEAFNQVVEVNVKIEEPGKNNVHNNAFYAEEKPLKSELEAMRDCDPLSARH  601

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTG LTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PG
Sbjct  602  WIVRNTRSVNRTGYLTGYKLVPGANCLPLAGSEAKFLRRAAFLKHNLWVTPYARGEMYPG  661

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNRPLEE D+VLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  662  GEFPNQNPRDGEGLATWVKQNRPLEEADVVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  721

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS +D D KENG+  KP   GL+AKL
Sbjct  722  HGFFNCSPAVDVPPSPSDLDDKENGMPAKPSQNGLIAKL  760



>ref|XP_010102489.1| Putative primary amine oxidase 2 [Morus notabilis]
 gb|EXB93553.1| Putative primary amine oxidase 2 [Morus notabilis]
Length=708

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 203/223 (91%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE + QVVE ++KVEEPGENN+HNNAFYAEE LL++EL+AMRDCNPL+ARH
Sbjct  486  MDMAVDCKPGETYNQVVEVDLKVEEPGENNIHNNAFYAEETLLRSELQAMRDCNPLTARH  545

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTG LTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  546  WIIRNTRTVNRTGHLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPG  605

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV+QNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFML P
Sbjct  606  GEFPNQNPRVGEGLATWVQQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLTP  665

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D K++ V    + KP   G+++KL
Sbjct  666  HGFFNCSPAVDVPPNACELDAKDSDVKDAGVAKPIQNGMLSKL  708



>ref|XP_010251089.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nelumbo nucifera]
Length=740

 Score =   370 bits (949),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 206/219 (94%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG++NVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  523  MDMAVDCKPGEPFNQVVELNVKVEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLSARH  582

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRA+FLKHNLWVTPY+R+EM+PG
Sbjct  583  WIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRASFLKHNLWVTPYSRDEMYPG  642

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQ+RPLEETDIVLWY+FG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  643  GEFPNQNPRVGEGLATWVKQDRPLEETDIVLWYIFGITHIPRLEDWPVMPVERIGFMLMP  702

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS++D D K+N ++TKP   GL+AKL
Sbjct  703  HGFFNCSPAVDVPPSTSDLDLKDN-IVTKPIQNGLLAKL  740



>ref|XP_007044777.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY00609.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   371 bits (952),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG++NVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  579  MDMAVDCKPGEAFNQVVEVNLKVEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLSARH  638

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PG
Sbjct  639  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPG  698

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVK+NR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  699  GEFPNQNPRVGEGLATWVKKNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  758

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D + K+N + TKP   G++AKL
Sbjct  759  HGFFNCSPAVDVPPSATDLELKDNDIATKPIQNGIIAKL  797



>ref|XP_010251088.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nelumbo nucifera]
Length=766

 Score =   370 bits (950),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 206/219 (94%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG++NVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  549  MDMAVDCKPGEPFNQVVELNVKVEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLSARH  608

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRA+FLKHNLWVTPY+R+EM+PG
Sbjct  609  WIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRASFLKHNLWVTPYSRDEMYPG  668

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQ+RPLEETDIVLWY+FG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  669  GEFPNQNPRVGEGLATWVKQDRPLEETDIVLWYIFGITHIPRLEDWPVMPVERIGFMLMP  728

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS++D D K+N ++TKP   GL+AKL
Sbjct  729  HGFFNCSPAVDVPPSTSDLDLKDN-IVTKPIQNGLLAKL  766



>ref|XP_007153778.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
 gb|ESW25772.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
Length=755

 Score =   370 bits (949),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/220 (85%), Positives = 201/220 (91%), Gaps = 1/220 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVK+EEPG+NNVHNNAFYAEE+LLK+ELEAMRDC+PLSARH
Sbjct  536  MDMAVDCKPGEAFNQVVEVNVKIEEPGDNNVHNNAFYAEEKLLKSELEAMRDCDPLSARH  595

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  596  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  655

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  656  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  715

Query  238  HGFFNCspavdvppssadpdPKE-NGVITKPCHPGLVAKL  122
            HGFFNCSPA+DVPP+  D D KE NG+  KP   GL+AKL
Sbjct  716  HGFFNCSPAIDVPPNPGDLDDKENNGLPAKPNQNGLIAKL  755



>ref|XP_010248627.1| PREDICTED: copper amine oxidase 1-like [Nelumbo nucifera]
Length=780

 Score =   370 bits (950),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 206/219 (94%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG++NVHNNAFYAEE LL++EL+AMRDCNPL+ARH
Sbjct  563  MDMAVDCKPGEPFNQVVELNVKVEEPGKDNVHNNAFYAEEDLLRSELQAMRDCNPLTARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R+EM+PG
Sbjct  623  WIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSRDEMYPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGLA+WVKQ+R LEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  683  GEFPNQNPRIGEGLATWVKQDRSLEETDIVLWYVFGITHIPRLEDWPVMPVERIGFMLMP  742

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+++D D K+N ++TK  H GL+AKL
Sbjct  743  HGFFNCSPAVDVPPNASDLDLKDN-IVTKSIHNGLLAKL  780



>ref|XP_006357609.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=776

 Score =   369 bits (948),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE+H QVVE N +VE PGENNVHNNAFYAEERLL+TELEAMRDCNPL+ARH
Sbjct  557  MDMAVDCKSGESHNQVVEVNARVEPPGENNVHNNAFYAEERLLRTELEAMRDCNPLTARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY+R E+FPG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYSREEIFPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV+QNR LEET IVLWY+FG+ HVPRLEDWPVMPVE IGFML P
Sbjct  677  GEFPNQNPRVGEGLATWVQQNRSLEETQIVLWYIFGLIHVPRLEDWPVMPVEHIGFMLQP  736

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCH  143
            HGFFNCSPAVDVPPS +D D KENG + K CH
Sbjct  737  HGFFNCSPAVDVPPSMSDSDIKENGTVAKSCH  768



>ref|XP_003519633.1| PREDICTED: copper amine oxidase 1-like [Glycine max]
Length=760

 Score =   369 bits (946),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE +VK+EEPG+NNVHNNAFYAEE+LLK+E EAMRDCNPLSARH
Sbjct  542  MDMAVDCKPGEAFNQVVEVDVKIEEPGKNNVHNNAFYAEEKLLKSESEAMRDCNPLSARH  601

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PG
Sbjct  602  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPGEMHPG  661

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV++NR LEE DIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  662  GEFPNQNPRVGEGLATWVQKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVERIGFMLMP  721

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS++D D KENG+  KP   G++AKL
Sbjct  722  HGFFNCSPAVDVPPSASDLDDKENGMSAKPIQNGMIAKL  760



>ref|XP_011045265.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=700

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDC+ GE   QVVE NVK+EEPG++NVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  482  MDMAVDCRPGETFNQVVEVNVKIEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLSARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNR+GQLTG+KL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  542  WIIRNTRTVNRSGQLTGFKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  662  HGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  700



>gb|KJB50258.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=779

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG+NNVHNNAFYAEE LLK+EL+AMRDC+PLSARH
Sbjct  561  MDMAVDCKPGEAFNQVVEVNLKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCDPLSARH  620

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  621  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  680

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  681  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  740

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  741  HGFFNCSPAVDVPPSATDLELKDTDIATKPIQNGIIAKL  779



>ref|XP_002314600.1| copper amine oxidase family protein [Populus trichocarpa]
 gb|EEF00771.1| copper amine oxidase family protein [Populus trichocarpa]
Length=700

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDC+ GE   QVVE NVK+EEPG++NVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  482  MDMAVDCRPGETFNQVVEVNVKIEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLSARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNR+GQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  542  WIIRNTRTVNRSGQLTGYKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            +GFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  662  YGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  700



>ref|XP_011045264.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=766

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDC+ GE   QVVE NVK+EEPG++NVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  548  MDMAVDCRPGETFNQVVEVNVKIEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLSARH  607

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNR+GQLTG+KL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  608  WIIRNTRTVNRSGQLTGFKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  667

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  668  GEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  727

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  728  HGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  766



>gb|KHN00390.1| Copper methylamine oxidase [Glycine soja]
Length=770

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE +VK+EEPG+NNVHNNAFYAEE+LLK+E EAMRDCNPLSARH
Sbjct  552  MDMAVDCKPGEAFNQVVEVDVKIEEPGKNNVHNNAFYAEEKLLKSESEAMRDCNPLSARH  611

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLP+AG+EAKFLRRAAFLKHNLWVTPY   EM PG
Sbjct  612  WIVRNTRTVNRTGQLTGYKLVPGSNCLPMAGSEAKFLRRAAFLKHNLWVTPYVPGEMHPG  671

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV++NR LEE DIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  672  GEFPNQNPRVGEGLATWVQKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVERIGFMLMP  731

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS++D D KENG+  KP   G++AKL
Sbjct  732  HGFFNCSPAVDVPPSASDLDDKENGMSAKPIQNGMIAKL  770



>gb|KJB50254.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=789

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG+NNVHNNAFYAEE LLK+EL+AMRDC+PLSARH
Sbjct  571  MDMAVDCKPGEAFNQVVEVNLKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCDPLSARH  630

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  631  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  690

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  691  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  750

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  751  HGFFNCSPAVDVPPSATDLELKDTDIATKPIQNGIIAKL  789



>ref|XP_004301007.1| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=789

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 204/223 (91%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA+ QVVE +VKVE+PGENNVH+NAFYAEERLL+TELEAMRDCNPLSARH
Sbjct  567  MDMAVDCKPGEAYNQVVELDVKVEKPGENNVHSNAFYAEERLLRTELEAMRDCNPLSARH  626

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EM+PG
Sbjct  627  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMYPG  686

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVK+NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE +GF+LMP
Sbjct  687  GEFPNQNPRVGEGLATWVKKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVEHLGFVLMP  746

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNC PAVDVPPS+ + + KE+ V    + KP   GL+AKL
Sbjct  747  HGFFNCCPAVDVPPSACESEVKEDDVKDNGVAKPIQNGLMAKL  789



>gb|KHG02854.1| Copper methylamine oxidase [Gossypium arboreum]
Length=804

 Score =   368 bits (944),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG+NNVHNNAFYAEE LLK+EL+AMRDC+PLSARH
Sbjct  586  MDMAVDCKPGEAFNQVVEVNLKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCDPLSARH  645

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  646  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  705

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP
Sbjct  706  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  765

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  766  HGFFNCSPAVDVPPSATDLELKDADIATKPIQNGIIAKL  804



>ref|XP_008389732.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Malus domestica]
Length=781

 Score =   367 bits (941),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVD K GE   QVVE NVKV+EPG+NNVHNNAFYAEE+LLK+EL+AMRDCNPLSARH
Sbjct  563  MDMAVDSKPGETFNQVVEVNVKVDEPGKNNVHNNAFYAEEKLLKSELQAMRDCNPLSARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PG
Sbjct  623  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  683  GEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  742

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  743  HGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  781



>ref|XP_008389733.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Malus domestica]
Length=775

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVD K GE   QVVE NVKV+EPG+NNVHNNAFYAEE+LLK+EL+AMRDCNPLSARH
Sbjct  557  MDMAVDSKPGETFNQVVEVNVKVDEPGKNNVHNNAFYAEEKLLKSELQAMRDCNPLSARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PG
Sbjct  617  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  677  GEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  736

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  775



>gb|KHG02564.1| Primary amine oxidase [Gossypium arboreum]
Length=756

 Score =   365 bits (938),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG+NNVHNNAFYAEE LL++EL+AMRDCNPL+ARH
Sbjct  538  MDMAVDCKPGEAFNQVVEVNLKVEEPGKNNVHNNAFYAEEELLRSELQAMRDCNPLTARH  597

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  598  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  657

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE D+VLWYVFGV H+PRLEDWPVMPV+RIGFMLMP
Sbjct  658  GEFPNQNPRVGEGLATWVKQNRSLEEADVVLWYVFGVIHIPRLEDWPVMPVDRIGFMLMP  717

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D + K+N + TKP    ++AKL
Sbjct  718  HGFFNCSPAVDVPPSTTDLELKDNDIATKPIQNVIIAKL  756



>ref|XP_002277961.1| PREDICTED: copper amine oxidase 1-like [Vitis vinifera]
Length=791

 Score =   366 bits (940),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 204/223 (91%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVE PG++NVHNNAFYAEE+LL++E++AMRDC+PLSARH
Sbjct  569  MDMAVDCKPGEAFNQVVEVNMKVENPGKDNVHNNAFYAEEKLLRSEMQAMRDCDPLSARH  628

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  629  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPG  688

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML P
Sbjct  689  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQP  748

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D K+N V    + KP   GL++K+
Sbjct  749  HGFFNCSPAVDVPPNACELDGKDNDVKDNGVAKPIQTGLLSKI  791



>gb|KJB15626.1| hypothetical protein B456_002G186900 [Gossypium raimondii]
Length=771

 Score =   364 bits (935),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG++NVHNNAFYAEE LL++EL+AMRDCNPL+ARH
Sbjct  553  MDMAVDCKPGEAFNQVVEVNLKVEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLTARH  612

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  613  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAHDEMYPG  672

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE D+VLWYVFGV H+PRLEDWPVMPV+RIGFMLMP
Sbjct  673  GEFPNQNPRVGEGLATWVKQNRSLEEADVVLWYVFGVIHIPRLEDWPVMPVDRIGFMLMP  732

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D + K+N + TKP    ++AKL
Sbjct  733  HGFFNCSPAVDVPPSTTDLELKDNDIATKPVQNVIIAKL  771



>gb|AIS23648.1| amine oxidase 5 [Malus domestica]
Length=788

 Score =   365 bits (936),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 201/223 (90%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE + QVVE +VKVE+PGENNVH+NAFYAEE LL+TE EAMRDCNPL+ARH
Sbjct  566  MDMAVDCKPGETYNQVVEMDVKVEKPGENNVHSNAFYAEETLLRTESEAMRDCNPLTARH  625

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EMFPG
Sbjct  626  WIVQNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMFPG  685

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  686  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  745

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  746  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQSGLLAKL  788



>ref|XP_010682433.1| PREDICTED: copper amine oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=773

 Score =   364 bits (934),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 202/220 (92%), Gaps = 1/220 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  Q+VE NVKVEEPG++NVHNNAFYAEE+LLK+EL+AMRDCNPL+ARH
Sbjct  554  MDMAVDCKPGEALNQIVELNVKVEEPGKDNVHNNAFYAEEKLLKSELQAMRDCNPLTARH  613

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT YA+NEM+PG
Sbjct  614  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTSYAQNEMYPG  673

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK++R LEE DIVLWYVFG+TH+PRLEDWPVMPVE +GFMLMP
Sbjct  674  GEFPNQNPRSGEGLATWVKKDRSLEEADIVLWYVFGLTHIPRLEDWPVMPVEHLGFMLMP  733

Query  238  HGFFNCspavdvppssadpdPKE-NGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D KE NGV+ KP   GL+AKL
Sbjct  734  HGFFNCSPAVDVPPNTHESDSKETNGVVAKPVQNGLIAKL  773



>gb|KCW86673.1| hypothetical protein EUGRSUZ_B032971, partial [Eucalyptus grandis]
 gb|KCW86674.1| hypothetical protein EUGRSUZ_B032971, partial [Eucalyptus grandis]
Length=345

 Score =   350 bits (899),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG+ NVHNNAFYAEE LL++E++AMRDCNPLSARH
Sbjct  127  MDMAVDCKPGETFNQVVEVNVKVEEPGKENVHNNAFYAEEELLQSEMQAMRDCNPLSARH  186

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  187  WIIRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  246

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  247  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  306

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+S D + KENG+  K    GL+AK+
Sbjct  307  HGFFNCSPAVDVPPNSGDSELKENGMAAKSIQNGLLAKM  345



>gb|AIS23644.1| amine oxidase 1 [Malus domestica]
Length=775

 Score =   364 bits (934),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVD K GE   QVVE NVKV+EPG+NNVHNNAFYAEE+LLK+EL+AMRDCNPLSARH
Sbjct  557  MDMAVDSKPGETFNQVVEVNVKVDEPGKNNVHNNAFYAEEKLLKSELQAMRDCNPLSARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM PG
Sbjct  617  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMNPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  677  GEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  736

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  737  HGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  775



>ref|XP_008380537.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   364 bits (934),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 201/223 (90%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE + QVVE +VKVE+PGENNVH+NAFYAEE LL+TE EAMRDCNPL+ARH
Sbjct  566  MDMAVDCKPGETYNQVVEMDVKVEKPGENNVHSNAFYAEETLLRTESEAMRDCNPLTARH  625

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EMFPG
Sbjct  626  WIVQNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMFPG  685

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  686  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  745

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  746  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_007036329.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY20830.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   363 bits (932),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N KVEEPGENNVHNNAFYAEE LLKTEL+AMRDCNP +ARH
Sbjct  575  MDMAVDCKPGEAFNQVVEVNAKVEEPGENNVHNNAFYAEETLLKTELQAMRDCNPFTARH  634

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  635  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTRYAPDEMFPG  694

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  695  GEFPNQNPRAGEGLATWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  754

Query  238  HGFFNCspavdvppssadpdPKEN----GVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D K+N     V+ K    GL+AKL
Sbjct  755  HGFFNCSPAVDVPPNACELDTKDNEIKENVVPKSTQNGLLAKL  797



>emb|CDP13211.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   346 bits (888),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK G  H QVVE NV VEEPG++NVH+NAFYAEE+LLKTELEAM DCNP +ARH
Sbjct  64   MDMAVDCKPGGTHNQVVEVNVIVEEPGDDNVHSNAFYAEEKLLKTELEAMCDCNPSTARH  123

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTGYKLVPGSNC  LA  EAKFLRRAAFLKHNLWVTPY+ +E FPG
Sbjct  124  WIVRNTRAVNRTGQLTGYKLVPGSNCQRLARPEAKFLRRAAFLKHNLWVTPYSHDEKFPG  183

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV++NRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE IGF LMP
Sbjct  184  GEFPNQNPRVGEGLATWVRENRPLEETDIVLWYVFGVTHVPRLEDWPVMPVEHIGFTLMP  243

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPA+DVP SS D D KENG+ITKPCH GLVAKL
Sbjct  244  HGFFNCSPAIDVPLSSCDSDVKENGMITKPCHNGLVAKL  282



>ref|XP_002511334.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF51936.1| copper amine oxidase, putative [Ricinus communis]
Length=797

 Score =   361 bits (927),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 200/223 (90%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            ++MAVDCK GEA  QVVE +VKVE+PGENNVHNNAFYAEE LLK+EL+AMR CNPL+ARH
Sbjct  575  INMAVDCKPGEAFNQVVEMDVKVEKPGENNVHNNAFYAEETLLKSELQAMRACNPLTARH  634

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNR GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  635  WIVRNTRTVNRMGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPG  694

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRV EGL++WVKQNR LEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  695  GEFPNQNPRVAEGLSTWVKQNRSLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  754

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+  + D KEN V    + KP   GL+AKL
Sbjct  755  HGFFNCSPAVDVPPNVCELDIKENDVKENGVAKPLQNGLLAKL  797



>ref|XP_010533488.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=787

 Score =   360 bits (925),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 179/224 (80%), Positives = 196/224 (88%), Gaps = 5/224 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NV+V+EPG+NNVHNNAFYAEE+LL+TELEAMRDC+PLSARH
Sbjct  564  MDMAVDCKPGEAFNQVVEVNVRVDEPGKNNVHNNAFYAEEKLLRTELEAMRDCDPLSARH  623

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W+++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRA FLKHNLWVTPY  NEMFPG
Sbjct  624  WVVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRATFLKHNLWVTPYDPNEMFPG  683

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  684  GEFPNQNPRVGEGLATWVKQNRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  743

Query  238  HGFFNCspavdv-----ppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDV        + D D K+N + +KP   GL+AKL
Sbjct  744  HGFFNCSPAVDVPPNPCEFETKDNDVKDNAISSKPIQSGLLAKL  787



>gb|KHG07734.1| Primary amine oxidase [Gossypium arboreum]
Length=777

 Score =   360 bits (924),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMA+DCK GEA  QVVE N KVEEPGENN+HNNAFYAEE LLKTEL+AMRDCNPL+ARH
Sbjct  555  MDMAIDCKPGEAFNQVVEVNAKVEEPGENNIHNNAFYAEETLLKTELQAMRDCNPLTARH  614

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPG
Sbjct  615  WIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPG  674

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQ+R LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  675  GEFPNQNPRAGEGLATWVKQDRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  734

Query  238  HGFFNCspavdvppssadpdPKEN----GVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  735  HGFFNCSPAVDVPPNACELDTKDNDIKENVVPKSMQNGLMSKL  777



>ref|XP_009362949.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   360 bits (924),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE +VKVE+PGENNVH+NAFYAEE LL+TE EAMRDCNPL+ARH
Sbjct  563  MDMAVDCKPGETFNQVVEMDVKVEKPGENNVHSNAFYAEETLLRTESEAMRDCNPLTARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPG
Sbjct  623  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  683  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  742

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  743  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPVQNGLLAKL  785



>gb|AIS23647.1| amine oxidase 4 [Malus domestica]
Length=788

 Score =   360 bits (924),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE +VKVE+PGENNVH+NAFYAEE LL+TE EAMRDCNPL+ARH
Sbjct  566  MDMAVDCKPGETFNQVVEMDVKVEKPGENNVHSNAFYAEETLLRTESEAMRDCNPLTARH  625

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPG
Sbjct  626  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPG  685

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  686  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  745

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  746  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_008367500.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   360 bits (924),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE +VKVE+PGENNVH+NAFYAEE LL+TE EAMRDCNPL+ARH
Sbjct  566  MDMAVDCKPGETFNQVVEMDVKVEKPGENNVHSNAFYAEETLLRTESEAMRDCNPLTARH  625

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPG
Sbjct  626  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPG  685

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  686  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  745

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  746  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_009345773.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   360 bits (923),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE +VKVE+PGENNVH+NAFYAEE LL+TE EAMRDCNPL+ARH
Sbjct  563  MDMAVDCKPGETFNQVVEMDVKVEKPGENNVHSNAFYAEETLLRTESEAMRDCNPLTARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y+R+EMFPG
Sbjct  623  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYSRDEMFPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  683  GEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVERIGFMLMP  742

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  743  HGFFNASPAVDVPPSACELEAKENDVKDSGVAKPVQNGLLAKL  785



>ref|XP_008464520.1| PREDICTED: copper amine oxidase 1 isoform X2 [Cucumis melo]
Length=704

 Score =   357 bits (917),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 202/223 (91%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE ++KVE PGENNVHNNAFYAEE LLK+E++AMRDC+PLSARH
Sbjct  482  MDMAVDCKPGEAFNQVVEVDLKVEGPGENNVHNNAFYAEETLLKSEMQAMRDCSPLSARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPG
Sbjct  542  WIVRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL++WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+P
Sbjct  602  GEFPNQNPRVGEGLSTWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLP  661

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  662  HGFFNCSPAVDVPPSTCELDSKDTDAKETVVTKPIQTPIIAKL  704



>ref|XP_008464519.1| PREDICTED: copper amine oxidase 1 isoform X1 [Cucumis melo]
Length=791

 Score =   359 bits (921),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 202/223 (91%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE ++KVE PGENNVHNNAFYAEE LLK+E++AMRDC+PLSARH
Sbjct  569  MDMAVDCKPGEAFNQVVEVDLKVEGPGENNVHNNAFYAEETLLKSEMQAMRDCSPLSARH  628

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPG
Sbjct  629  WIVRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPG  688

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL++WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+P
Sbjct  689  GEFPNQNPRVGEGLSTWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLP  748

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  749  HGFFNCSPAVDVPPSTCELDSKDTDAKETVVTKPIQTPIIAKL  791



>gb|KHN13432.1| Copper methylamine oxidase [Glycine soja]
Length=738

 Score =   357 bits (916),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVE+PG+NNVHNNAFYAEE+LLK+E+EAMRDC+PLSARH
Sbjct  520  MDMAVDCKPGEAFNQVVEVNVKVEKPGDNNVHNNAFYAEEKLLKSEMEAMRDCDPLSARH  579

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  580  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  639

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  640  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  699

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  700  HGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  738



>gb|KJB19706.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
 gb|KJB19707.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=791

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMA+DCK GEA  QVVE N KVEEPGENN+HNNAFYAEE LLKTEL+AMRDCNPL+ARH
Sbjct  569  MDMAIDCKPGEAFNQVVEVNAKVEEPGENNIHNNAFYAEETLLKTELQAMRDCNPLTARH  628

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPG
Sbjct  629  WIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPG  688

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK++R LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  689  GEFPNQNPRAGEGLATWVKRDRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  748

Query  238  HGFFNCspavdvppssadpdPKEN----GVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  749  HGFFNCSPAVDVPPNACELDTKDNDIKENVVAKSIQNGLMSKL  791



>ref|XP_003551224.1| PREDICTED: peroxisomal primary amine oxidase-like isoform X1 
[Glycine max]
 gb|KHN07220.1| Primary amine oxidase [Glycine soja]
Length=764

 Score =   357 bits (915),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVE+PG+NNVHNNAFYAEE+LLK+ELEAMRDC+PLSARH
Sbjct  546  MDMAVDCKPGEAFNQVVEVNVKVEKPGDNNVHNNAFYAEEKLLKSELEAMRDCDPLSARH  605

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  606  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  665

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  666  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  725

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  726  HGFFNCSPAVDVPPNPSDLDDKENGLPAKPIQNGLIAKL  764



>gb|AES96091.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=737

 Score =   356 bits (913),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE +VKVE+PG+NNVHNNAFYAEERLLK+ELEAMRDCNPLSARH
Sbjct  519  MDMAVDCKPGEAFNQVVEVDVKVEDPGKNNVHNNAFYAEERLLKSELEAMRDCNPLSARH  578

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PG
Sbjct  579  WIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPG  638

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  639  GEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  698

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D D KENG+  KP    L+AKL
Sbjct  699  HGFFNCSPAVDVPPSAGDLDDKENGMPAKPIQNELIAKL  737



>ref|XP_006584631.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X1 [Glycine max]
Length=766

 Score =   356 bits (914),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVE+PG+NNVHNNAFYAEE+LLK+E+EAMRDC+PLSARH
Sbjct  548  MDMAVDCKPGEAFNQVVEVNVKVEKPGDNNVHNNAFYAEEKLLKSEMEAMRDCDPLSARH  607

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  608  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  667

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  668  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  727

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  728  HGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  766



>emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera]
Length=706

 Score =   354 bits (909),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG+NNVHNNAFYAEE+LL++E++AMRDCNPLSARH
Sbjct  488  MDMAVDCKPGETFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLRSEMQAMRDCNPLSARH  547

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  548  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  607

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  608  GEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMP  667

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D D K+NGV  KP   GL+AKL
Sbjct  668  HGFFNCSPAVDVPPSTCDLDLKDNGVTGKPIQNGLLAKL  706



>ref|XP_010646479.1| PREDICTED: copper amine oxidase 1 isoform X2 [Vitis vinifera]
Length=700

 Score =   354 bits (909),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG+NNVHNNAFYAEE+LL++E++AMRDCNPLSARH
Sbjct  482  MDMAVDCKPGETFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLRSEMQAMRDCNPLSARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  542  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  602  GEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+NGV  KP   GL+AKL
Sbjct  662  HGFFNCSPAVDVPPSTCELDLKDNGVTGKPIQNGLLAKL  700



>ref|XP_002273532.2| PREDICTED: copper amine oxidase 1 isoform X1 [Vitis vinifera]
 emb|CBI23365.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG+NNVHNNAFYAEE+LL++E++AMRDCNPLSARH
Sbjct  556  MDMAVDCKPGETFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLRSEMQAMRDCNPLSARH  615

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  616  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  675

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  676  GEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFRLMP  735

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+NGV  KP   GL+AKL
Sbjct  736  HGFFNCSPAVDVPPSTCELDLKDNGVTGKPIQNGLLAKL  774



>ref|XP_008239321.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=784

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 200/221 (90%), Gaps = 4/221 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE + QVVE +VKVE+PG+NNVH+NAFYAEE LL+TEL+AMRDCNPL+ARH
Sbjct  561  MDMAVDCKPGETYNQVVELDVKVEKPGDNNVHSNAFYAEETLLRTELQAMRDCNPLTARH  620

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EMFPG
Sbjct  621  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAQDEMFPG  680

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRV EGLA+WV +NR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  681  GEFPNQNPRVSEGLATWVNKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  740

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVA  128
            HGFFNCSPAVDVPPS+ + + K+N V    + K    GL+A
Sbjct  741  HGFFNCSPAVDVPPSACELEAKDNDVKDNGVAKSIPNGLLA  781



>ref|XP_011101289.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=777

 Score =   355 bits (912),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 196/223 (88%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVD K GE H QVVE N++VEEPG++NVHNNAFYAEE LL++ELEAMRDC+PLSARH
Sbjct  555  MDMAVDSKPGEMHNQVVEVNLRVEEPGKDNVHNNAFYAEETLLRSELEAMRDCDPLSARH  614

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTR+VNR GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR E FPG
Sbjct  615  WIIRNTRSVNRNGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARGEDFPG  674

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVKQNR LEE DIVLWYVFG+THVPRLEDWPVMPVE IGF+L P
Sbjct  675  GEFPNQNPRVGEGLASWVKQNRSLEEADIVLWYVFGITHVPRLEDWPVMPVEHIGFVLQP  734

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ D D KEN V    + K    GL+AKL
Sbjct  735  HGFFNCSPAVDVPPNACDMDAKENDVKDNGVAKSISSGLIAKL  777



>emb|CBI14968.3| unnamed protein product [Vitis vinifera]
Length=1372

 Score =   366 bits (940),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVE PG++NVHNNAFYAEE+LL++E++AMRDC+PLSARH
Sbjct  568  MDMAVDCKPGEAFNQVVEVNMKVENPGKDNVHNNAFYAEEKLLRSEMQAMRDCDPLSARH  627

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  628  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPG  687

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML P
Sbjct  688  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQP  747

Query  238  HGFFNC  221
            HGFFNC
Sbjct  748  HGFFNC  753



>ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
 gb|KGN63544.1| hypothetical protein Csa_1G004100 [Cucumis sativus]
Length=791

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 202/223 (91%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE ++KVE PGENNVHNNAFYAEE LLK+E++AMRDC+PLSARH
Sbjct  569  MDMAVDCKPGEAFNQVVEVDLKVEGPGENNVHNNAFYAEETLLKSEMQAMRDCSPLSARH  628

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTG+KL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPG
Sbjct  629  WIVRNTRTVNRTGQLTGFKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPG  688

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL++WVK++RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+P
Sbjct  689  GEFPNQNPRVGEGLSTWVKKDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLP  748

Query  238  HGFFNCspavdvppssadpdPKE----NGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  749  HGFFNCSPAVDVPPSTCELDSKDADPKENVVTKPIQTPIIAKL  791



>ref|XP_007158407.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30401.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=769

 Score =   355 bits (910),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE +V VEEPG+NNVHNNAFYAEERLLK+ELEAMRDCNPLSARH
Sbjct  551  MDMAVDCKPGEAFNQVVEVDVIVEEPGKNNVHNNAFYAEERLLKSELEAMRDCNPLSARH  610

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PG
Sbjct  611  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPEEMHPG  670

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV+QNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF+LMP
Sbjct  671  GEFPNQNPRVGEGLATWVQQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFLLMP  730

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS++D D K+NG+  KP   G++AKL
Sbjct  731  HGFFNCSPAVDVPPSASDLDDKDNGMSAKPIQNGVIAKL  769



>ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
Length=794

 Score =   355 bits (911),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 203/226 (90%), Gaps = 7/226 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE ++KVE PGENNVHNNAFYAEE LLK+E++AMRDC+PLSARH
Sbjct  569  MDMAVDCKPGEAFNQVVEVDLKVEGPGENNVHNNAFYAEETLLKSEMQAMRDCSPLSARH  628

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTG+KL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y+R+EMFPG
Sbjct  629  WIVRNTRTVNRTGQLTGFKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQYSRDEMFPG  688

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL++WVK++RPLEETDIVLWYVFG+THVPRLEDWPVMPV+RIGF L+P
Sbjct  689  GEFPNQNPRVGEGLSTWVKKDRPLEETDIVLWYVFGITHVPRLEDWPVMPVDRIGFTLLP  748

Query  238  HGFFNCspavdvppssadpdPKEN-------GVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K++        V+TKP    ++AKL
Sbjct  749  HGFFNCSPAVDVPPSTCELDSKDSKDADPKENVVTKPIQTPIIAKL  794



>gb|KEH20158.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=700

 Score =   352 bits (904),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVEEPG+NNVHNNAFYAEE+LLK+ELEAMRDC+PLSARH
Sbjct  482  MDMAVDCKPGEAFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLKSELEAMRDCDPLSARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PG
Sbjct  542  WIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  602  GEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  662  HGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  700



>ref|XP_010907652.1| PREDICTED: copper amine oxidase 1 [Elaeis guineensis]
Length=771

 Score =   354 bits (909),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 195/219 (89%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EA  QVVE NVKVE PG+NNVHNNAFYAEE+LL++EL+AMRDC+P SARH
Sbjct  553  MDMAVDCKPSEAFNQVVEVNVKVEGPGQNNVHNNAFYAEEKLLRSELQAMRDCDPSSARH  612

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY R+EM+PG
Sbjct  613  WIVRNTRTVNRTGQPTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYNRDEMYPG  672

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR  EGLA+WVK+NRPLEETDIVLWY+FGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRPNEGLATWVKKNRPLEETDIVLWYIFGVTHIPRLEDWPVMPVERIGFMLMP  732

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP  ++ + K+N    K    GL+AKL
Sbjct  733  HGFFNCSPAVDVPPGHSEVEVKDNNGTPKLIQNGLLAKL  771



>gb|AES71447.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=548

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD + GEA  QVVE N+KVEEPGE N+HNNAFYAEE LL++ELEAMRDCNPL+ARH
Sbjct  326  MDMSVDSRPGEALNQVVEVNMKVEEPGEKNIHNNAFYAEETLLRSELEAMRDCNPLTARH  385

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  386  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  445

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  446  GEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  505

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  506  HGFFNCSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  548



>gb|KEH20163.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=724

 Score =   353 bits (905),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVEEPG+NNVHNNAFYAEE+LLK+ELEAMRDC+PLSARH
Sbjct  506  MDMAVDCKPGEAFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLKSELEAMRDCDPLSARH  565

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PG
Sbjct  566  WIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPG  625

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  626  GEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  685

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  686  HGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  724



>ref|XP_007158406.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30400.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=757

 Score =   353 bits (907),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE +V VEEPG+NNVHNNAFYAEERLLK+ELEAMRDCNPLSARH
Sbjct  539  MDMAVDCKPGEAFNQVVEVDVIVEEPGKNNVHNNAFYAEERLLKSELEAMRDCNPLSARH  598

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY   EM PG
Sbjct  599  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVPEEMHPG  658

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV+QNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF+LMP
Sbjct  659  GEFPNQNPRVGEGLATWVQQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFLLMP  718

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS++D D K+NG+  KP   G++AKL
Sbjct  719  HGFFNCSPAVDVPPSASDLDDKDNGMSAKPIQNGVIAKL  757



>gb|KEH20159.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=761

 Score =   353 bits (907),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVEEPG+NNVHNNAFYAEE+LLK+ELEAMRDC+PLSARH
Sbjct  543  MDMAVDCKPGEAFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLKSELEAMRDCDPLSARH  602

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PG
Sbjct  603  WIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPG  662

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  663  GEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  722

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  723  HGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  761



>gb|KEH20157.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=774

 Score =   354 bits (908),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVEEPG+NNVHNNAFYAEE+LLK+ELEAMRDC+PLSARH
Sbjct  556  MDMAVDCKPGEAFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLKSELEAMRDCDPLSARH  615

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+E+ PG
Sbjct  616  WIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDELHPG  675

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  676  GEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  735

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  736  HGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  774



>ref|NP_001237782.1| peroxisomal copper-containing amine oxidase [Glycine max]
 gb|AAD40979.1|AF089851_1 peroxisomal copper-containing amine oxidase [Glycine max]
Length=701

 Score =   352 bits (902),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVE+PG+NNVHNNAFYAEE+LLK+E+EAMRDC+PLSAR 
Sbjct  483  MDMAVDCKPGEAFNQVVEVNVKVEKPGDNNVHNNAFYAEEKLLKSEMEAMRDCDPLSARP  542

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM PG
Sbjct  543  WIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMHPG  602

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  603  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  662

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  663  HGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  701



>ref|XP_004489782.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=761

 Score =   352 bits (904),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE +VKVE+PG+NNVHNNAFYAEE+LLK+ELEAMRDCNPLSARH
Sbjct  543  MDMSVDCKPGEAFNQVVEVDVKVEDPGKNNVHNNAFYAEEKLLKSELEAMRDCNPLSARH  602

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PG
Sbjct  603  WIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPG  662

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGFMLMP
Sbjct  663  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFMLMP  722

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D D KEN +  KP   GL+AKL
Sbjct  723  HGFFNCSPAVDVPPSAGDLDDKENVMSAKPIQNGLIAKL  761



>ref|XP_010044582.1| PREDICTED: peroxisomal primary amine oxidase-like [Eucalyptus 
grandis]
Length=796

 Score =   353 bits (905),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG+ NVHNNAFYAEE LL++E++AMRDCNPLSARH
Sbjct  578  MDMAVDCKPGETFNQVVEVNVKVEEPGKENVHNNAFYAEEELLQSEMQAMRDCNPLSARH  637

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EM+PG
Sbjct  638  WIIRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMYPG  697

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  698  GEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  757

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+S D + KENG+  K    GL+AK+
Sbjct  758  HGFFNCSPAVDVPPNSGDSELKENGMAAKSIQNGLLAKM  796



>ref|XP_003613133.1| Copper amine oxidase [Medicago truncatula]
Length=750

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 196/232 (84%), Gaps = 13/232 (6%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEE-------------PGENNVHNNAFYAEERLLKTEL  638
            MDMAVDCK GEA  QV      V++             PG+NNVHNNAFYAEERLLK+EL
Sbjct  519  MDMAVDCKPGEAFNQVSVQYFTVDKVFNVVEVDVKVEDPGKNNVHNNAFYAEERLLKSEL  578

Query  637  EAMRDCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNL  458
            EAMRDCNPLSARHWI++NTRTVNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNL
Sbjct  579  EAMRDCNPLSARHWIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNL  638

Query  457  WVTPYARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWP  278
            WVTPY  NEM PGGEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWP
Sbjct  639  WVTPYVHNEMHPGGEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWP  698

Query  277  VMPVERIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            VMPVERIGFMLMPHGFFNCSPAVDVPPS+ D D KENG+  KP    L+AKL
Sbjct  699  VMPVERIGFMLMPHGFFNCSPAVDVPPSAGDLDDKENGMPAKPIQNELIAKL  750



>gb|KJB19705.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=795

 Score =   352 bits (904),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 199/227 (88%), Gaps = 8/227 (4%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMA+DCK GEA  QVVE N KVEEPGENN+HNNAFYAEE LLKTEL+AMRDCNPL+ARH
Sbjct  569  MDMAIDCKPGEAFNQVVEVNAKVEEPGENNIHNNAFYAEETLLKTELQAMRDCNPLTARH  628

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPG
Sbjct  629  WIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPG  688

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVL----WYVFGVTHVPRLEDWPVMPVERIGF  251
            GEFPNQNPR GEGLA+WVK++R LEETDIVL    WYVFG+THVPRLEDWPVMPVERIGF
Sbjct  689  GEFPNQNPRAGEGLATWVKRDRSLEETDIVLWLLNWYVFGITHVPRLEDWPVMPVERIGF  748

Query  250  MLMPHGFFNCspavdvppssadpdPKEN----GVITKPCHPGLVAKL  122
            MLMPHGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  749  MLMPHGFFNCSPAVDVPPNACELDTKDNDIKENVVAKSIQNGLMSKL  795



>ref|XP_004501882.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=767

 Score =   351 bits (901),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 198/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD + GEA  QVVE N+KVEEPGENN+HNNAFYAEE LLK+E EAMRDCNPL+ARH
Sbjct  545  MDMSVDSRPGEALNQVVEVNMKVEEPGENNIHNNAFYAEETLLKSESEAMRDCNPLTARH  604

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  605  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  664

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+W+KQ+R LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  665  GEFPNQNPRVGEGLATWIKQDRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  724

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPSS + + K+N +      KP   GL +KL
Sbjct  725  HGFFNCSPAVDVPPSSCEAESKDNDIKDNGAPKPIPSGLASKL  767



>gb|KEH35029.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=704

 Score =   349 bits (896),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD + GEA  QVVE N+KVEEPGE N+HNNAFYAEE LL++ELEAMRDCNPL+ARH
Sbjct  482  MDMSVDSRPGEALNQVVEVNMKVEEPGEKNIHNNAFYAEETLLRSELEAMRDCNPLTARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  542  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  602  GEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  662  HGFFNCSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  704



>ref|XP_003601196.1| Primary amine oxidase [Medicago truncatula]
Length=674

 Score =   348 bits (894),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD + GEA  QVVE N+KVEEPGE N+HNNAFYAEE LL++ELEAMRDCNPL+ARH
Sbjct  452  MDMSVDSRPGEALNQVVEVNMKVEEPGEKNIHNNAFYAEETLLRSELEAMRDCNPLTARH  511

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  512  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  571

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  572  GEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  631

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  632  HGFFNCSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  674



>ref|XP_006581907.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=724

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 197/223 (88%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD K GEA  QVVE N+KVEEPGE NVHNNAFYAEE LL++ELEAMRDCN L+ARH
Sbjct  502  MDMSVDSKPGEALNQVVEVNMKVEEPGEKNVHNNAFYAEETLLRSELEAMRDCNSLTARH  561

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W+++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y+R+E+FPG
Sbjct  562  WVVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRDELFPG  621

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEET++VLWY+FG+THVPRLEDWPVMPVERIGFML P
Sbjct  622  GEFPNQNPRVGEGLATWVKQNRSLEETNVVLWYIFGITHVPRLEDWPVMPVERIGFMLTP  681

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  682  HGFFNCSPAVDVPPNACEMDSKDNDIKDNGSSKPIQSGLTAKL  724



>ref|XP_003601195.1| Primary amine oxidase [Medicago truncatula]
 gb|AES71446.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=769

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD + GEA  QVVE N+KVEEPGE N+HNNAFYAEE LL++ELEAMRDCNPL+ARH
Sbjct  547  MDMSVDSRPGEALNQVVEVNMKVEEPGEKNIHNNAFYAEETLLRSELEAMRDCNPLTARH  606

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y+R+EMFPG
Sbjct  607  WIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAYSRDEMFPG  666

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  667  GEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLMP  726

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+S + + K++ +     +KP   G+ +KL
Sbjct  727  HGFFNCSPAVDVPPNSCEVESKDSDIKDNGASKPIQGGIASKL  769



>ref|XP_006411505.1| hypothetical protein EUTSA_v100163161mg, partial [Eutrema salsugineum]
 gb|ESQ52958.1| hypothetical protein EUTSA_v100163161mg, partial [Eutrema salsugineum]
Length=329

 Score =   337 bits (863),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE N +V+EPGENNVHNNAFYAEE+LL++E EAMRDC+PL+ARH
Sbjct  106  MDMSVDCKPGEAFNQVVEVNARVDEPGENNVHNNAFYAEEKLLRSEAEAMRDCDPLAARH  165

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  166  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  225

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  226  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  285

Query  238  HGFFNC  221
            HGFFNC
Sbjct  286  HGFFNC  291



>gb|ACN27241.1| unknown [Zea mays]
Length=246

 Score =   333 bits (855),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  29   MDMAVDCKPNEAHNQVVEVNVKVESAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  88

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPG
Sbjct  89   WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPG  148

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  149  GEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  208

Query  238  HGFFNC  221
            HGFFNC
Sbjct  209  HGFFNC  214



>ref|XP_003527002.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=774

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 197/223 (88%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD K GEA  QVVE N+KVEEPGE NVHNNAFYAEE LL++ELEAMRDCN L+ARH
Sbjct  552  MDMSVDSKPGEALNQVVEVNMKVEEPGEKNVHNNAFYAEETLLRSELEAMRDCNSLTARH  611

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W+++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y+R+E+FPG
Sbjct  612  WVVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRDELFPG  671

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEET++VLWY+FG+THVPRLEDWPVMPVERIGFML P
Sbjct  672  GEFPNQNPRVGEGLATWVKQNRSLEETNVVLWYIFGITHVPRLEDWPVMPVERIGFMLTP  731

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  732  HGFFNCSPAVDVPPNACEMDSKDNDIKDNGSSKPIQSGLTAKL  774



>ref|XP_002527922.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF34479.1| copper amine oxidase, putative [Ricinus communis]
Length=795

 Score =   349 bits (895),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 204/220 (93%), Gaps = 1/220 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG++NVHNNAFYAE++LL++EL+AMRDCNPL+ARH
Sbjct  576  MDMAVDCKPGETFNQVVEVNVKVEEPGKDNVHNNAFYAEDKLLRSELQAMRDCNPLTARH  635

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA +EM+PG
Sbjct  636  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAPDEMYPG  695

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNR LEET+IVLWYVFGVTH+PRLEDWPVMPVERIGF+LMP
Sbjct  696  GEFPNQNPRVGEGLATWVKQNRSLEETNIVLWYVFGVTHIPRLEDWPVMPVERIGFILMP  755

Query  238  HGFFNCspavdvppssadpdPKENGVITK-PCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ D D K+NG+  K P   GL+AKL
Sbjct  756  HGFFNCSPAVDVPPSACDMDIKDNGITAKPPIQNGLLAKL  795



>gb|KDP31040.1| hypothetical protein JCGZ_11416 [Jatropha curcas]
Length=787

 Score =   348 bits (894),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 201/223 (90%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEA  QVVE +VKVE+PGENNVHNNAFYAEE LL++EL+AM DCNPL+ARH
Sbjct  565  MNMAVDCKPGEAFNQVVEVDVKVEKPGENNVHNNAFYAEETLLRSELQAMGDCNPLTARH  624

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  625  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYARDEMFPG  684

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFG+THVPRLEDWPVMPVERIGFML P
Sbjct  685  GEFPNQNPRVGEGLATWVKQNRPLEENDIVLWYVFGITHVPRLEDWPVMPVERIGFMLSP  744

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D KE  V    + KP   GL++KL
Sbjct  745  HGFFNCSPAVDVPPNACELDAKETDVKENGVGKPIQSGLLSKL  787



>ref|XP_007138024.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
 gb|ESW10018.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
Length=770

 Score =   347 bits (890),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 195/223 (87%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD K GEA  QVVE N+KVEEPGENNVHNNAFYAEE LL++ELEAMRDCN L+ARH
Sbjct  548  MDMSVDSKPGEALNQVVEVNMKVEEPGENNVHNNAFYAEETLLRSELEAMRDCNSLTARH  607

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y+RNEMFPG
Sbjct  608  WIVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTYSRNEMFPG  667

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR  EGLA+WVKQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  668  GEFPNQNPRDREGLATWVKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVEHIGFMLTP  727

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  728  HGFFNCSPAVDVPPNACEMDSKDNEIKDNGSSKPIQNGLTAKL  770



>ref|XP_007225246.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
 gb|EMJ26445.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
Length=777

 Score =   347 bits (890),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVD K GE   QVVE NVKVEEPG+NNVHNNAFYAEE+LLK+EL+AMRDCNPLSARH
Sbjct  559  MDMAVDSKPGETFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLKSELQAMRDCNPLSARH  618

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+E++PG
Sbjct  619  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEVYPG  678

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGLA+WVK+NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  679  GEFPNQNPRIGEGLATWVKKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  738

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCS AVDVPP++ D D K+NG+  KP   GL+AKL
Sbjct  739  HGFFNCSTAVDVPPNTCDLDLKDNGMTAKPIQNGLLAKL  777



>ref|XP_002322194.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
 gb|EEF06321.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
Length=773

 Score =   347 bits (889),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NV+VE+PGE NVHNNAFYA+E LL++EL+AMRDCNP +ARH
Sbjct  551  MDMAVDCKSGEAFNQVVEVNVEVEKPGEKNVHNNAFYAKETLLQSELQAMRDCNPQTARH  610

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  611  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLNHNLWVTPYTHGEMFPG  670

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  671  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  730

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+N      ++KP   G++AKL
Sbjct  731  HGFFNCSPAVDVPPSACELDAKDNDAKDNSVSKPLQNGVLAKL  773



>ref|XP_008221920.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=777

 Score =   347 bits (890),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVD K GE   QVVE NVKVEEPG+NNVHNNAFYAEE+LLK+EL+AMRDCNPLSARH
Sbjct  559  MDMAVDSKPGETFNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLKSELQAMRDCNPLSARH  618

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+E++PG
Sbjct  619  WIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEVYPG  678

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGLA+WVK+NR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGF LMP
Sbjct  679  GEFPNQNPRIGEGLATWVKKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLMP  738

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCS AVDVPP++ D D K+NG+  KP   GL+AKL
Sbjct  739  HGFFNCSTAVDVPPNTCDLDLKDNGMTAKPIQNGLLAKL  777



>gb|KHN18421.1| Copper methylamine oxidase [Glycine soja]
Length=711

 Score =   344 bits (883),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+M VD K G+A  QVVE NVKVEEPG+NNVHNNAFYAEE LLK+ELEAMRDCNPL+ARH
Sbjct  487  MNMTVDSKPGDALNQVVEINVKVEEPGDNNVHNNAFYAEETLLKSELEAMRDCNPLAARH  546

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPG
Sbjct  547  WIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPG  606

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLMP
Sbjct  607  GEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLMP  666

Query  238  HGFFNC  221
            HGFFNC
Sbjct  667  HGFFNC  672



>ref|XP_011046219.1| PREDICTED: copper amine oxidase 1-like [Populus euphratica]
Length=777

 Score =   346 bits (887),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 198/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NV+VE+PGE NVHNNAFYA+E LL++EL+AMRDCNP +ARH
Sbjct  555  MDMAVDCKSGEAFNQVVEVNVEVEKPGEKNVHNNAFYAKETLLQSELQAMRDCNPQTARH  614

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  615  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLNHNLWVTPYTHGEMFPG  674

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  675  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  734

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + + K+N      + KP   G++AKL
Sbjct  735  HGFFNCSPAVDVPPSACELEAKDNDAKDNSVAKPLQNGVLAKL  777



>ref|XP_008777611.1| PREDICTED: copper amine oxidase 1-like, partial [Phoenix dactylifera]
Length=204

 Score =   327 bits (838),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  733  VVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWIIKNTRTVNRTGQL  554
            VVE NVKVE PG+NNVHNNAFYAEE+LL++EL+AMRDC+P SARHWI++NTRTVNRTGQ 
Sbjct  1    VVEVNVKVEGPGQNNVHNNAFYAEEKLLRSELQAMRDCDPSSARHWIVRNTRTVNRTGQP  60

Query  553  TGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEGLA  374
            TGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY R+EM+PGGEFPNQNPR  EGLA
Sbjct  61   TGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPYNRDEMYPGGEFPNQNPRPNEGLA  120

Query  373  SWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNCspavdvpps  194
            +WVK+NR LEETDIVLWY+FGVTH+PRLEDWPVMPVERIGFMLMPHGFFNCS AVDVPPS
Sbjct  121  TWVKKNRSLEETDIVLWYIFGVTHIPRLEDWPVMPVERIGFMLMPHGFFNCSTAVDVPPS  180

Query  193  sadpdPKENGVITKPCHPGLVAKL  122
            +++ D K+N    K     L+AKL
Sbjct  181  TSEMDVKDNNGTPKLIQNALLAKL  204



>ref|NP_001169559.1| uncharacterized protein LOC100383438 [Zea mays]
 gb|ACN34121.1| unknown [Zea mays]
Length=352

 Score =   332 bits (852),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  135  MDMAVDCKPNEAHNQVVEVNVKVESAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  194

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPG
Sbjct  195  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPG  254

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  255  GEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  314

Query  238  HGFFNC  221
            HGFFNC
Sbjct  315  HGFFNC  320



>ref|XP_003550715.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=751

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+M VD K G+A  QVVE NVKVEEPG+NNVHNNAFYAEE LLK+ELEAMRDCNPL+ARH
Sbjct  527  MNMTVDSKPGDALNQVVEINVKVEEPGDNNVHNNAFYAEETLLKSELEAMRDCNPLAARH  586

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPG
Sbjct  587  WIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPG  646

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLMP
Sbjct  647  GEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLMP  706

Query  238  HGFFNC  221
            HGFFNC
Sbjct  707  HGFFNC  712



>ref|XP_010678856.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   344 bits (883),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDC  GEA  QVVE NV+VE+PG++NVH+NAFYAEE +LK+ELEA+RDCNPLSARH
Sbjct  525  MDMAVDCNPGEALNQVVEMNVRVEDPGDHNVHDNAFYAEETILKSELEAIRDCNPLSARH  584

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG++AKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  585  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSDAKFLRRAAFLKHNLWVTEYACDEMFPG  644

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVK+NRPL E+D+VLWYVFG+THVPRLEDWPVMPVE IGFMLMP
Sbjct  645  GEFPNQNPRAGEGLATWVKKNRPLYESDVVLWYVFGLTHVPRLEDWPVMPVEHIGFMLMP  704

Query  238  HGFFNC  221
            HGFFNC
Sbjct  705  HGFFNC  710



>ref|XP_004309984.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   344 bits (882),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVD K GE + QVVE NVKVEEPG+NNVHNNAFYAEE+LLK+EL+AMRDCNPLSARH
Sbjct  562  MDMAVDSKPGETYNQVVEVNVKVEEPGKNNVHNNAFYAEEKLLKSELQAMRDCNPLSARH  621

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI+++TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YAR+EM+PG
Sbjct  622  WIVRHTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSYARDEMYPG  681

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV+Q+R LEE DIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  682  GEFPNQNPRVGEGLATWVQQDRSLEEADIVLWYVFGVTHIPRLEDWPVMPVEHIGFTLMP  741

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCS AVDVPP++ + D KEN + TKP    LVAKL
Sbjct  742  HGFFNCSTAVDVPPNTCENDLKENEMSTKPIQTALVAKL  780



>ref|XP_009403621.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=775

 Score =   344 bits (882),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EA  QV+E N KVE+PG+NNVHNNAFYAEE+LLK+ELEAMRDC+P SARH
Sbjct  559  MDMAVDCKPTEAFNQVIEVNAKVEDPGQNNVHNNAFYAEEKLLKSELEAMRDCDPFSARH  618

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGYKL+PG NCLPLAG EAKFLRRAAFLKHNLWVTPY+R+EM+PG
Sbjct  619  WIVRNTRTVNRTGQPTGYKLMPGLNCLPLAGPEAKFLRRAAFLKHNLWVTPYSRDEMYPG  678

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGL +WVK+NR LEE DIVLWYVFG+TH+PRLEDWPVMPV+RIGFMLMP
Sbjct  679  GEFPNQNPRINEGLVTWVKKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVDRIGFMLMP  738

Query  238  HGFFNC  221
            HGFFNC
Sbjct  739  HGFFNC  744



>ref|XP_010322539.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=774

 Score =   343 bits (881),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 190/225 (84%), Gaps = 7/225 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE N+KVEEPG+ NVHNNAFYAEE  L++EL+AMRDC+PLSARH
Sbjct  551  MNMAVDCKPGEAHNQVVEVNLKVEEPGKENVHNNAFYAEETQLRSELQAMRDCDPLSARH  610

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  611  WIVRNTRTSNRTGQLTGYKLVPGQNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  670

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVK++R LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  671  GEFPNQNPRVGEGLASWVKEDRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  730

Query  238  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDV         S D D  ENG  +KP   GL AKL
Sbjct  731  HGFFNCSPAVDVPPPRGCDSESKDSDASENGE-SKPTTTGLTAKL  774



>ref|XP_002318664.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
 gb|EEE96884.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
Length=751

 Score =   343 bits (879),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDC+ GEA  QVVE NV+VE+PGE NVHNNAFYA+E LL++ELEAMR CNP +ARH
Sbjct  529  MDMAVDCRPGEAFNQVVEVNVEVEKPGEKNVHNNAFYAKETLLRSELEAMRACNPQTARH  588

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  589  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPG  648

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMP
Sbjct  649  GEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMP  708

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  709  HGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  751



>ref|XP_011047815.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=771

 Score =   343 bits (880),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDC+ GEA  QVVE NV+VE+PGE NVHNNAFYA+E LL++ELEAMR CNP +ARH
Sbjct  549  MDMAVDCRPGEAFNQVVEVNVEVEKPGETNVHNNAFYAKETLLRSELEAMRACNPQTARH  608

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  609  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPG  668

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMP
Sbjct  669  GEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMP  728

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  729  HGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  771



>ref|XP_011047814.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=774

 Score =   343 bits (879),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDC+ GEA  QVVE NV+VE+PGE NVHNNAFYA+E LL++ELEAMR CNP +ARH
Sbjct  552  MDMAVDCRPGEAFNQVVEVNVEVEKPGETNVHNNAFYAKETLLRSELEAMRACNPQTARH  611

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTPY   EMFPG
Sbjct  612  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTPYTHGEMFPG  671

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVER+GFMLMP
Sbjct  672  GEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVERLGFMLMP  731

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  732  HGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  774



>emb|CAN76391.1| hypothetical protein VITISV_023592 [Vitis vinifera]
Length=790

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVE PG++NVHNNAFYAEE+LL++E++AMRDC+PLSARH
Sbjct  541  MDMAVDCKPGEAFNQVVEVNMKVENPGKDNVHNNAFYAEEKLLRSEMQAMRDCDPLSARH  600

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR+EMFPG
Sbjct  601  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYARDEMFPG  660

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML-M  242
            GEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVERIGFML +
Sbjct  661  GEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVERIGFMLQI  720

Query  241  PHGFF  227
             H  F
Sbjct  721  LHNLF  725



>ref|XP_002881856.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58115.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
Length=775

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 194/223 (87%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE NV+V+EPGENNVH+NAFYAEE+LL++E  AMRDC+PLSARH
Sbjct  553  MDMSVDCKPGEAFNQVVEVNVRVDEPGENNVHSNAFYAEEKLLRSEAVAMRDCDPLSARH  612

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  672

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  673  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  732

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+  + + K++     V  KP   GL++KL
Sbjct  733  HGFFNCSPAVDVPPNPCELETKDSEVKEVVAPKPLQTGLLSKL  775



>dbj|BAD95322.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=502

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK  EA  QVVE NV+V+E GENNVHNNAFYAEE+LLK+E  AMRDC+PLSARH
Sbjct  280  MDMSVDCKPAEAFNQVVEVNVRVDERGENNVHNNAFYAEEKLLKSEALAMRDCDPLSARH  339

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  340  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  399

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  400  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  459

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  460  HGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  502



>ref|XP_010100391.1| Copper methylamine oxidase [Morus notabilis]
 gb|EXB82525.1| Copper methylamine oxidase [Morus notabilis]
Length=841

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 196/214 (92%), Gaps = 2/214 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE +VKVEEPG NNVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  584  MDMAVDCKPGEAFNQVVEVDVKVEEPGNNNVHNNAFYAEETLLRSELQAMRDCNPLSARH  643

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EM+PG
Sbjct  644  WIVRNTRNVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAKDEMYPG  703

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV QNR LEE DIVLWYVFGVTH+PRLEDWPVMP +RIGFMLMP
Sbjct  704  GEFPNQNPRVGEGLATWVNQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPADRIGFMLMP  763

Query  238  HGFFNCspavdvppssadpdPKE--NGVITKPCH  143
            HGFFNCSPAVDVPPSS+D + K+  NGV  KP H
Sbjct  764  HGFFNCSPAVDVPPSSSDLELKDNGNGVTAKPIH  797



>ref|XP_009133538.1| PREDICTED: copper amine oxidase 1-like [Brassica rapa]
Length=757

 Score =   341 bits (875),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 191/224 (85%), Gaps = 5/224 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA+ QVVE NVKV+EPGENN+HNNAFYAEE+LL++E EA RDC+P SARH
Sbjct  534  MDMSVDCKPGEAYNQVVEVNVKVDEPGENNIHNNAFYAEEKLLRSEAEATRDCDPFSARH  593

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  594  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  653

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  654  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  713

Query  238  HGFFNCspavdvppssadpdPKENG-----VITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+ A     ++      V  KP   GL++KL
Sbjct  714  HGFFNCSPAVDVPPNPACELDTKDSEVKEVVAPKPLQSGLLSKL  757



>emb|CDP12746.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   341 bits (875),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 183/223 (82%), Positives = 197/223 (88%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NV+VEEPG++NVHNNAFYAEE LL++ELEAMRD +P SARH
Sbjct  551  MDMAVDCKPGEAHNQVVEVNVRVEEPGKDNVHNNAFYAEETLLRSELEAMRDIDPFSARH  610

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLP+AG EAKFLRRAAFLKHNLWVT YAR E FPG
Sbjct  611  WIIRNTRTVNRTGQLTGYKLVPGSNCLPMAGPEAKFLRRAAFLKHNLWVTQYARGEDFPG  670

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL SWVKQNR LEETDIVLWYVFG+THVPRLEDWPVMPVERIGF+L P
Sbjct  671  GEFPNQNPRVGEGLDSWVKQNRSLEETDIVLWYVFGITHVPRLEDWPVMPVERIGFLLQP  730

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP + + D K+N V    + KP   GLVAKL
Sbjct  731  HGFFNCSPAVDVPPGACEMDGKDNDVKESSLAKPIPTGLVAKL  773



>ref|XP_010532283.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=789

 Score =   341 bits (875),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 198/227 (87%), Gaps = 8/227 (4%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE NVKVEEPGENNVHNNAF+AEE+LL++E EAMRDC+PL+ARH
Sbjct  563  MDMAVDCKPGEAFNQVVEVNVKVEEPGENNVHNNAFFAEEKLLRSEAEAMRDCDPLTARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W+++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVTPYA NEMFPG
Sbjct  623  WVVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTPYAPNEMFPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  683  GEFPNQNPRVGEGLATWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  742

Query  238  HGFFNCspavdv-------ppssadpdPKENGVITKPCH-PGLVAKL  122
            HGFFNCSPAVDV          + D D KEN V +KP    GL+AKL
Sbjct  743  HGFFNCSPAVDVPPSLSPCELDTKDSDVKENVVASKPIQNGGLLAKL  789



>ref|XP_006293724.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
 gb|EOA26622.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
Length=771

 Score =   340 bits (873),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 191/223 (86%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE N +V+EPGENNVHNNAFYAEE+LL++E EAMRDC+P SARH
Sbjct  549  MDMSVDCKPGEAFNQVVEVNARVDEPGENNVHNNAFYAEEKLLRSEAEAMRDCDPFSARH  608

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  609  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPEEKFPG  668

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGL++WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  669  GEFPNQNPRAGEGLSTWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  728

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+  + D K++     V  KP   GL++KL
Sbjct  729  HGFFNCSPAVDVPPNPCELDTKDSEVKEVVAPKPIQTGLLSKL  771



>ref|XP_010027284.1| PREDICTED: copper amine oxidase 1 [Eucalyptus grandis]
Length=769

 Score =   340 bits (873),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE+  QVVE +VKVEEPGE NVHNNAFYAEE LL++EL+AMRDCNPL+ARH
Sbjct  547  MDMAVDCKPGESFNQVVEVDVKVEEPGEKNVHNNAFYAEETLLRSELQAMRDCNPLTARH  606

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  607  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYAPDEMFPG  666

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL++WVK+NRPLEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  667  GEFPNQNPRVGEGLSTWVKRNRPLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  726

Query  238  HGFFNCspavdvppssadpdPKENGV  161
            HGFFNCSPAVDVPPS+ D D K+N V
Sbjct  727  HGFFNCSPAVDVPPSTCDMDAKDNEV  752



>ref|XP_006347431.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=769

 Score =   340 bits (872),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 190/225 (84%), Gaps = 7/225 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            ++MAVDCK GEAH QVVE N+KVEEPG+ NVHNNAFYAEE  L++EL+AMRDC+PLSARH
Sbjct  546  INMAVDCKPGEAHNQVVEVNLKVEEPGKENVHNNAFYAEETQLRSELQAMRDCDPLSARH  605

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT +A  E FPG
Sbjct  606  WIVRNTRTSNRTGQLTGYKLVPGQNCLPLAGPEAKFLRRAAFLKHNLWVTQFAPGEDFPG  665

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVK++R LEE+DIVLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  666  GEFPNQNPRVGEGLASWVKEDRSLEESDIVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  725

Query  238  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPA+DV         S D D  ENG  +KP   GL AKL
Sbjct  726  HGFFNCSPAIDVPPPRGCDLESKDSDASENGE-SKPTTTGLTAKL  769



>ref|XP_006845257.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
 gb|ERN06932.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
Length=786

 Score =   340 bits (873),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 200/219 (91%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVDCK GEA  QVVE NVKVEEPG+NN+HNNAFYAEE LL++EL+AMRDCNPL+ARH
Sbjct  569  LDMAVDCKPGEALNQVVEVNVKVEEPGKNNIHNNAFYAEEELLRSELQAMRDCNPLTARH  628

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+VNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y R+E +PG
Sbjct  629  WIVRNTRSVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYKRDEKYPG  688

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPV+RIGFMLMP
Sbjct  689  GEFPNQNPRIDEGLATWVKQNRPLEENDIVLWYVFGVTHIPRLEDWPVMPVDRIGFMLMP  748

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPSS + D KE GV  KP   GLV+KL
Sbjct  749  HGFFNCSPAVDVPPSSTETDLKEIGV-PKPLQNGLVSKL  786



>gb|KDO69506.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=775

 Score =   340 bits (872),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 198/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM VDCK GEA  QVVE +VKVE+PG +NVHNNAFYAEE LLK+E++AMRDCNPL+ARH
Sbjct  553  MDMEVDCKPGEAFNQVVEVDVKVEKPGGSNVHNNAFYAEETLLKSEMQAMRDCNPLTARH  612

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  672

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  732

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  733  HGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>gb|KFK37100.1| hypothetical protein AALP_AA4G213000 [Arabis alpina]
Length=767

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 190/224 (85%), Gaps = 5/224 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA+ QVVE N +V+EPGENNVHNNAFYAEE+LL+ E EAMRDC+P +ARH
Sbjct  544  MDMSVDCKPGEAYNQVVEVNARVDEPGENNVHNNAFYAEEKLLRNESEAMRDCDPFTARH  603

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  604  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  663

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  664  GEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  723

Query  238  HGFFNCspavdvppssadpdPKENG-----VITKPCHPGLVAKL  122
            HGFFNCSPA+DVPP+ A     ++      V  KP   GL++KL
Sbjct  724  HGFFNCSPAIDVPPNPACELETKDSEVKEVVTPKPIQAGLLSKL  767



>ref|XP_006439904.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
 gb|ESR53144.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
Length=775

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 198/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM VDCK GEA  QVVE +VKVE+PG +NVHNNAFYAEE LLK+E++AMRDCNPL+ARH
Sbjct  553  MDMEVDCKPGEAFNQVVEVDVKVEKPGGSNVHNNAFYAEETLLKSEMQAMRDCNPLTARH  612

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  672

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  732

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  733  HGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_010517774.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   340 bits (871),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 191/223 (86%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE N +V+EPGENNVHNNAFYAEE+LL++E EA RDC+P SARH
Sbjct  559  MDMSVDCKPGEAFNQVVEVNARVDEPGENNVHNNAFYAEEKLLRSEAEATRDCDPFSARH  618

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  619  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  678

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  679  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  738

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPA+DVPP+  + D K++     V  KP   GL++KL
Sbjct  739  HGFFNCSPAIDVPPNPCELDTKDSEVKEVVAPKPLQTGLLSKL  781



>ref|XP_010506075.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Camelina sativa]
 ref|XP_010506076.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Camelina sativa]
Length=779

 Score =   339 bits (869),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 191/223 (86%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE N +V+EPGENNVHNNAFYAEE+LL++E EA RDC+P SARH
Sbjct  557  MDMSVDCKPGEAFNQVVEVNARVDEPGENNVHNNAFYAEEKLLRSEAEATRDCDPFSARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y+ +E FPG
Sbjct  617  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYSPDEKFPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  677  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  736

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPA+DVPP+  + D K++     V  KP   GL++KL
Sbjct  737  HGFFNCSPAIDVPPNPCELDTKDSEVKEVVAPKPLQTGLLSKL  779



>gb|AAD23730.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAM15387.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=759

 Score =   338 bits (866),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK  EA  QVVE NV+V+E GENNVHNNAFYAEE+LLK+E  AMRDC+PLSARH
Sbjct  537  MDMSVDCKPAEAFNQVVEVNVRVDERGENNVHNNAFYAEEKLLKSEAVAMRDCDPLSARH  596

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  597  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  656

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  657  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  716

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  717  HGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  759



>gb|KJB50256.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=751

 Score =   338 bits (866),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG+NNVHNNAFYAEE LLK+EL+AMRDC+PLSARH
Sbjct  571  MDMAVDCKPGEAFNQVVEVNLKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCDPLSARH  630

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  631  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  690

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  242
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  691  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>gb|KJB50255.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=757

 Score =   338 bits (866),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG+NNVHNNAFYAEE LLK+EL+AMRDC+PLSARH
Sbjct  571  MDMAVDCKPGEAFNQVVEVNLKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCDPLSARH  630

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  631  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  690

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  242
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  691  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>ref|XP_006476867.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Citrus sinensis]
Length=775

 Score =   338 bits (867),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 197/223 (88%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM VDCK GEA  QVVE +VKVE+PG +NVHNNAFYAEE LLK+E++AMRDC PL+ARH
Sbjct  553  MDMEVDCKPGEAFNQVVEVDVKVEKPGGSNVHNNAFYAEETLLKSEMQAMRDCKPLTARH  612

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  672

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  732

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  733  HGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>gb|KJB50257.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=775

 Score =   338 bits (867),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG+NNVHNNAFYAEE LLK+EL+AMRDC+PLSARH
Sbjct  571  MDMAVDCKPGEAFNQVVEVNLKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCDPLSARH  630

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY+R EM PG
Sbjct  631  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPYSREEMHPG  690

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  242
            GEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM
Sbjct  691  GEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  749



>ref|XP_002448036.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
 gb|EES12364.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
Length=782

 Score =   338 bits (867),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  565  MDMAVDCKPNEAHNQVVEVNVKVESAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  624

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y R+EMFPG
Sbjct  625  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRDEMFPG  684

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGL +WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  685  GEFPNQNPRIHEGLPTWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  744

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPSS+D D KE     K    GLV+KL
Sbjct  745  HGFFNCSPAVDVPPSSSDADVKE-AESPKAIQNGLVSKL  782



>ref|XP_010508564.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE N +V+EPGENNVHNNAFYAEE+LL++E EA RDC+P SARH
Sbjct  559  MDMSVDCKPGEAFNQVVEVNARVDEPGENNVHNNAFYAEEKLLRSEAEATRDCDPFSARH  618

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  619  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  678

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  679  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  738

Query  238  HGFFNC  221
            HGFFNC
Sbjct  739  HGFFNC  744



>ref|NP_181777.2| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AAM53275.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAN15348.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AEC10126.1| copper amine oxidase family protein [Arabidopsis thaliana]
Length=776

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 191/223 (86%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK  EA  QVVE NV+V+E GENNVHNNAFYAEE+LLK+E  AMRDC+PLSARH
Sbjct  554  MDMSVDCKPAEAFNQVVEVNVRVDERGENNVHNNAFYAEEKLLKSEAVAMRDCDPLSARH  613

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  614  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  673

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGF LMP
Sbjct  674  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFTLMP  733

Query  238  HGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  734  HGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  776



>ref|XP_006476868.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Citrus sinensis]
Length=704

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 197/223 (88%), Gaps = 4/223 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM VDCK GEA  QVVE +VKVE+PG +NVHNNAFYAEE LLK+E++AMRDC PL+ARH
Sbjct  482  MDMEVDCKPGEAFNQVVEVDVKVEKPGGSNVHNNAFYAEETLLKSEMQAMRDCKPLTARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  542  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  662  HGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  704



>emb|CDY47975.1| BnaA04g24530D [Brassica napus]
Length=775

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE NV+V+EPGENN+HNNAFYAEE+LL++E EAMRDC+P SARH
Sbjct  554  MDMSVDCKPGEAFNQVVEVNVRVDEPGENNIHNNAFYAEEKLLRSEAEAMRDCDPFSARH  613

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPG
Sbjct  614  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPG  673

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  674  GEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  733

Query  238  HGFFNC  221
            HGFFNC
Sbjct  734  HGFFNC  739



>emb|CDY14839.1| BnaC04g48360D [Brassica napus]
Length=775

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE NV+V+EPGENN+HNNAFYAEE+LL++E EAMRDC+P SARH
Sbjct  554  MDMSVDCKPGEAFNQVVEVNVRVDEPGENNIHNNAFYAEEKLLRSEAEAMRDCDPFSARH  613

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPG
Sbjct  614  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPG  673

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  674  GEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  733

Query  238  HGFFNC  221
            HGFFNC
Sbjct  734  HGFFNC  739



>gb|EPS71193.1| hypothetical protein M569_03564, partial [Genlisea aurea]
Length=202

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  748  EAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWIIKNTRTVN  569
            +A  QVVE N++VEEPG++NVH+NAFYAEE LLKTELEAMRDC+PLSARHWI++NTR VN
Sbjct  1    DALLQVVELNMRVEEPGQDNVHHNAFYAEETLLKTELEAMRDCDPLSARHWIVRNTRAVN  60

Query  568  RTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRV  389
            R+GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT YAR E FPGGEFPNQNPR 
Sbjct  61   RSGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYARGEDFPGGEFPNQNPRA  120

Query  388  GEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNCspav  209
            GEGLASWVKQNR LEE DIVLWYVFG+THVPR EDWPVMPVE IGF+L PHGFFNCSPAV
Sbjct  121  GEGLASWVKQNRSLEEADIVLWYVFGITHVPRPEDWPVMPVEHIGFVLQPHGFFNCSPAV  180

Query  208  dvppssadpdPKEN  167
            DVPP++ + + KEN
Sbjct  181  DVPPNACETESKEN  194



>ref|XP_004289862.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 197/219 (90%), Gaps = 4/219 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA+ QVVE +VKVE+PGENNVH+NAFYAEERLL+TE EAMRDCN LSARH
Sbjct  526  MDMAVDCKPGEAYNQVVEVDVKVEDPGENNVHSNAFYAEERLLRTESEAMRDCNALSARH  585

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y+ +EMFPG
Sbjct  586  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQYSPDEMFPG  645

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLA+WV++NR LEETDIVLWYVFG+THVPRLEDWPVMPVE IGF L+P
Sbjct  646  GEFPNQNPRVGEGLATWVQKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVEHIGFKLVP  705

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPPS+ +   KE+ V       GL+AKL
Sbjct  706  HGFFNCSPAVDVPPSACESKAKEDDVKDN----GLMAKL  740



>ref|XP_011071936.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=786

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 195/224 (87%), Gaps = 5/224 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NV+VEEPG +NVHNNAFYAEE LL++ELEAMRDC+PLSARH
Sbjct  563  MDMAVDCKPGEAHNQVVEVNVRVEEPGNDNVHNNAFYAEETLLRSELEAMRDCDPLSARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNR+GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT YAR E FPG
Sbjct  623  WIIRNTRTVNRSGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYARGEDFPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGL SWVKQNRPLEE DIVLWYVFG+THVPRLEDWPVMPVE IGF+L P
Sbjct  683  GEFPNQNPRAGEGLVSWVKQNRPLEENDIVLWYVFGITHVPRLEDWPVMPVEHIGFVLQP  742

Query  238  HGFFNCspavdvppssadpdPKENGV----ITKP-CHPGLVAKL  122
            HGFFNCSPAVDVPP+  + D KE+ V    + KP     L+AKL
Sbjct  743  HGFFNCSPAVDVPPNVCEIDAKESDVKDSSVAKPTSSAALIAKL  786



>gb|EMS63127.1| Primary amine oxidase [Triticum urartu]
Length=735

 Score =   335 bits (858),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G NNVHNNAFYAEE++LK+EL+AMRDC+P SARH
Sbjct  516  MDMAVDCKPNEAHNQVVEVNVKVESAGTNNVHNNAFYAEEKILKSELQAMRDCDPSSARH  575

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQ TG++LVPGSNCLP A  EAKFLRRA FLKHNLWVTPY  +E FPG
Sbjct  576  WIVRNTRAVNRTGQPTGFRLVPGSNCLPFALPEAKFLRRAGFLKHNLWVTPYKSDEKFPG  635

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  636  GEFPNQNPRLHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  695

Query  238  HGFFNC  221
            HGFFNC
Sbjct  696  HGFFNC  701



>ref|XP_006652410.1| PREDICTED: copper amine oxidase 1-like [Oryza brachyantha]
Length=699

 Score =   333 bits (855),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  482  MDMAVDCKPNEAHNQVVEVNVKVESTGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQ TGY+LVPGSNCLPLA  +AKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  542  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPDAKFLRRAGFLKHNLWVTQYRSDEVFPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  662  HGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  699



>ref|XP_003581353.1| PREDICTED: copper amine oxidase 1-like [Brachypodium distachyon]
Length=771

 Score =   335 bits (860),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAF+AEE++LK+ELEAMRDC+P SARH
Sbjct  553  MDMAVDCKPNEAHNQVVEINVKVESAGTHNVHNNAFFAEEKILKSELEAMRDCDPSSARH  612

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVTPY  +E FPG
Sbjct  613  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTPYNSDEKFPG  672

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  673  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  732

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
             GFFNCSPAVDVPP S+D D KE        + GLV+KL
Sbjct  733  DGFFNCSPAVDVPPGSSDVDAKEAESPKAIQNGGLVSKL  771



>ref|XP_008668433.1| PREDICTED: uncharacterized protein LOC100383438 isoform X1 [Zea 
mays]
 tpg|DAA37327.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
 tpg|DAA37328.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=780

 Score =   335 bits (860),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  563  MDMAVDCKPNEAHNQVVEVNVKVESAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y R EMFPG
Sbjct  623  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKRGEMFPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  683  GEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  742

Query  238  HGFFNC  221
            HGFFNC
Sbjct  743  HGFFNC  748



>gb|KCW83296.1| hypothetical protein EUGRSUZ_B00228 [Eucalyptus grandis]
Length=1349

 Score =   345 bits (884),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE+  QVVE +VKVEEPGE NVHNNAFYAEE LL++EL+AMRDCNPL+ARH
Sbjct  547  MDMAVDCKPGESFNQVVEVDVKVEEPGEKNVHNNAFYAEETLLRSELQAMRDCNPLTARH  606

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  607  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAYAPDEMFPG  666

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL++WVK+NRPLEETD+VLWYVFG+THVPRLEDWPVMPVERIGFMLMP
Sbjct  667  GEFPNQNPRVGEGLSTWVKRNRPLEETDVVLWYVFGITHVPRLEDWPVMPVERIGFMLMP  726

Query  238  HGFFNC  221
            HGFFNC
Sbjct  727  HGFFNC  732



>gb|EYU22171.1| hypothetical protein MIMGU_mgv1a001639mg [Erythranthe guttata]
Length=781

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE H QVVE NV+VEEPGE NVHNNAFYAEE LL++ELEAMRDC+PLSARH
Sbjct  556  MDMAVDCKPGEMHNQVVEVNVRVEEPGEENVHNNAFYAEETLLRSELEAMRDCDPLSARH  615

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNR+G+LTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  616  WIIRNTRTVNRSGELTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  675

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL SWVKQNRPLEETD+VLWYVFG+THVPRLEDWPVMPVE IGF+L P
Sbjct  676  GEFPNQNPRVGEGLVSWVKQNRPLEETDVVLWYVFGITHVPRLEDWPVMPVEHIGFVLQP  735

Query  238  HGFFNCspavdvppssadpdPKENGV  161
            HGFFNCSPAVDVPPS+ + + KEN V
Sbjct  736  HGFFNCSPAVDVPPSACELEAKENDV  761



>emb|CDY35376.1| BnaA03g19840D [Brassica napus]
Length=1065

 Score =   341 bits (875),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA+ QVVE NVKV+EPGENN+HNNAFYAEE+LL++E EA RDC+P SARH
Sbjct  534  MDMSVDCKPGEAYNQVVEVNVKVDEPGENNIHNNAFYAEEKLLRSEAEATRDCDPFSARH  593

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  594  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  653

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  654  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  713

Query  238  HGFFNC  221
            HGFFNC
Sbjct  714  HGFFNC  719



>ref|XP_009142070.1| PREDICTED: LOW QUALITY PROTEIN: copper amine oxidase 1 [Brassica 
rapa]
Length=778

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA  QVVE NV+V+E GENN+HNNAFYAEE+LL++E EAMRDC+P SARH
Sbjct  557  MDMSVDCKPGEAFNQVVEVNVRVDEXGENNIHNNAFYAEEKLLRSEAEAMRDCDPFSARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y   E FPG
Sbjct  617  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYDPEEKFPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE IGF LMP
Sbjct  677  GEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVEHIGFTLMP  736

Query  238  HGFFNC  221
            HGFFNC
Sbjct  737  HGFFNC  742



>ref|XP_004975956.1| PREDICTED: copper amine oxidase 1-like [Setaria italica]
Length=781

 Score =   333 bits (854),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE LLK+EL+AMRDC+P SARH
Sbjct  563  MDMAVDCKPNEAHNQVVEVNVKVESAGTHNVHNNAFYAEEELLKSELQAMRDCDPSSARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EMFPG
Sbjct  623  WIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEMFPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGL +WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE IGFMLMP
Sbjct  683  GEFPNQNPRIHEGLPTWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVEHIGFMLMP  742

Query  238  HGFFNC  221
            HGFFNC
Sbjct  743  HGFFNC  748



>emb|CDY22564.1| BnaC03g23740D [Brassica napus]
Length=1075

 Score =   338 bits (867),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 171/188 (91%), Gaps = 2/188 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VDCK GEA+ QVVE NVKV+EPGENN+HNNAFYAEE+LL++E EA RDC+P SARH
Sbjct  534  MDMSVDCKPGEAYNQVVEVNVKVDEPGENNIHNNAFYAEEKLLRSEAEATRDCDPFSARH  593

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT YA +E FPG
Sbjct  594  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRYAPDEKFPG  653

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLW--YVFGVTHVPRLEDWPVMPVERIGFML  245
            GEFPNQNPR GEGLA+WVKQNR LEE+D+VLW  YVFG+THVPRLEDWPVMPVE IGF L
Sbjct  654  GEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVYVFGITHVPRLEDWPVMPVEHIGFTL  713

Query  244  MPHGFFNC  221
            MPHGFFNC
Sbjct  714  MPHGFFNC  721



>ref|XP_007155469.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
 gb|ESW27463.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
Length=1289

 Score =   340 bits (871),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVD K G+A  QVVE NVKVEEPGENNVHNNAFYAEE LL++ELEAMRDCNPL+ARH
Sbjct  511  MDMAVDSKPGDALNQVVEINVKVEEPGENNVHNNAFYAEETLLRSELEAMRDCNPLTARH  570

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR  NR+G+LTGYKLVPGSNCLPLAG+EA FLRRA FL+HNLW+TPY+ ++MFPG
Sbjct  571  WIVRNTRRGNRSGELTGYKLVPGSNCLPLAGSEAMFLRRAGFLRHNLWITPYSHHQMFPG  630

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ +GL +WVKQNR LEET IVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  631  GEFPNQNPRLNQGLPTWVKQNRSLEETAIVLWYVFGMTHIPRLEDWPVMPVERIGFMLMP  690

Query  238  HGFFNC  221
            HGFFNC
Sbjct  691  HGFFNC  696



>ref|XP_009606421.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=786

 Score =   328 bits (841),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NVKVEEPG+ NVHNNAFYAEE LL++EL+AMRDC+P SARH
Sbjct  563  MNMAVDCKPGEAHNQVVEVNVKVEEPGKENVHNNAFYAEETLLRSELQAMRDCDPFSARH  622

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  623  WIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEEFPG  682

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVKQ+RPLEE+DIVLWY+FG+THVPRLEDWPVMPVE IGF+L P
Sbjct  683  GEFPNQNPRVGEGLASWVKQDRPLEESDIVLWYIFGITHVPRLEDWPVMPVEHIGFVLQP  742

Query  238  HGFFNC  221
            HGFFNC
Sbjct  743  HGFFNC  748



>ref|XP_006600617.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=722

 Score =   326 bits (836),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+M VD K G+A  QVVE NVKVEEPG+NNVHNNAFYAEE LLK+ELEAMRDCNPL+ARH
Sbjct  527  MNMTVDSKPGDALNQVVEINVKVEEPGDNNVHNNAFYAEETLLKSELEAMRDCNPLAARH  586

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY+ ++MFPG
Sbjct  587  WIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPYSHDQMFPG  646

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  242
            GEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVERIGFMLM
Sbjct  647  GEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVERIGFMLM  705



>ref|XP_006351050.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=786

 Score =   327 bits (839),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 189/225 (84%), Gaps = 6/225 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NVKVEEPG+ NVHNNAFYAEE LL++EL+AMRDC+P SARH
Sbjct  562  MNMAVDCKPGEAHNQVVEVNVKVEEPGKENVHNNAFYAEETLLRSELQAMRDCDPFSARH  621

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  622  WIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  681

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLASWVKQ+RPLEE+D VLWY+FG+THVPRLEDWPVMPVE IGFML P
Sbjct  682  GEFPNQNPRAGEGLASWVKQDRPLEESDTVLWYIFGITHVPRLEDWPVMPVEHIGFMLQP  741

Query  238  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDV         S D +  +N  + K    GL+AKL
Sbjct  742  HGFFNCSPAVDVPPPSGCDSESRDSEVTDNSSVAKHTTTGLMAKL  786



>gb|KEH27747.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=714

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE +VKVE+PG+NNVHNNAFYAEERLLK+ELEAMRDCNPLSARH
Sbjct  519  MDMAVDCKPGEAFNQVVEVDVKVEDPGKNNVHNNAFYAEERLLKSELEAMRDCNPLSARH  578

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY  NEM PG
Sbjct  579  WIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYVHNEMHPG  638

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  242
            GEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVERIGFMLM
Sbjct  639  GEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVERIGFMLM  697



>ref|XP_009778427.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 gb|ABI93948.1| methylputrescine oxidase [Nicotiana tabacum]
 dbj|BAF49519.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=790

 Score =   327 bits (837),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NVKVEEPG+ NVHNNAFYAEE LL++EL+AMRDC+P SARH
Sbjct  567  MNMAVDCKPGEAHNQVVEVNVKVEEPGKENVHNNAFYAEETLLRSELQAMRDCDPFSARH  626

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  627  WIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  686

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVKQ+RPLEE+DIVLWY+FG+THVPRLEDWPVMPVE IGF+L P
Sbjct  687  GEFPNQNPRVGEGLASWVKQDRPLEESDIVLWYIFGITHVPRLEDWPVMPVEHIGFVLQP  746

Query  238  HGFFNC  221
            HG+FNC
Sbjct  747  HGYFNC  752



>ref|XP_004244763.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=788

 Score =   325 bits (833),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NVKVEEPG+ NVHNNAFYAEE LL++EL+AMRDC+P SARH
Sbjct  564  MNMAVDCKPGEAHNQVVEVNVKVEEPGKENVHNNAFYAEETLLRSELQAMRDCDPFSARH  623

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPG NCLPLAG EAKF+RRAAFLKHNLWVT YA  E FPG
Sbjct  624  WIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFMRRAAFLKHNLWVTQYAPGEDFPG  683

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR GEGLASWVKQ+RPLEE+D VLWY+FG+THVPRLEDWPVMPVE IGFML P
Sbjct  684  GEFPNQNPRAGEGLASWVKQDRPLEESDTVLWYIFGITHVPRLEDWPVMPVEHIGFMLQP  743

Query  238  HGFFNC  221
            HGFFNC
Sbjct  744  HGFFNC  749



>dbj|BAJ87935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NV VE  G NNVHNNAFYAEE++LK+EL+AMRDC+P SARH
Sbjct  308  MDMAVDCKPNEAHNQVVEVNVNVESAGTNNVHNNAFYAEEKILKSELQAMRDCDPSSARH  367

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQ TG++LVPGSNCLP A  EAKFLRRA FLKHNLWVTPY  +E FPG
Sbjct  368  WIVRNTRAVNRTGQPTGFRLVPGSNCLPFALPEAKFLRRAGFLKHNLWVTPYKSDEKFPG  427

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVKQ+RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  428  GEFPNQNPRLHEGLATWVKQDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  487

Query  238  HGFFNC  221
            HGFFNC
Sbjct  488  HGFFNC  493



>ref|NP_001053078.1| Os04g0476100 [Oryza sativa Japonica Group]
 dbj|BAF14992.1| Os04g0476100, partial [Oryza sativa Japonica Group]
Length=518

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  301  MDMAVDCKPNEAHNQVVEVNVKVENAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  360

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  361  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  420

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  421  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  480

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  481  HGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  518



>gb|EMT09520.1| Copper methylamine oxidase [Aegilops tauschii]
Length=808

 Score =   323 bits (828),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EA+ QVVE NVKVE  G NNVHNN FYAEE LL++EL+AMRDC+P SARH
Sbjct  592  MDMAVDCKPNEAYNQVVEVNVKVESSGPNNVHNNGFYAEEELLQSELQAMRDCDPSSARH  651

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGYKL+PGSNCLP    EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  652  WIVRNTRTVNRTGQPTGYKLIPGSNCLPFCLPEAKFLRRAGFLKHNLWVTSYKSDEIFPG  711

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++R LEET+IVLWYVFG+TH+PRLEDWPVMPVER GFMLMP
Sbjct  712  GEFPNQNPRIHEGLATWVKKDRSLEETNIVLWYVFGITHIPRLEDWPVMPVERSGFMLMP  771

Query  238  HGFFNC  221
            HGFFNC
Sbjct  772  HGFFNC  777



>ref|XP_009618867.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 188/225 (84%), Gaps = 7/225 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NV+VEEPG+ NVHNNAFYA+E +L +EL+AMRDC+ LSARH
Sbjct  479  MNMAVDCKPGEAHNQVVEVNVRVEEPGKENVHNNAFYAKETVLTSELQAMRDCDTLSARH  538

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  539  WIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  598

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  599  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  658

Query  238  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  659  HGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  702



>gb|ABR16250.1| unknown [Picea sitchensis]
Length=788

 Score =   320 bits (821),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE   QVVE NVKVEEPG NN+HNNAFYAEE LL+TE +A RDCNPLSARH
Sbjct  572  MDMAVDCKPGEPVNQVVEVNVKVEEPGLNNIHNNAFYAEEELLRTESQAQRDCNPLSARH  631

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFL+HNLWVT Y ++E +PG
Sbjct  632  WIVRNTRTVNRTGQLTGYKLVPGANCLPLAGSEAKFLRRAAFLQHNLWVTQYHKDEQYPG  691

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL +WVKQNR LEE D+VLWYVFG+THVPRLEDWPVMPVERIGFML P
Sbjct  692  GEFPNQNPRVGEGLHTWVKQNRNLEEADVVLWYVFGITHVPRLEDWPVMPVERIGFMLSP  751

Query  238  HGFFNC  221
            HGFFNC
Sbjct  752  HGFFNC  757



>emb|CAE05498.2| OSJNBa0022H21.18 [Oryza sativa Japonica Group]
Length=699

 Score =   318 bits (815),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  482  MDMAVDCKPNEAHNQVVEVNVKVENAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  542  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  662  HGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  699



>ref|XP_009379966.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=771

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 185/219 (84%), Gaps = 2/219 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK  EA  QVVE NVKVEEPG++N+HNNAFYAEE+LL++EL+AMRDC PLSARH
Sbjct  555  MNMAVDCKPNEAFNQVVEVNVKVEEPGKDNIHNNAFYAEEKLLRSELQAMRDCQPLSARH  614

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ  GYKL+PGSNCLPLAG EAKFLRRAAFLKHNLWVT Y  +EM+PG
Sbjct  615  WIVRNTRTVNRTGQPAGYKLMPGSNCLPLAGPEAKFLRRAAFLKHNLWVTSYKHDEMYPG  674

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WV++NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE IGF+LMP
Sbjct  675  GEFPNQNPRINEGLATWVRKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVEHIGFLLMP  734

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNC       P S +   KE G   K  H GLVAKL
Sbjct  735  HGFFNC-SPAVDVPPSPNEADKECGA-PKLMHNGLVAKL  771



>emb|CAH67316.1| OSIGBa0106G07.12 [Oryza sativa Indica Group]
Length=699

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  482  MDMAVDCKPNEAHNQVVEVNVKVENAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  541

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  542  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  601

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  602  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  661

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  662  HGFFNCSPAVDVPPGSSDADIKE-AESPKVIQNGLISKL  699



>dbj|BAF49520.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=766

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 188/225 (84%), Gaps = 7/225 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NV+VEEPG+ NVHNNAFYA+E +L +EL+AMRDC+ LSARH
Sbjct  543  MNMAVDCKPGEAHNQVVEVNVRVEEPGKENVHNNAFYAKETVLTSELQAMRDCDTLSARH  602

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  603  WIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  662

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  663  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  722

Query  238  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  723  HGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  766



>ref|XP_009618862.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618864.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618865.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=766

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 188/225 (84%), Gaps = 7/225 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NV+VEEPG+ NVHNNAFYA+E +L +EL+AMRDC+ LSARH
Sbjct  543  MNMAVDCKPGEAHNQVVEVNVRVEEPGKENVHNNAFYAKETVLTSELQAMRDCDTLSARH  602

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  603  WIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  662

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  663  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  722

Query  238  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  723  HGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  766



>ref|XP_009773282.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 ref|XP_009773283.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
Length=774

 Score =   318 bits (815),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 188/225 (84%), Gaps = 7/225 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NV+VEEPG+ NVHNNAFYA+E +L +EL+AMRDC+ LSARH
Sbjct  551  MNMAVDCKPGEAHNQVVEVNVRVEEPGKENVHNNAFYAKETVLTSELQAMRDCDTLSARH  610

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPG NCLPLAG +AKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  611  WIVRNTRTSNRTGQLTGYKLVPGPNCLPLAGPKAKFLRRAAFLKHNLWVTKYAPGEDFPG  670

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML P
Sbjct  671  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFMLQP  730

Query  238  HGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  731  HGFFNCSPAVDVPPPRGCDMEIKDSDGSENGV-AKPTPSNLMAKL  774



>ref|XP_001759255.1| predicted protein [Physcomitrella patens]
 gb|EDQ75939.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   316 bits (810),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVDC  GE   QVVE N+KVEEPG  N HNNAFYAEE LL++EL+A RDCN LS RH
Sbjct  490  LDMAVDCNPGEGLNQVVEVNMKVEEPGPENPHNNAFYAEETLLRSELQAQRDCNALSHRH  549

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKL+PG NCLPLAG +AKFLRRAAFL HNLWVT Y  +E FPG
Sbjct  550  WIVRNTRTFNRTGQLTGYKLMPGRNCLPLAGPDAKFLRRAAFLNHNLWVTEYKHDECFPG  609

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+GEGL +WVKQ+R LEETDIVLWYVFGVTHVPRLEDWPVMPVE +GF L+P
Sbjct  610  GEFPNQNPRIGEGLPTWVKQDRKLEETDIVLWYVFGVTHVPRLEDWPVMPVEHVGFNLLP  669

Query  238  HGFFNC  221
            HGFFNC
Sbjct  670  HGFFNC  675



>gb|EAZ31082.1| hypothetical protein OsJ_15179 [Oryza sativa Japonica Group]
Length=838

 Score =   319 bits (817),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  621  MDMAVDCKPNEAHNQVVEVNVKVENAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  680

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  681  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  740

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  741  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  800

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  801  HGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  838



>gb|EAY94528.1| hypothetical protein OsI_16305 [Oryza sativa Indica Group]
Length=787

 Score =   318 bits (814),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EAH QVVE NVKVE  G +NVHNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  570  MDMAVDCKPNEAHNQVVEVNVKVENAGTHNVHNNAFYAEEKLLKSELQAMRDCDPSSARH  629

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  630  WIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQYKSDEVFPG  689

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVERIGFMLMP
Sbjct  690  GEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVERIGFMLMP  749

Query  238  HGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  122
            HGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  750  HGFFNCSPAVDVPPGSSDADIKE-AESPKVIQNGLISKL  787



>emb|CAE02362.2| OSJNBb0016B03.15 [Oryza sativa Japonica Group]
Length=792

 Score =   318 bits (814),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EA+ QVVE NV  E  G NN+HNNAFYAEE+LLK+EL+AMRDC+P SAR+
Sbjct  586  MDMAVDCKPNEAYNQVVEVNVNTECAGPNNMHNNAFYAEEKLLKSELQAMRDCHPSSARY  645

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PG
Sbjct  646  WIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPG  705

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML P
Sbjct  706  GEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFMLKP  765

Query  238  HGFFNC  221
             GFF+C
Sbjct  766  DGFFDC  771



>ref|XP_009404245.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EA  QVVE NVKVEEPG +N+HNNAFYAEE+LL++EL+AMRDCNP SARH
Sbjct  551  MDMAVDCKPNEAFNQVVEVNVKVEEPGLHNIHNNAFYAEEKLLRSELQAMRDCNPSSARH  610

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ  GYKL+PG NCLPLAG EAKF RRAAFLKHNLWVT Y  +EM+PG
Sbjct  611  WIVRNTRTVNRTGQPAGYKLMPGPNCLPLAGPEAKFFRRAAFLKHNLWVTSYKHDEMYPG  670

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK+NR LEET+IVLWYVFGVTH+PRLEDWPVMPVERIGFMLMP
Sbjct  671  GEFPNQNPRINEGLATWVKKNRSLEETNIVLWYVFGVTHIPRLEDWPVMPVERIGFMLMP  730

Query  238  HGFFNC  221
            HGFFNC
Sbjct  731  HGFFNC  736



>ref|XP_001757203.1| predicted protein [Physcomitrella patens]
 gb|EDQ78062.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   313 bits (803),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM+VDC  GE   QVVE N+KVE+PG  N HNNAFYAEE LL +EL A RDCN L+ RH
Sbjct  490  LDMSVDCNPGERLNQVVEVNMKVEDPGPENPHNNAFYAEETLLSSELHAQRDCNALTHRH  549

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKL+PG NCLPLAG +AKFLRRAAFL HNLWVT Y R+E FPG
Sbjct  550  WIVRNTRTFNRTGQLTGYKLMPGRNCLPLAGPDAKFLRRAAFLNHNLWVTEYKRDECFPG  609

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL +WVKQ+R LEETD+VLWYVFGVTHVPRLEDWPVMPVE +GF L+P
Sbjct  610  GEFPNQNPRVGEGLPTWVKQDRKLEETDVVLWYVFGVTHVPRLEDWPVMPVEHVGFKLLP  669

Query  238  HGFFNC  221
            HGFFNC
Sbjct  670  HGFFNC  675



>gb|EEC76708.1| hypothetical protein OsI_14715 [Oryza sativa Indica Group]
Length=729

 Score =   306 bits (783),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EA+ QVVE NV  E  G NN+HNNAFYAEE+LLK+EL+AMRDC+P SARH
Sbjct  496  MDMAVDCKPNEAYNQVVEVNVNAECAGPNNMHNNAFYAEEKLLKSELQAMRDCHPSSARH  555

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PG
Sbjct  556  WIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPG  615

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  245
            GEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML
Sbjct  616  GEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFML  673



>ref|XP_001774529.1| predicted protein [Physcomitrella patens]
 gb|EDQ60597.1| predicted protein [Physcomitrella patens]
Length=705

 Score =   305 bits (781),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVDCK GE   QVVE NVKVE+PG  N HNNAF+AEE LL++E +A+RDCN LSARH
Sbjct  485  LDMAVDCKPGEGLNQVVEVNVKVEKPGPKNPHNNAFFAEETLLRSEQQALRDCNALSARH  544

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPGSNCLPLAG +AKFLRRAAFLKHNLWVT Y  +E FPG
Sbjct  545  WIVRNTRTFNRTGQLTGYKLVPGSNCLPLAGPDAKFLRRAAFLKHNLWVTQYNPDECFPG  604

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL +WVKQ+R LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF LMP
Sbjct  605  GEFPNQNPRVGEGLPTWVKQDRKLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFSLMP  664

Query  238  HGFFNC  221
            HGFFNC
Sbjct  665  HGFFNC  670



>gb|EMS61925.1| Copper methylamine oxidase [Triticum urartu]
Length=760

 Score =   306 bits (783),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EA+ QVVE NVKVE  G NN+HNNAFYAEE LL++EL AMRDC+P SARH
Sbjct  544  MDMAVDCKPNEAYNQVVEVNVKVESSGPNNMHNNAFYAEEELLQSELLAMRDCDPSSARH  603

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGYKL+PGSNCLP    EAKFLRRA FLKHNLWVT Y  +E+FPG
Sbjct  604  WIVRNTRTVNRTGQPTGYKLIPGSNCLPFCLPEAKFLRRAGFLKHNLWVTSYKSDEIFPG  663

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPR+ EGLA+WVK++R LEET+IVLWYVFG+TH+PRLEDWPVMPVER GF++MP
Sbjct  664  GEFPNQNPRIHEGLATWVKKDRSLEETNIVLWYVFGITHIPRLEDWPVMPVERSGFIIMP  723

Query  238  HGFFNC  221
            HGFFNC
Sbjct  724  HGFFNC  729



>gb|EAZ29581.1| hypothetical protein OsJ_13655 [Oryza sativa Japonica Group]
Length=819

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK  EA+ QVVE NV  E  G NN+HNNAFYAEE+LLK+EL+AMRDC+P SAR+
Sbjct  586  MDMAVDCKPNEAYNQVVEVNVNTECAGPNNMHNNAFYAEEKLLKSELQAMRDCHPSSARY  645

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y  +EM+PG
Sbjct  646  WIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSYKNDEMYPG  705

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  245
            GEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE IGFML
Sbjct  706  GEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVEHIGFML  763



>ref|XP_009618866.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=723

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDCK GEAH QVVE NV+VEEPG+ NVHNNAFYA+E +L +EL+AMRDC+ LSARH
Sbjct  543  MNMAVDCKPGEAHNQVVEVNVRVEEPGKENVHNNAFYAKETVLTSELQAMRDCDTLSARH  602

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT YA  E FPG
Sbjct  603  WIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQYAPGEDFPG  662

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  245
            GEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE IGFML
Sbjct  663  GEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVEHIGFML  720



>ref|XP_001753509.1| predicted protein [Physcomitrella patens]
 gb|EDQ81732.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            ++MAVD   G    QVVE NVKVE+PG +N HNNAFYAEE LL++E EA RDCNP SARH
Sbjct  445  LNMAVDSNPGAGLNQVVEVNVKVEKPGPSNPHNNAFYAEETLLRSEQEAQRDCNPFSARH  504

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRT NRTG LTGYKLVPGSNCLPLAG +AKFLRRAAFLKHNLWVT Y  +E+FPG
Sbjct  505  WIVRNTRTFNRTGHLTGYKLVPGSNCLPLAGPDAKFLRRAAFLKHNLWVTQYYPDEIFPG  564

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFPNQNPRVGEGL +WVKQ+R LEETDIVLWYVFGVTH+PRLEDWPVMPVE IGF L+P
Sbjct  565  GEFPNQNPRVGEGLPTWVKQDRKLEETDIVLWYVFGVTHIPRLEDWPVMPVEHIGFSLVP  624

Query  238  HGFFNC  221
            HGFFNC
Sbjct  625  HGFFNC  630



>gb|KDO82259.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=716

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEAH QVVE NVKVEEPG+NNVHNNAFYAEE LLK+EL+AMRDCNPL+ARH
Sbjct  557  MDMAVDCKPGEAHNQVVEMNVKVEEPGKNNVHNNAFYAEEELLKSELQAMRDCNPLTARH  616

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPYA +EM+PG
Sbjct  617  WIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPYAHDEMYPG  676

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  317
            GEFPNQNPRVGEGLA+WV+QNR LEETDIVLW V
Sbjct  677  GEFPNQNPRVGEGLATWVEQNRSLEETDIVLWLV  710



>ref|XP_002462763.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
 gb|EER99284.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
Length=651

 Score =   288 bits (737),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM VDC   E H QVVE NVKVE  G +NVH+NAFYAEE+LLK+EL+A+RDC+PLS RH
Sbjct  454  MDMDVDCNPNEPHNQVVEVNVKVESAGPHNVHHNAFYAEEKLLKSELQAVRDCDPLSKRH  513

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRT +LTGYKL+PGSNC P+A  EAKFLRRA FLKHNLWVTPY  +EMFPG
Sbjct  514  WIVRNTRTVNRTRKLTGYKLMPGSNCKPMALPEAKFLRRAGFLKHNLWVTPYKSDEMFPG  573

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G+FPNQNP + EGL +WVK++R LEETDIVLWYVFG+TH+PRLEDWPVMPV+R+   ++P
Sbjct  574  GDFPNQNPHIDEGLPTWVKKDRSLEETDIVLWYVFGLTHIPRLEDWPVMPVDRMDSSIVP  633



>ref|XP_007211293.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
 gb|EMJ12492.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
Length=714

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GE + QVVE +VKVE+PG+NNVH+NAFYAEE LL+TEL+AMRDCNPL+ARH
Sbjct  561  MDMAVDCKPGETYNQVVELDVKVEKPGDNNVHSNAFYAEETLLRTELQAMRDCNPLTARH  620

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYA++EMFPG
Sbjct  621  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAQDEMFPG  680

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  317
            GEFPNQNPRVGEGLA+WVK+NR LEETDIVLW V
Sbjct  681  GEFPNQNPRVGEGLATWVKKNRSLEETDIVLWSV  714



>ref|XP_002979456.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
 gb|EFJ19345.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
Length=668

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDC  GE   QVVE NV  E+ G +N HNN+FY  E +LK+EL+A RDCNPLSARH
Sbjct  446  MNMAVDCVPGEQANQVVEVNVLSEKAGSDNPHNNSFYPTETVLKSELQAQRDCNPLSARH  505

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+ NR GQLTGYKLVPGSNCLPL G  A  LRRA FL HNLWVT Y+ +E +PG
Sbjct  506  WIVRNTRSFNRMGQLTGYKLVPGSNCLPLVGENAMMLRRAKFLHHNLWVTSYSPDERYPG  565

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G+FPNQNPRVGEGL +W K+++ LE+ DIVLWY FGV HVPRLEDWPVMPVE +GF L P
Sbjct  566  GDFPNQNPRVGEGLPTWTKRDKNLEQADIVLWYTFGVIHVPRLEDWPVMPVEHLGFSLAP  625

Query  238  HGFFNC  221
             GFFNC
Sbjct  626  VGFFNC  631



>gb|AFK48029.1| unknown [Lotus japonicus]
Length=174

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 4/174 (2%)
 Frame = -2

Query  631  MRDCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWV  452
            MRDCNP++ARHWI++NTR+ NRTGQLTGYKLVPGSNCLPLA +EAKFLRRAAFLKHNLWV
Sbjct  1    MRDCNPMTARHWIVRNTRSGNRTGQLTGYKLVPGSNCLPLARSEAKFLRRAAFLKHNLWV  60

Query  451  TPYARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVM  272
            T Y+ +E+FPGGEFPNQNPRV EGLA+WVKQNR LEETDIVLWYVFG+THVPRLEDWPVM
Sbjct  61   TKYSHDEVFPGGEFPNQNPRVSEGLATWVKQNRSLEETDIVLWYVFGITHVPRLEDWPVM  120

Query  271  PVERIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  122
            PVERIGFMLMPHGFFNCSPAVDVPP++   D K+N V     +K     L AKL
Sbjct  121  PVERIGFMLMPHGFFNCSPAVDVPPNTCVGDSKDNDVKDNGASKTIPGALAAKL  174



>ref|XP_007036330.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY20831.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=755

 Score =   283 bits (723),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N KVEEPGENNVHNNAFYAEE LLKTEL+AMRDCNP +ARH
Sbjct  575  MDMAVDCKPGEAFNQVVEVNAKVEEPGENNVHNNAFYAEETLLKTELQAMRDCNPFTARH  634

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT YA +EMFPG
Sbjct  635  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTRYAPDEMFPG  694

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  290
            GEFPNQNPR GEGLA+WVKQ+RPLEETDIV ++ +    + RL
Sbjct  695  GEFPNQNPRAGEGLATWVKQDRPLEETDIVCFWNYPCPSIGRL  737


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -1

Query  338  RHCSLVCFWSDSCSSAGRLAGNACGAHWFHAHAAWIL  228
                +VCFW+  C S GRLA  A GAHWFHA+AAWIL
Sbjct  719  EETDIVCFWNYPCPSIGRLACYASGAHWFHANAAWIL  755



>ref|XP_007044779.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
 gb|EOY00611.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
Length=754

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMAVDCK GEA  QVVE N+KVEEPG++NVHNNAFYAEE LL++EL+AMRDCNPLSARH
Sbjct  568  MDMAVDCKPGEAFNQVVEVNLKVEEPGKDNVHNNAFYAEEELLRSELQAMRDCNPLSARH  627

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPYAR EM+PG
Sbjct  628  WIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPYAREEMYPG  687

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  290
            GEFPNQNPRVGEGLA+WVK+NR LEE DIVL +   +T   RL
Sbjct  688  GEFPNQNPRVGEGLATWVKKNRSLEEADIVLCHTVSLTAHQRL  730



>gb|KJB19704.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=743

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDMA+DCK GEA  QVVE N KVEEPGENN+HNNAFYAEE LLKTEL+AMRDCNPL+ARH
Sbjct  569  MDMAIDCKPGEAFNQVVEVNAKVEEPGENNIHNNAFYAEETLLKTELQAMRDCNPLTARH  628

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  A NEMFPG
Sbjct  629  WIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQCAPNEMFPG  688

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  317
            GEFPNQNPR GEGLA+WVK++R LEETDIVLW +
Sbjct  689  GEFPNQNPRAGEGLATWVKRDRSLEETDIVLWLL  722



>ref|XP_002985875.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
 gb|EFJ13052.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
Length=710

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVD K GEA  QVVE NV  E PG NN H NAFYA+E LLK+E++A RDCNPLSARH
Sbjct  512  MNMAVDSKPGEAENQVVEVNVVPEPPGPNNPHCNAFYAKETLLKSEMQAQRDCNPLSARH  571

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NT+ VNR G  TGYKLVPG+NCL   G +A  LRRA FLKHNLWVT Y+++E++P 
Sbjct  572  WIVRNTKVVNRAGGNTGYKLVPGANCLGFIGKDAMILRRAEFLKHNLWVTSYSKDELYPA  631

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFP QNPR+GEGL +WVK++R LE  DIVLWYVFGVTH+PRLEDWPVMPVERIGF L P
Sbjct  632  GEFPKQNPRIGEGLPTWVKKDRDLENADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLTP  691

Query  238  HGFFNC  221
            HGFF+C
Sbjct  692  HGFFDC  697



>ref|XP_002984811.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
 gb|EFJ14061.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
Length=710

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVD K GEA  QVVE NV  E PG NN H NAFYA+E LLK+E++A RDCNPLSARH
Sbjct  512  MNMAVDSKPGEAENQVVEVNVVPEPPGPNNPHCNAFYAKETLLKSEMQAQRDCNPLSARH  571

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NT+ VNR G  TGYKLVPG+NCL   G +A  LRRA FLKHNLWVT Y+++E++P 
Sbjct  572  WIVRNTKVVNRAGGNTGYKLVPGANCLGFIGKDAMILRRAEFLKHNLWVTSYSKDELYPA  631

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GEFP QNPR+GEGL +WVK++R LE  DIVLWYVFGVTH+PRLEDWPVMPVERIGF L P
Sbjct  632  GEFPKQNPRIGEGLPTWVKKDRDLENADIVLWYVFGVTHIPRLEDWPVMPVERIGFTLTP  691

Query  238  HGFFNC  221
            HGFF+C
Sbjct  692  HGFFDC  697



>ref|XP_002977869.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
 gb|EFJ21207.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
Length=797

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 148/205 (72%), Gaps = 19/205 (9%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+MAVDC  GE   QVVE NV  E+ G +N HNN+FY  E +LK+EL+A RDCN LSARH
Sbjct  556  MNMAVDCVPGEQANQVVEVNVLSEKAGSDNPHNNSFYPTETVLKSELQAQRDCNSLSARH  615

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTR+ NR GQLTGYKLVPGSNCLPL G  A  LRRA FL HNLWVT Y+ +E +PG
Sbjct  616  WIVRNTRSFNRMGQLTGYKLVPGSNCLPLVGENAMMLRRAKFLHHNLWVTSYSPDERYPG  675

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLW-------------------YVFGVTHVP  296
            G+FPNQNPRVGEGL +W K+++ LE+ DIVLW                   Y FGV HVP
Sbjct  676  GDFPNQNPRVGEGLPTWTKRDKNLEQADIVLWSVAHFGLIRSFMVFSWISRYTFGVIHVP  735

Query  295  RLEDWPVMPVERIGFMLMPHGFFNC  221
            RLEDWPVMPVE +GF L P GFFNC
Sbjct  736  RLEDWPVMPVEHLGFSLAPVGFFNC  760



>gb|KDO69507.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=735

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM VDCK GEA  QVVE +VKVE+PG +NVHNNAFYAEE LLK+E++AMRDCNPL+ARH
Sbjct  553  MDMEVDCKPGEAFNQVVEVDVKVEKPGGSNVHNNAFYAEETLLKSEMQAMRDCNPLTARH  612

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT YAR+EMFPG
Sbjct  613  WIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAYARDEMFPG  672

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  317
            GEFPNQNPR+GEGL +WVKQNRPLEE+DIVLW+V
Sbjct  673  GEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWFV  706



>ref|XP_010678857.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 137/173 (79%), Gaps = 7/173 (4%)
 Frame = -2

Query  721  NVKVEEPGENNVHNN----AFYA--EERLLKTELEAMRDCNPLSARHWIIKNTRTVNRTG  560
            +V    PGE+  +        YA   +      ++   DCNP  A + + +NTRTVNRTG
Sbjct  492  SVGALSPGESRKYGTTIAPGLYAPVHQHFFVARMDMAVDCNPGEALNQV-RNTRTVNRTG  550

Query  559  QLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEG  380
            QLTGYKLVPGSNCLPLAG++AKFLRRAAFLKHNLWVT YA +EMFPGGEFPNQNPR GEG
Sbjct  551  QLTGYKLVPGSNCLPLAGSDAKFLRRAAFLKHNLWVTEYACDEMFPGGEFPNQNPRAGEG  610

Query  379  LASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  221
            LA+WVK+NRPL E+D+VLWYVFG+THVPRLEDWPVMPVE IGFMLMPHGFFNC
Sbjct  611  LATWVKKNRPLYESDVVLWYVFGLTHVPRLEDWPVMPVEHIGFMLMPHGFFNC  663



>ref|NP_001173054.1| Os02g0593150 [Oryza sativa Japonica Group]
 dbj|BAH91783.1| Os02g0593150 [Oryza sativa Japonica Group]
Length=311

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 130/177 (73%), Gaps = 33/177 (19%)
 Frame = -2

Query  772  MAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWI  593
            MAVDCK  EA+ Q                                 AMRDC+P SARHWI
Sbjct  1    MAVDCKPNEAYNQ---------------------------------AMRDCDPSSARHWI  27

Query  592  IKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGE  413
            ++NTRTVNRTGQ TGYKLVPGS+CLPLA  EAKFLRRA FLKHNLWVT +  +EMFPGGE
Sbjct  28   VRNTRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSFKNDEMFPGGE  87

Query  412  FPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  242
            FPNQNPR+ EGLA+WVK++R LEET++VLWYVFG+TH+PRLEDWPVMPVERI FMLM
Sbjct  88   FPNQNPRINEGLATWVKKDRSLEETNLVLWYVFGITHIPRLEDWPVMPVERISFMLM  144



>gb|KHN14535.1| Histamine oxidase [Glycine soja]
Length=121

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 109/130 (84%), Gaps = 12/130 (9%)
 Frame = -2

Query  772  MAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWI  593
            MAVDCK GEA  QVVE + KVEEPG+NNV+NNAFYAEE+LLK+ELEAMRDCNPLSARHWI
Sbjct  1    MAVDCKPGEAFNQVVEVDAKVEEPGKNNVYNNAFYAEEKLLKSELEAMRDCNPLSARHWI  60

Query  592  IKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGE  413
            ++NTR             VPGSNCLPLAG+EAKFLRR+AFLKHNLWVTPYA ++M PGGE
Sbjct  61   VRNTRK------------VPGSNCLPLAGSEAKFLRRSAFLKHNLWVTPYAPDKMHPGGE  108

Query  412  FPNQNPRVGE  383
            F NQNPRVGE
Sbjct  109  FSNQNPRVGE  118



>gb|EEE57286.1| hypothetical protein OsJ_07344 [Oryza sativa Japonica Group]
Length=681

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 123/162 (76%), Gaps = 8/162 (5%)
 Frame = -2

Query  703  PGENNVHNN----AFYA--EERLLKTELEAMRDCNPLSARHWII--KNTRTVNRTGQLTG  548
            PGE   +      + YA   +      ++   DC P  A + ++  +NTRTVNRTGQ TG
Sbjct  353  PGEQRKYGTTIAPSLYAPVHQHFFVARMDMAVDCKPNEAYNQVVEVRNTRTVNRTGQPTG  412

Query  547  YKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEGLASW  368
            YKLVPGS+CLPLA  EAKFLRRA FLKHNLWVT +  +EMFPGGEFPNQNPR+ EGLA+W
Sbjct  413  YKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSFKNDEMFPGGEFPNQNPRINEGLATW  472

Query  367  VKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  242
            VK++R LEET++VLWYVFG+TH+PRLEDWPVMPVERI FMLM
Sbjct  473  VKKDRSLEETNLVLWYVFGITHIPRLEDWPVMPVERISFMLM  514



>ref|WP_027094208.1| tyramine oxidase [Cohnella thermotolerans]
Length=647

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM +D         V E NV  EEPGE N  +N FYA+  LL+TE +A+RD    +AR+
Sbjct  441  MDMQIDGN----ENSVYEVNVVAEEPGEQNPRDNGFYAKSTLLETERQAVRDIKLETARY  496

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  GQ  GYK+V G NC P A   +  ++RA F++H+LWVTPY  NEM+  
Sbjct  497  WKIVNDNVKNDYGQSVGYKIVTGENCFPFASPNSSLIKRAGFIRHHLWVTPYNENEMYAA  556

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+   G+GL++WV+Q+RP++ TDIV+WY  G THVPR EDWPVMP   IGFML P
Sbjct  557  GNYPNQHIG-GDGLSAWVEQDRPVKNTDIVVWYTMGHTHVPRPEDWPVMPAAYIGFMLKP  615

Query  238  HGFFN  224
             GFFN
Sbjct  616  VGFFN  620



>ref|WP_036584415.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX90377.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91103.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91955.1| tyramine oxidase [Paenibacillus darwinianus]
Length=647

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 117/185 (63%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM +D         V E NV  EE GE N   NAFYA+  LL TE EA+RD    +AR+
Sbjct  441  MDMMIDGN----ENSVYEVNVVPEELGEGNPRENAFYAQSTLLTTESEAVRDIKLETARY  496

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W   N    N  GQ  GYK++ G NC P A   +  ++RA F+KH+LWVTPY  NEM+  
Sbjct  497  WKFVNDNVKNDLGQSVGYKIMTGENCFPFASDSSSLIKRAGFIKHHLWVTPYNENEMYAS  556

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQN   G+GL++WV+Q+RP+   DIV+WY  G THVPR EDWPVMP   IGF L P
Sbjct  557  GKYPNQNIG-GDGLSAWVEQDRPVVNKDIVVWYTMGHTHVPRPEDWPVMPAAYIGFTLKP  615

Query  238  HGFFN  224
             GFFN
Sbjct  616  VGFFN  620



>gb|ETX01504.1| hypothetical protein ETSY2_37115, partial [Candidatus Entotheonella 
sp. TSY2]
Length=278

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 120/185 (65%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVD      +  VVE N      GE+N + NAFYA+   LKTE EA R  +P +AR+
Sbjct  83   LDMAVDGP----NNTVVEVNTTAAPAGEDNPYGNAFYAKPTALKTEQEAQRLIDPFAARY  138

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N  + N+TG    YKL+PG N LP A  ++   +R A++  +LWVTPY+ NE +P 
Sbjct  139  WQITNPSSTNKTGAPVAYKLLPGENTLPFAQPDSSIAKRGAYMWKHLWVTPYSPNERYPA  198

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+ + G+GL +W + +R +E TD+V+WYV    H+ RLEDWPVMPV  IGF L P
Sbjct  199  GDYPNQH-QGGDGLPAWTQADRSVENTDLVVWYVMNGNHIARLEDWPVMPVTNIGFKLKP  257

Query  238  HGFFN  224
             GFF+
Sbjct  258  SGFFD  262



>ref|XP_006600619.1| PREDICTED: copper amine oxidase 1-like isoform X4 [Glycine max]
Length=680

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+M VD K G+A  QVVE NVKVEEPG+NNVHNNAFYAEE LLK+ELEAMRDCNPL+ARH
Sbjct  527  MNMTVDSKPGDALNQVVEINVKVEEPGDNNVHNNAFYAEETLLKSELEAMRDCNPLAARH  586

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWV  452
            WI++NTR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWV
Sbjct  587  WIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWV  635



>ref|WP_025696771.1| tyramine oxidase, partial [Paenibacillus durus]
Length=475

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 119/185 (64%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MD+ +D         V E +V  EE GE N   NAFYA+  LL+TE +A+RD    +AR+
Sbjct  269  MDIQIDGN----DNSVYEVDVVPEELGEGNPRENAFYAKSTLLETEQKAIRDIKLETARY  324

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  GQ  GYK+V G NC P A   +  L+RA F+KH+LWVTPY  +E++  
Sbjct  325  WKIVNDNVKNELGQSVGYKIVTGENCFPFASKNSSLLKRAGFIKHHLWVTPYNEDEIYAS  384

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+   GEGL+SW +Q+RP+  +DIV+WY  G THVPR EDWPVMP   IGFML P
Sbjct  385  GKYPNQHIG-GEGLSSWAEQDRPVANSDIVVWYTMGHTHVPRPEDWPVMPTAYIGFMLKP  443

Query  238  HGFFN  224
              FFN
Sbjct  444  VSFFN  448



>ref|XP_006600618.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Glycine max]
Length=697

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+M VD K G+A  QVVE NVKVEEPG+NNVHNNAFYAEE LLK+ELEAMRDCNPL+ARH
Sbjct  527  MNMTVDSKPGDALNQVVEINVKVEEPGDNNVHNNAFYAEETLLKSELEAMRDCNPLAARH  586

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWV  452
            WI++NTR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWV
Sbjct  587  WIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWV  635



>ref|WP_015845121.1| tyramine oxidase [Paenibacillus sp. JDR-2]
 gb|ACT02179.1| Primary-amine oxidase [Paenibacillus sp. JDR-2]
Length=647

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 120/185 (65%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM +D         V E NV  EEPGENN   NAFYA+  LL+TEL+A RD    +AR+
Sbjct  441  LDMQIDGN----ENSVYEVNVVSEEPGENNPRENAFYAKSTLLETELQAKRDIKLETARY  496

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W   N    N  GQ  G+K+V G NC P A   +  ++RA F+KH+LWVTPY  +EM+  
Sbjct  497  WKFVNDNVKNELGQSVGFKIVTGENCFPFALDNSSLIKRAGFIKHHLWVTPYDEDEMYAS  556

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+   G+GL++W +++R ++ TD+V+WY  G THVPR EDWPVMP   IGFML P
Sbjct  557  GKYPNQH-LGGDGLSAWAEKDRDIKNTDVVVWYTMGHTHVPRPEDWPVMPAAYIGFMLKP  615

Query  238  HGFFN  224
              FFN
Sbjct  616  VSFFN  620



>ref|WP_036002001.1| tyramine oxidase [Leptolyngbya sp. JSC-1]
Length=652

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 117/184 (64%), Gaps = 1/184 (1%)
 Frame = -2

Query  772  MAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWI  593
            M +D         V E N   E PG +N + NAFYAE  LLKTE  A R  +PL AR+W 
Sbjct  445  MRLDFDLDGTANSVYEVNTAAEPPGPDNPYGNAFYAESTLLKTEQAAQRIVDPLKARYWK  504

Query  592  IKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGE  413
            + N    NR GQ  G+KLVPG N LP A  +A  L+RA F+  +LWVTPY+ +E +P G 
Sbjct  505  VVNPNQHNRLGQPVGFKLVPGENVLPFAHPDAPILKRAGFMTKHLWVTPYSPSERYPTGN  564

Query  412  FPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHG  233
            +PNQ+P  GEGL  W + NR +E TD+V+WY+FG  H+PR ED+P+MPV   GF+L P G
Sbjct  565  YPNQHPG-GEGLPQWTQANRSIENTDLVVWYMFGHHHIPRPEDFPIMPVAYAGFLLKPVG  623

Query  232  FFNC  221
            FF+ 
Sbjct  624  FFDA  627



>ref|WP_007920030.1| tyramine oxidase [Ktedonobacter racemifer]
 gb|EFH82153.1| Primary-amine oxidase [Ktedonobacter racemifer DSM 44963]
Length=649

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 116/185 (63%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM +D      +  V E + + E  G  N + NAF+A+  LL TE+EA +  +P SAR+
Sbjct  450  MDMMIDG----VNNSVYEVHTEAEPLGPENPYGNAFFAKSTLLATEIEAQQTIDPFSARY  505

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W + N    NR G+   YKL+PG N LP    E+  ++RA F+K NLWVTPY   E++P 
Sbjct  506  WKVANPNVQNRLGEPVAYKLMPGDNALPFLHPESSIMKRAGFIKKNLWVTPYHEKELYPA  565

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+   GEGL +W + NR LE TD+VLWYV    HV R EDWPVMP   IGFML P
Sbjct  566  GDYPNQHAG-GEGLPAWTQANRSLENTDVVLWYVMNAHHVTRPEDWPVMPTTYIGFMLKP  624

Query  238  HGFFN  224
             GFF+
Sbjct  625  VGFFD  629



>ref|WP_036480875.1| tyramine oxidase [Myxosarcina sp. GI1]
Length=634

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 117/186 (63%), Gaps = 5/186 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM VD     A   V E N + E  GENN H NAF+A+   L TEL+A R  NP S R+
Sbjct  437  LDMCVDG----ADNSVYEVNTEAEPLGENNPHGNAFFAKATPLTTELKAQRIINPFSGRY  492

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N  ++N  GQ  GYKL+PG N LP A  E+  ++RA F+  +LWVTPY  +E++  
Sbjct  493  WKIVNPSSLNSLGQPVGYKLMPGDNILPFAHPESSVIKRAGFMNKHLWVTPYQPDELYGA  552

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+P   EGL  W + +R ++ TD+V+WY FG  HV R EDWPVMPV  I F L P
Sbjct  553  GDYPNQHPG-NEGLTKWTQSDRSVDNTDVVVWYTFGQHHVTRPEDWPVMPVAYIDFKLKP  611

Query  238  HGFFNC  221
             GFF+ 
Sbjct  612  IGFFDA  617



>ref|WP_012627324.1| tyramine oxidase [Cyanothece sp. PCC 7425]
 gb|ACL44238.1| Amine oxidase (copper-containing) [Cyanothece sp. PCC 7425]
Length=641

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 118/185 (64%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM+VD   GE +  V E N +   PG  N + NAF A + LL TE EA R  +PLSAR+
Sbjct  442  LDMSVD---GE-NNSVYEVNSEAVPPGPENPYGNAFIARKTLLTTETEAQRIIDPLSARY  497

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W+I N    N  GQ   YKL+PG N LP A  ++  ++RA F+  +LWVTPY   E +P 
Sbjct  498  WVIANPTVNNSLGQPVAYKLIPGENALPFAHPDSAIIKRATFMTKHLWVTPYHPKENYPA  557

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+P  G+GL  W   NR ++ TD+V+WY FG  H+PR EDWPVMPV  IGF L P
Sbjct  558  GDYPNQHPG-GDGLPRWTAANRSIDNTDLVVWYNFGHHHIPRPEDWPVMPVAYIGFYLKP  616

Query  238  HGFFN  224
             GFF+
Sbjct  617  SGFFD  621



>ref|WP_015186652.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
 gb|AFZ28775.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
Length=646

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 117/186 (63%), Gaps = 5/186 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM VD   GE +  V E N + E  G +N + NAFYAE  LL TE EA R  +P + R+
Sbjct  449  LDMCVD---GE-NNSVYEVNTQAEPMGPDNPYGNAFYAESTLLATESEAQRIIDPFTGRY  504

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  GQ   YKL+PG N LP A  E+  ++RA F+  +LWVTPY  +E++  
Sbjct  505  WKIVNPAVRNSLGQPVSYKLMPGENILPFAHPESSVIKRAGFMTKHLWVTPYDPDELYAA  564

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+P    GL +W K NR +E TD+V+WY FG  HV R EDWPVMPV  IGFML P
Sbjct  565  GDYPNQHPG-DAGLPAWTKANREIENTDVVVWYTFGHNHVTRPEDWPVMPVSHIGFMLKP  623

Query  238  HGFFNC  221
             GFF+ 
Sbjct  624  VGFFDA  629



>ref|WP_008317043.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=632

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 110/183 (60%), Gaps = 1/183 (1%)
 Frame = -2

Query  772  MAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWI  593
            M +D         V E N + E  G +N   N +YA   LL TE  A R  +PL  R+W 
Sbjct  435  MRLDFDVDGCANSVYEVNSQAEPLGPDNPQGNGWYAVPTLLDTEKSAQRRIDPLVGRYWK  494

Query  592  IKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGE  413
            + N +  NR GQ  G+KL+PG N LP A  EA  ++RA FL  +LWVTPY   E FP G 
Sbjct  495  VVNPQVTNRLGQPVGFKLIPGENILPFAHPEAPIMKRAGFLNQHLWVTPYQAAENFPAGP  554

Query  412  FPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHG  233
            +PNQ+P  GEGL  W   +RPLE TD+VLWYVFG  H+PR EDWPVMPV   GF L P G
Sbjct  555  YPNQHPG-GEGLPQWTVADRPLENTDVVLWYVFGHHHIPRPEDWPVMPVAYSGFTLKPLG  613

Query  232  FFN  224
            FF+
Sbjct  614  FFD  616



>ref|WP_011430198.1| tyramine oxidase [Synechococcus sp. JA-3-3Ab]
 gb|ABC99520.1| copper amine oxidase [Synechococcus sp. JA-3-3Ab]
Length=672

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 114/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVD   G  ++ + E + +   PG +N + NAF A   LLKTE EA +  +PL  R+
Sbjct  467  LDMAVD---GPGNS-LYEVHAEPLPPGPDNPYGNAFRARSTLLKTEQEAKQTVDPLRGRY  522

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TPY   E FP 
Sbjct  523  WKIVNPNRHNRLGQPVAYKLMPGENVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPA  582

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMPV  IGFML P
Sbjct  583  GNYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPVSYIGFMLKP  641

Query  238  HGFFNC  221
             GFF C
Sbjct  642  LGFFEC  647



>ref|WP_036531589.1| tyramine oxidase [Neosynechococcus sphagnicola]
 gb|KGF73303.1| tyramine oxidase [Neosynechococcus sphagnicola sy1]
Length=641

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 120/184 (65%), Gaps = 5/184 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM +D   GE ++ VVE N +    G +N + NAF A+E LL TE +A R  +PL+ R+
Sbjct  446  LDMTID---GENNS-VVEVNTEAVPLGPDNPYGNAFIAKETLLATESQAQRCIDPLAGRY  501

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N   +NR G+   YKL PG N LP A  +A  L+RA F+  +LWVTPY   E +P 
Sbjct  502  WKIVNPTVLNRLGKPVSYKLQPGENILPFADPQAWILKRAGFMTRHLWVTPYHPQENYPA  561

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+P  G GL +W + +R L+ TD+V+WY FG  H+PR EDWPVMPV  IGFML P
Sbjct  562  GDYPNQHPG-GAGLPAWTEADRSLDNTDLVVWYNFGHHHIPRPEDWPVMPVAYIGFMLKP  620

Query  238  HGFF  227
             GFF
Sbjct  621  VGFF  624



>ref|WP_008314860.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=643

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 118/185 (64%), Gaps = 6/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM VD      +  V E +++ E+  ++N + NAFYA+  LL TEL A R  +P+  R+
Sbjct  446  LDMCVDG----MNNSVYEVDIEPED-DDHNPYGNAFYAKSTLLPTELAAQRRIDPMKGRY  500

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G  T YKL+PG N LPLA   A  ++RA ++  +LWVTPY+ +E FP 
Sbjct  501  WKIVNPTKTNAMGYPTAYKLMPGENTLPLARPNASVIKRATYMTQHLWVTPYSPDEKFPA  560

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+P  GEGL  W + +RP+E TD+V+W+ F  +H PR EDWPVMPV  IGFML P
Sbjct  561  GNYPNQSPG-GEGLPQWTQADRPVENTDLVVWHTFAHSHSPRAEDWPVMPVSTIGFMLKP  619

Query  238  HGFFN  224
              FF+
Sbjct  620  LNFFD  624



>ref|WP_015124381.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
 gb|AFY60837.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
Length=650

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 116/185 (63%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM++D   GE ++ V E + +   PG +N   NAF A++ LLKTE EA +  +P  AR 
Sbjct  447  LDMSID---GEENS-VFETHSEAVPPGPDNPQMNAFIAKKTLLKTEQEAQQLVDPFIARS  502

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W+I N    N  GQ   YKL+P   CLP A  +A  ++RA FL  + W TPY  +E FP 
Sbjct  503  WLITNPNLKNYLGQPVAYKLIPSETCLPFANDQAWVMKRAGFLNTHFWATPYHPDENFPA  562

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G+ PNQ+P  GEGL  W + NRP+E TD+V+WY FG  H+PR EDWP+MP   IGF L P
Sbjct  563  GDHPNQHPG-GEGLQKWTQANRPIENTDVVVWYNFGHHHIPRPEDWPIMPTAYIGFHLKP  621

Query  238  HGFFN  224
             GFF+
Sbjct  622  FGFFD  626



>gb|ABD03718.1| putative copper methylamine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=641

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVD   G  ++ + E + +    G +N H NAF A   LLKTE EA +  +PL  R+
Sbjct  436  LDMAVD---GPCNS-LYEVHAEPLPLGPDNPHGNAFRARSTLLKTEQEAKQTVDPLRGRY  491

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TPY   E FP 
Sbjct  492  WKIVNPNRHNRLGQPVAYKLMPGDNVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPA  551

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMP   IGFML P
Sbjct  552  GDYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPASYIGFMLKP  610

Query  238  HGFFNC  221
             GFF C
Sbjct  611  LGFFEC  616



>ref|WP_041436864.1| tyramine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=647

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVD   G  ++ + E + +    G +N H NAF A   LLKTE EA +  +PL  R+
Sbjct  442  LDMAVD---GPCNS-LYEVHAEPLPLGPDNPHGNAFRARSTLLKTEQEAKQTVDPLRGRY  497

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TPY   E FP 
Sbjct  498  WKIVNPNRHNRLGQPVAYKLMPGDNVQLLAHPDSWLYRRAGYLAHHLWATPYHPGEKFPA  557

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMP   IGFML P
Sbjct  558  GDYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPASYIGFMLKP  616

Query  238  HGFFNC  221
             GFF C
Sbjct  617  LGFFEC  622



>ref|WP_017299862.1| tyramine oxidase [Nodosilinea nodulosa]
Length=642

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 117/185 (63%), Gaps = 6/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM +D         V E +++ EE  E+N + NAFYA+  LL TE  A R  +P+ AR+
Sbjct  446  MDMCIDG----LQNSVYEVDIEPEE-EEHNPYGNAFYAKSTLLTTEQAAQRLIDPMKARY  500

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G  T YKL+PG N LP+A + A   +RA ++  +LWVTPYA  E FP 
Sbjct  501  WKIVNPTETNAMGYPTAYKLMPGENTLPMARSGASVTKRATYMTQHLWVTPYAEEEKFPA  560

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+P  GEGL  W +++RP+  TD+V+WY F  +HVPR EDWPVMPV  IGFML P
Sbjct  561  GNYPNQHPG-GEGLPKWTERDRPIVNTDLVVWYTFAHSHVPRAEDWPVMPVAYIGFMLKP  619

Query  238  HGFFN  224
              FFN
Sbjct  620  LNFFN  624



>ref|WP_006520181.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
 gb|EKU99059.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
Length=647

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 118/186 (63%), Gaps = 8/186 (4%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM+VD      +  V E ++ V E  E+N + NAFYA+  LL +E  A R  +P+  R+
Sbjct  447  MDMSVDG----PNNSVYEVDI-VPEEDEHNPYGNAFYAQSTLLSSEQGAQRTIDPMKGRY  501

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G  T YKL+PG N LPLA  +A  +RRA ++  +LWVTPY+ +E +P 
Sbjct  502  WKIVNPAKTNAMGYPTAYKLMPGENTLPLARPDASVIRRATYMTKHLWVTPYSPDEKYPA  561

Query  418  GEFPNQNPRVGE-GLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLM  242
            G +PNQ+P  G+ GL  W + +R +E+TD+V+WY F  +H PR EDWPVMPV  IGFML 
Sbjct  562  GNYPNQHP--GDVGLPEWTQADRSVEDTDVVVWYTFAHSHSPRAEDWPVMPVATIGFMLK  619

Query  241  PHGFFN  224
            P  FF+
Sbjct  620  PLNFFD  625



>ref|WP_039728302.1| MULTISPECIES: tyramine oxidase [Oscillatoriophycideae]
 gb|KIF15990.1| tyramine oxidase [Aphanocapsa montana BDHKU210001]
 gb|KIF40915.1| tyramine oxidase [Lyngbya confervoides BDU141951]
Length=638

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 111/183 (61%), Gaps = 1/183 (1%)
 Frame = -2

Query  772  MAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWI  593
            M +D         V E N +    G  N + NA+Y    LLKTE  A R  +PL  R+W 
Sbjct  440  MRLDFDVDGTDNSVYEVNSEAVPMGPENPYGNAWYGVSTLLKTEQAAQRLIDPLVGRYWK  499

Query  592  IKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGE  413
            + N    NR GQ  G+KL+PG N LP A  +A  ++RA F+  +LWVTPY  +E FP G 
Sbjct  500  VVNPNIHNRLGQPVGFKLIPGENVLPFAHPDAPIVKRAGFITRHLWVTPYHPDENFPAGP  559

Query  412  FPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHG  233
            +PNQ+P  GEGL  W +++R L+ TD+V+WYVFG  H+PR EDWPVMPV   GF L P G
Sbjct  560  YPNQHPG-GEGLLKWTQRDRALDNTDVVVWYVFGHHHIPRPEDWPVMPVAYSGFTLKPLG  618

Query  232  FFN  224
            FF+
Sbjct  619  FFD  621



>ref|WP_035986372.1| tyramine oxidase [Leptolyngbya sp. KIOST-1]
Length=643

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 104/156 (67%), Gaps = 1/156 (1%)
 Frame = -2

Query  691  NVHNNAFYAEERLLKTELEAMRDCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPL  512
            N + NAFYA+  LL TE +A R  +P+ AR+W I N    N  G  T YKL+PG N LPL
Sbjct  471  NPYGNAFYAKSTLLTTEQQAQRLIDPMKARYWKIVNPNETNAAGYPTAYKLMPGENTLPL  530

Query  511  AGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDI  332
            A   A  + RA ++  +LWVTPYA +E FP G++PNQ+P  GEGL  W + +RP++ TD+
Sbjct  531  ARPHASVINRATYMTKHLWVTPYAPDEKFPAGDYPNQSPG-GEGLPKWTEGDRPVDNTDL  589

Query  331  VLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  224
            V+WY F  TH+PR EDWPVMP   IGFML P  +F+
Sbjct  590  VVWYTFAHTHIPRAEDWPVMPTAYIGFMLKPLNYFD  625



>ref|WP_009633550.1| Cu2+-containing amine oxidase [Synechocystis sp. PCC 7509]
Length=645

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 114/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM +D   GE +  V E N + E    +N + NAF A+  LL TEL A R  NP+S R+
Sbjct  449  LDMNLD---GE-NNSVYEVNTEAEPISADNPYGNAFAAKSTLLATELAAQRVINPMSGRY  504

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W + N    N  GQ   YK++PG N LP    E+  ++RA +L  +LWVTPY + E +P 
Sbjct  505  WKVVNPDVHNSLGQPVAYKIMPGENILPFLHPESFVIKRAGYLNKHLWVTPYNKAENYPA  564

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+   G+GL  W K +R +E TD+V+WY FG  H+PR EDWPVMP   IGFML P
Sbjct  565  GAYPNQHAG-GDGLPEWTKADRHIENTDVVVWYTFGHNHIPRPEDWPVMPTSYIGFMLKP  623

Query  238  HGFFNC  221
             GFF+ 
Sbjct  624  VGFFDA  629



>ref|WP_006456034.1| tyramine oxidase [Synechococcus sp. PCC 7335]
 gb|EDX86269.1| Copper amine oxidase, enzyme domain protein [Synechococcus sp. 
PCC 7335]
Length=646

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 113/185 (61%), Gaps = 6/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM VD         V E ++ V E   +N + NAFYA+  LL TE  A R  +P+  R+
Sbjct  451  MDMRVDGD----RNSVYEVDI-VPEEETSNPYGNAFYAKSTLLPTEKAAQRLIDPMKGRY  505

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G  T YKL+PG N LP+A   A   +RAA++  +LWVTP+  +E +P 
Sbjct  506  WKIVNPSKTNAMGYPTAYKLMPGENTLPMARPSASVSKRAAYMSQHLWVTPFHEDEKYPA  565

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQNP  G GL  W + +R +E+TD+V+WY F  +H PR EDWPVMPV  IGFML P
Sbjct  566  GDYPNQNPG-GAGLPHWTQSDRVVEDTDLVVWYTFAHSHSPRAEDWPVMPVATIGFMLKP  624

Query  238  HGFFN  224
              FF+
Sbjct  625  LNFFD  629



>emb|CEG30995.1| Primary amine oxidase precursor [Bacillus simplex]
Length=650

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 109/185 (59%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM VD      +  V E N K  E G +N + N FY    LLK E EA+RD +  +AR 
Sbjct  445  LDMMVDG----MNNSVYEVNTKSMEKGPDNPYGNGFYPVSTLLKNESEAVRDLDLRTARF  500

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    NR G+  GYKL  G NC P A  ++  L+RA FLKH+ WVTP+  +E F  
Sbjct  501  WKIVNPSKKNRLGEPVGYKLFAGENCFPFAHDDSPLLKRAGFLKHHFWVTPFDPDEQFAS  560

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+   GEGL  WVK +R +E  D+V+WY  G  H+ R EDWPVMP   I F+L P
Sbjct  561  GRYPNQHAG-GEGLEDWVKADRSIENEDVVVWYNMGHHHITRPEDWPVMPTAYISFILKP  619

Query  238  HGFFN  224
             GFFN
Sbjct  620  TGFFN  624



>ref|WP_037709969.1| tyramine oxidase [Streptomyces mirabilis]
Length=666

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 116/185 (63%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM+VD   G A+T VVE +     PG  N HNNA+     +L  E  A R  +PL AR+
Sbjct  463  LDMSVD---GPANT-VVEIDSVASPPGPENPHNNAWETRRTVLAHESAAQRQIDPLKARY  518

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I+N + ++  G+  GY L+PG N +P+   EA F  RA F   +LWVT Y   E +  
Sbjct  519  WRIENPQKLSGLGEPVGYTLMPGGNTVPMYPPEALFAPRAGFTASHLWVTAYDPAERYAA  578

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+P  GEGL ++   +RPLE+TD+V+WY FG  HV R EDWPVMPV  IGFML P
Sbjct  579  GDYPNQHPG-GEGLPAYAAADRPLEDTDVVVWYTFGAHHVVRPEDWPVMPVSTIGFMLKP  637

Query  238  HGFFN  224
             GFF+
Sbjct  638  SGFFD  642



>ref|WP_042206338.1| tyramine oxidase [Paenibacillus durus]
 gb|AIQ12487.1| tyramine oxidase [Paenibacillus durus]
Length=648

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 107/185 (58%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM +D         + E N     PG +N + N F      LKTE EA+RD +  S+R+
Sbjct  439  MDMMIDG----VDNSIYEVNTSSMPPGPDNPYENGFIPVSTQLKTETEAIRDMDIRSSRY  494

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G   GYKL PG N  P A   +  ++RA FLKH+LW TPY   E +  
Sbjct  495  WKIVNPAKKNPVGDPVGYKLFPGENAFPFASDNSSLIKRAGFLKHHLWCTPYNPKEKYAS  554

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+   G GL+SWV+Q+R L+ TD+V+WY  G  HV R EDWPVMP   IGF L P
Sbjct  555  GDYPNQHAG-GAGLSSWVQQDRSLDNTDVVVWYTMGHHHVTRPEDWPVMPTAYIGFSLKP  613

Query  238  HGFFN  224
             GFF+
Sbjct  614  VGFFD  618



>ref|WP_012935344.1| tyramine oxidase [Conexibacter woesei]
 gb|ADB52293.1| Primary-amine oxidase [Conexibacter woesei DSM 14684]
Length=643

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 110/185 (59%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+ VD         VVE   +    GE N H NA+    R L +ELEA R   P  AR 
Sbjct  443  LDIDVDGPG----NSVVEVEAEAVPEGEENPHGNAWRTVHRTLSSELEACRRLAPERARG  498

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W++ N    N  G+   YKLVPG N +P A   +  LRRA F++H+LWVT +A  E +P 
Sbjct  499  WLVTNPAVRNAVGEAVAYKLVPGDNTVPFAAPGSALLRRAGFVEHHLWVTRHAAAERYPA  558

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GE+P Q+   GEGL +WV+ +RPL + D+VLWY     HVPR EDWPVMPV RIGF L P
Sbjct  559  GEYPYQH-SGGEGLPAWVQADRPLVDRDVVLWYTMNHHHVPRPEDWPVMPVARIGFELKP  617

Query  238  HGFFN  224
             GFF+
Sbjct  618  WGFFD  622



>ref|WP_034315126.1| tyramine oxidase [Bacillus simplex]
Length=650

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 107/185 (58%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM VD      +  V E N K  E G +N + N FY    LLK E EA+RD +  +AR 
Sbjct  445  LDMMVDG----MNNSVYEVNTKSMEKGPDNPYGNGFYPVSTLLKNESEAVRDLDLRTARF  500

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G+  GYKL  G NC P A  ++  L+RA FLKH+ WVTP+   E F  
Sbjct  501  WKIVNPSKKNILGEPVGYKLFAGENCFPFAHDDSPLLKRAGFLKHHFWVTPFDPEEQFAS  560

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+   GEGL  WVK +R +E  D+V+WY  G  H+ R EDWPVMP   I F+L P
Sbjct  561  GRYPNQHAG-GEGLEDWVKADRSIENEDVVVWYNMGHHHITRPEDWPVMPTAYISFILKP  619

Query  238  HGFFN  224
             GFFN
Sbjct  620  TGFFN  624



>ref|WP_012873420.1| tyramine oxidase [Sphaerobacter thermophilus]
 gb|ACZ40385.1| Primary-amine oxidase [Sphaerobacter thermophilus DSM 20745]
Length=646

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 110/171 (64%), Gaps = 1/171 (1%)
 Frame = -2

Query  733  VVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWIIKNTRTVNRTGQL  554
            V E +   E  G +N H NAF +   LL+ E +  R  +PLSAR+W I N  ++N+ G+ 
Sbjct  454  VYEVHSAPEPLGPDNPHGNAFRSHAVLLEREGDGHRVVDPLSARYWKIVNHNSLNKVGEP  513

Query  553  TGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEGLA  374
              Y+L+P  N LP+A   A  ++RA F+  ++WVTPY   E +  G++PNQ+P  G GL 
Sbjct  514  VAYRLMPHGNVLPMAHPTASVMQRAGFMTKHVWVTPYRPEEKYAAGDYPNQHPG-GAGLP  572

Query  373  SWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  221
            +W  QNRP+ +TD+V+WY  G  HV RLEDWPVMPV+ +GF+L P GFF+ 
Sbjct  573  AWTAQNRPIVDTDVVVWYTLGSHHVVRLEDWPVMPVQYVGFLLQPFGFFDA  623



>ref|WP_016730365.1| tyramine oxidase [Sulfolobus islandicus]
Length=661

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 6/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+ +D +      ++ E N+K E     N   NAFY EE LLKTELEA R  NP + R+
Sbjct  455  LDLDIDGQI----NKIYEVNLKPEPISSENPLGNAFYPEETLLKTELEARRHVNPQTGRY  510

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N+  VN  G+   Y+L+P  N       E+   +R  ++ ++LWVTPY  NE +  
Sbjct  511  WKIVNSTKVNYLGESVAYRLIPRENVACPLPEESFVRKRGGYINYHLWVTPYEPNEKYAT  570

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++P +  R+GEGL  +V+QNR + +TD+VLWY  GV HV R+EDWPVMPVE  GFML P
Sbjct  571  GDYPYE--RIGEGLPKYVEQNRSVVDTDLVLWYTLGVEHVVRVEDWPVMPVEMAGFMLRP  628

Query  238  HGFFN  224
             GFF+
Sbjct  629  DGFFD  633



>ref|WP_014513326.1| tyramine oxidase [Sulfolobus islandicus]
 ref|YP_005647197.1| Amine oxidase (copper-containing) [Sulfolobus islandicus HVE10/4]
 gb|ADX83983.1| Amine oxidase (copper-containing) [Sulfolobus islandicus HVE10/4]
Length=661

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 6/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+ +D +      ++ E N+K E     N   NAFY EE LLKTELEA R  NP + R+
Sbjct  455  LDLDIDGQI----NKIYEVNLKPEPISSENPLGNAFYPEETLLKTELEARRHVNPQTGRY  510

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N+  VN  G+   Y+L+P  N       E+   +R  ++ ++LWVTPY  NE +  
Sbjct  511  WKIVNSTKVNYLGESVAYRLIPRENVACPLPEESFVRKRGGYINYHLWVTPYEPNEKYAT  570

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++P +  R+GEGL  +V+QNR + +TD+VLWY  GV HV R+EDWPVMPVE  GFML P
Sbjct  571  GDYPYE--RIGEGLPKYVEQNRSVVDTDLVLWYTLGVEHVVRVEDWPVMPVEMAGFMLRP  628

Query  238  HGFFN  224
             GFF+
Sbjct  629  DGFFD  633



>ref|WP_027416719.1| tyramine oxidase [Aneurinibacillus terranovensis]
Length=650

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 113/181 (62%), Gaps = 1/181 (1%)
 Frame = -2

Query  766  VDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWIIK  587
            +D +    +  VVE N   E  GE+N +NNAFY E +  KTE EA R  +  S R W I 
Sbjct  446  LDTQLDGTNNSVVEINTVPETRGEHNPYNNAFYIETKTFKTEQEAQRIMDLASQRTWKII  505

Query  586  NTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFP  407
            N  ++N  GQ  GYK++PG NCLP A  ++  ++RA F+K++L VT + R+EM+  G++P
Sbjct  506  NPNSLNAVGQPVGYKIMPGENCLPFAYDDSSLIKRAGFIKNHLHVTKFDRDEMYASGKYP  565

Query  406  NQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  227
            NQ+ + G+GL  + + NR +E  DIV+WY  G  H+ R EDWPVMP   I F L P GFF
Sbjct  566  NQH-KGGDGLTKYAQANRNIENEDIVVWYTMGHHHITRPEDWPVMPTAYINFQLKPVGFF  624

Query  226  N  224
            +
Sbjct  625  D  625



>ref|WP_036725089.1| tyramine oxidase [Paenibacillus forsythiae]
Length=648

 Score =   167 bits (422),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 106/185 (57%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MDM +D      +  + E N     PG +N + N F      LKTE EA+RD +  S+R+
Sbjct  439  MDMMIDG----VNNSIYEVNTSSMPPGPDNPYENGFIPVSTQLKTETEAVRDMDIRSSRY  494

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G    YKL PG N  P A   +  ++RA FLKH+LW TPY   E +  
Sbjct  495  WKIVNPNKKNHVGDPVSYKLFPGENAFPFASDNSSLIKRAGFLKHHLWCTPYNPEEKYAS  554

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+   G GL+SWV+Q+R L+ TD+V+WY  G  HV R EDWPVMP   IGF L P
Sbjct  555  GSYPNQHAG-GAGLSSWVQQDRSLDNTDVVVWYTMGHHHVTRPEDWPVMPTAYIGFSLKP  613

Query  238  HGFFN  224
             GFF+
Sbjct  614  VGFFD  618



>ref|WP_012714637.1| tyramine oxidase [Sulfolobus islandicus]
 ref|YP_002833435.1| tyramine oxidase [Sulfolobus islandicus L.S.2.15]
 ref|YP_003420974.1| Amine oxidase (copper-containing) [Sulfolobus islandicus L.D.8.5]
 gb|ACP36790.1| Amine oxidase (copper-containing) [Sulfolobus islandicus L.S.2.15]
 gb|ADB88604.1| Amine oxidase (copper-containing) [Sulfolobus islandicus L.D.8.5]
Length=661

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
             ++ +D        ++ E N+K E     N   NAFY EE LLKTELEA R  NP + R+
Sbjct  451  FNIRLDLDIDGLINKIYEVNLKPEPISSENPLGNAFYPEETLLKTELEARRHVNPQTGRY  510

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N+  VN  G+   Y+L+P  N       E+   +R  ++ ++LWVTPY  NE +  
Sbjct  511  WKIVNSTKVNYLGESVAYRLIPRENVACPLPEESFVRKRGGYINYHLWVTPYEPNEKYAT  570

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++P +  R+GEGL  +V+QNR + +TD+VLWY  GV HV R+EDWPVMPVE  GFML P
Sbjct  571  GDYPYE--RIGEGLPKYVEQNRSVVDTDLVLWYTLGVEHVVRVEDWPVMPVEMAGFMLRP  628

Query  238  HGFFN  224
             GFF+
Sbjct  629  DGFFD  633



>ref|WP_024084556.1| tyramine oxidase [Sulfolobus acidocaldarius]
 gb|AHC52192.1| tyramine oxidase [Sulfolobus acidocaldarius SUSAZ]
Length=664

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 114/185 (62%), Gaps = 6/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+ +D +      +V E N+K +  G  N   NAFYAEE LLK ELEA R  NP S R+
Sbjct  458  LDLDIDGQI----NRVYEVNLKPDSIGPENPLGNAFYAEETLLKNELEARRHVNPQSGRY  513

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N +  N  G+ T Y+ +P  N       E+   +R  ++ ++LWVTPY  NE +  
Sbjct  514  WKIVNPKKSNYLGEPTAYRFIPRENVACPLPEESFVRKRGGYINYHLWVTPYDPNERYAT  573

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++P +  R+GEGL  +V++NR + + DIVLWY  GV HV R+EDWPVMPVE  GFML P
Sbjct  574  GDYPYE--RIGEGLPKYVEKNRSIVDKDIVLWYTLGVEHVVRVEDWPVMPVEMAGFMLRP  631

Query  238  HGFFN  224
             GFF+
Sbjct  632  DGFFD  636



>ref|WP_011278970.1| tyramine oxidase [Sulfolobus acidocaldarius]
 ref|YP_256761.1| tyramine oxidase [Sulfolobus acidocaldarius DSM 639]
 ref|YP_007435219.1| tyramine oxidase [Sulfolobus acidocaldarius N8]
 ref|YP_007437537.1| tyramine oxidase [Sulfolobus acidocaldarius Ron12/I]
 gb|AAY81468.1| copper amine oxidase [Sulfolobus acidocaldarius DSM 639]
 gb|AGE72071.1| tyramine oxidase [Sulfolobus acidocaldarius N8]
 gb|AGE74389.1| tyramine oxidase [Sulfolobus acidocaldarius Ron12/I]
Length=664

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 113/185 (61%), Gaps = 6/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+ +D +      +V E N+K E  G  N   NAFYAEE LLK ELEA R  NP S R+
Sbjct  458  LDLDIDGQI----NRVYEVNLKPESIGPENPLGNAFYAEETLLKNELEARRHVNPQSGRY  513

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N +  N  G+   Y+ +P  N       E+   +R  ++ ++LWVTPY  NE +  
Sbjct  514  WKIVNLKKSNYLGEPVAYRFIPRENVACPLPDESFVRKRGGYINYHLWVTPYDPNERYAT  573

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++P +  R+GEGL  +V++NR + + DIVLWY  GV HV R+EDWPVMPVE  GFML P
Sbjct  574  GDYPYE--RIGEGLPKYVEKNRSIVDKDIVLWYTLGVEHVVRVEDWPVMPVEMAGFMLRP  631

Query  238  HGFFN  224
             GFF+
Sbjct  632  DGFFD  636



>gb|AHY48354.1| Cu2+-containing amine oxidase [Rubrobacter radiotolerans]
Length=636

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+  +D        ++ E + +   PG++N H NAF+++  LL++E EA    +  SARH
Sbjct  438  MNFRLDLDVDGTENRLYEVHTEAVPPGDDNPHGNAFFSKSTLLESESEAQFTTDSTSARH  497

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W +++T+T N+ G+   Y+L+P +N LP    E+   RRA F K + W TPYA +E    
Sbjct  498  WRVESTQTKNKVGEPCAYRLIPQTNVLPFFTEESAISRRAGFAKKHFWATPYAPDERHAA  557

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+P  G+GL ++ + +R L+  D+V+WY  G  HV R+EDWPVMPV+  GF L P
Sbjct  558  GAYPNQSP--GDGLPNYTRDDRSLDGEDVVVWYTLGAHHVVRVEDWPVMPVQHAGFKLEP  615

Query  238  HGFFN  224
             GFF+
Sbjct  616  AGFFD  620



>ref|WP_041339143.1| tyramine oxidase [Rubrobacter radiotolerans]
Length=634

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            M+  +D        ++ E + +   PG++N H NAF+++  LL++E EA    +  SARH
Sbjct  436  MNFRLDLDVDGTENRLYEVHTEAVPPGDDNPHGNAFFSKSTLLESESEAQFTTDSTSARH  495

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W +++T+T N+ G+   Y+L+P +N LP    E+   RRA F K + W TPYA +E    
Sbjct  496  WRVESTQTKNKVGEPCAYRLIPQTNVLPFFTEESAISRRAGFAKKHFWATPYAPDERHAA  555

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+P  G+GL ++ + +R L+  D+V+WY  G  HV R+EDWPVMPV+  GF L P
Sbjct  556  GAYPNQSP--GDGLPNYTRDDRSLDGEDVVVWYTLGAHHVVRVEDWPVMPVQHAGFKLEP  613

Query  238  HGFFN  224
             GFF+
Sbjct  614  AGFFD  618



>ref|WP_026844103.1| tyramine oxidase [Geodermatophilaceae bacterium URHA0031]
Length=678

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 110/185 (59%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM VD +    H  V E +     PGE+N   NA+  ++ LL  E EA R  NP  AR 
Sbjct  456  LDMQVDGE----HNSVYEVDAAALPPGEDNPWGNAWVTQKTLLGRESEAQRLINPFVART  511

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N  +VN  GQ  GYKL+PG N LPL    ++   RA F   +LWVT Y   E+F  
Sbjct  512  WQIVNPSSVNELGQPAGYKLMPGDNVLPLQQEGSQAWDRAQFAYKHLWVTRYEPGELFAA  571

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+ R G GL  +VK +R LE+TD+V+WY FG  HV R EDWPVMPV   GF L P
Sbjct  572  GDYPNQSQRPG-GLPEYVKADRSLEDTDVVVWYSFGAHHVVRPEDWPVMPVSYAGFHLKP  630

Query  238  HGFFN  224
             GFF+
Sbjct  631  VGFFD  635



>ref|WP_040597665.1| tyramine oxidase [Patulibacter medicamentivorans]
Length=641

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 111/185 (60%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D A+D       + V+E        G +N H NA+    R L++ELEA RD +  +AR 
Sbjct  435  LDFALDG----GRSSVLETETVPAPVGPDNPHGNAWTTVSRPLRSELEARRDIDITTARG  490

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W + N    N  GQ  GY+LV G N +P +   +   RRAAF+ H+LWVT +   E +P 
Sbjct  491  WTVVNPDVRNAVGQPVGYRLVTGENTVPFSAPGSSARRRAAFMDHHLWVTRHDPAERYPA  550

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GE+P Q+P  G+GL  WV+ +RPLE  D+V+WY     HVPR EDWPVMPV R+GFML P
Sbjct  551  GEYPYQHPG-GDGLPRWVQADRPLEREDLVVWYTMNHHHVPRPEDWPVMPVARLGFMLKP  609

Query  238  HGFFN  224
             GFF+
Sbjct  610  WGFFD  614



>gb|EHN12772.1| Monoamine oxidase [Patulibacter medicamentivorans]
Length=632

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 111/185 (60%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D A+D       + V+E        G +N H NA+    R L++ELEA RD +  +AR 
Sbjct  426  LDFALDG----GRSSVLETETVPAPVGPDNPHGNAWTTVSRPLRSELEARRDIDITTARG  481

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W + N    N  GQ  GY+LV G N +P +   +   RRAAF+ H+LWVT +   E +P 
Sbjct  482  WTVVNPDVRNAVGQPVGYRLVTGENTVPFSAPGSSARRRAAFMDHHLWVTRHDPAERYPA  541

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GE+P Q+P  G+GL  WV+ +RPLE  D+V+WY     HVPR EDWPVMPV R+GFML P
Sbjct  542  GEYPYQHPG-GDGLPRWVQADRPLEREDLVVWYTMNHHHVPRPEDWPVMPVARLGFMLKP  600

Query  238  HGFFN  224
             GFF+
Sbjct  601  WGFFD  605



>ref|WP_041858942.1| hypothetical protein, partial [Candidatus Solibacter usitatus]
Length=616

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 110/184 (60%), Gaps = 4/184 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+ VD   G +  +V+E N      G  N +  AF   E  L TE +A R+ +  S+R 
Sbjct  426  LDLDVD---GPSPNRVIEINTVPVPTGPGNPYGGAFQMVETPLSTESDAQRNLDLSSSRK  482

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI+ N    N  G  TGY L+PG N +P A  ++   RRAAFL  ++WVTPY  +EM+ G
Sbjct  483  WIVTNPHERNALGHATGYALLPGENAVPFAQPDSWVRRRAAFLDSHIWVTPYRASEMYAG  542

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+ R G+GL  W   NR +   D+VLWY  G+TH PR EDWPVMPV   GF L+P
Sbjct  543  GDYPNQS-RGGDGLRQWTAANRDIHNHDVVLWYTLGITHNPRPEDWPVMPVHAAGFRLVP  601

Query  238  HGFF  227
             GFF
Sbjct  602  WGFF  605



>gb|ABJ81915.1| Amine oxidase (copper-containing) [Candidatus Solibacter usitatus 
Ellin6076]
Length=634

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 110/184 (60%), Gaps = 4/184 (2%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+ VD   G +  +V+E N      G  N +  AF   E  L TE +A R+ +  S+R 
Sbjct  444  LDLDVD---GPSPNRVIEINTVPVPTGPGNPYGGAFQMVETPLSTESDAQRNLDLSSSRK  500

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            WI+ N    N  G  TGY L+PG N +P A  ++   RRAAFL  ++WVTPY  +EM+ G
Sbjct  501  WIVTNPHERNALGHATGYALLPGENAVPFAQPDSWVRRRAAFLDSHIWVTPYRASEMYAG  560

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+ R G+GL  W   NR +   D+VLWY  G+TH PR EDWPVMPV   GF L+P
Sbjct  561  GDYPNQS-RGGDGLRQWTAANRDIHNHDVVLWYTLGITHNPRPEDWPVMPVHAAGFRLVP  619

Query  238  HGFF  227
             GFF
Sbjct  620  WGFF  623



>ref|WP_029635581.1| hypothetical protein [actinobacterium SCGC AAA041-L13]
Length=629

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 107/184 (58%), Gaps = 5/184 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MD+ +D      +  VVE        GE N +  A+   E +LK+E  A R  +P+ +R 
Sbjct  431  MDLEIDG----VNNSVVEIESFAHPVGEKNPYGGAYETRETVLKSESTAQRLVDPIKSRF  486

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W + N    N  G   GYKL+PG    PLA  E+   +RA F+  +LWVTP+  +E +P 
Sbjct  487  WKVINPNKKNHVGHSIGYKLIPGHTTYPLAHKESVLGKRAGFMYSHLWVTPHVESERYPA  546

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++P Q+   G GL  W K +R +E TD+VLW+VFG  H+PR EDWPVMPVER GF L P
Sbjct  547  GDYPFQH-EGGAGLPEWTKNDRSIENTDVVLWHVFGTNHIPRTEDWPVMPVERTGFHLKP  605

Query  238  HGFF  227
             GFF
Sbjct  606  TGFF  609



>ref|WP_009075996.1| tyramine oxidase [Streptomyces sp. AA4]
 gb|EFL06694.1| tyramine oxidase [Streptomyces sp. AA4]
Length=636

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 115/184 (63%), Gaps = 8/184 (4%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM+VD +    H  V E +  V  PG    H+NAF A+  LL  E EA R  +PL+ R 
Sbjct  446  LDMSVDGE----HNSVYEVDT-VAVPGSE--HHNAFAAQPTLLARESEAQRLVDPLAGRV  498

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W + N    + TG+  GY+L+PG+N LPLA + ++  RRA F   +LWVT Y  ++ +  
Sbjct  499  WTVVNPSVRHHTGRPVGYQLMPGTNILPLAQSGSQTSRRAGFAYRHLWVTAYDPDQRYAS  558

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ P   +GLA +V+ +RPL +TD+V+WY FG  HVPR EDWPVMPV + GF L P
Sbjct  559  GDYPNQRPG-DDGLAEYVRADRPLVDTDVVVWYTFGANHVPRPEDWPVMPVSKAGFHLRP  617

Query  238  HGFF  227
              FF
Sbjct  618  VAFF  621



>ref|WP_026159538.1| hypothetical protein [actinobacterium SCGC AAA023-J06]
Length=637

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 105/184 (57%), Gaps = 5/184 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            MD+ +D      +  VVE        GE N +  A+   E +LK E  A R  +P+ +R 
Sbjct  439  MDLEIDG----VNNSVVEIESFAHPVGEKNPYGGAYETSETVLKNENSAQRLVDPIKSRF  494

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G   GYKL+PG    PLA  ++   +RA F+  +LWVTP   +E +P 
Sbjct  495  WKIINPNKKNHVGHSIGYKLIPGHTTYPLAHRDSVLGKRAGFMYSHLWVTPNVESERYPA  554

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++P Q+   G GL  W K NR LE TDIVLW+VFG  H+PR EDWPVMPVER GF L P
Sbjct  555  GDYPFQH-EGGAGLPEWTKNNRSLENTDIVLWHVFGTNHIPRTEDWPVMPVERTGFHLKP  613

Query  238  HGFF  227
             GFF
Sbjct  614  TGFF  617



>ref|WP_028921142.1| tyramine oxidase [Pseudonocardia acaciae]
Length=656

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 112/185 (61%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVD        +VVE + +   PG +N H NA+     +L +E  A RD +   AR+
Sbjct  457  LDMAVDGPV----NRVVEVDSQPSPPGPDNPHGNAWETVRTVLASEAVAQRDADANRARY  512

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I+N    +  G+ T Y L+PG++   +   +A F  RA F  H LWVT Y  ++ FP 
Sbjct  513  WRIENPSARSALGEATAYSLMPGASAPRMYSPDAVFAPRAGFAAHQLWVTAYDEDQRFPA  572

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQNP  G+GL  +V+ +RPL+ TD+V+WY  G  HV R EDWPVMPV  IGFML P
Sbjct  573  GDYPNQNPG-GDGLPKFVEGDRPLDGTDLVVWYTMGAHHVVRPEDWPVMPVTSIGFMLRP  631

Query  238  HGFFN  224
             GFF+
Sbjct  632  TGFFD  636



>ref|WP_039705665.1| hypothetical protein [marine actinobacterium MedAcidi-G3]
 gb|KIE53375.1| hypothetical protein MB55_02790 [marine actinobacterium MedAcidi-G3]
Length=632

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 112/185 (61%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMA+D         +VE N +    G  N HN AF A E LL++E  AMR+ N  S+R+
Sbjct  437  LDMAIDGNK----NNIVEVNTEPLPAGPANPHNTAFAARETLLESEHSAMRNTNSTSSRY  492

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I+N+   NR G+ T Y+L+P S     A   +   +RA F KHNLWVTP  ++E +  
Sbjct  493  WRIENSGKTNRLGRPTAYRLLPSSTATMFAAENSPHAQRAMFAKHNLWVTPTTQSERYAA  552

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++P Q    GEGL  +   +R L +TD+ +W+ FG+TH  R+ED+PVMP E  GFML+P
Sbjct  553  GDYPTQR-NAGEGLPKFTANDRSLADTDLTVWHTFGLTHDVRVEDYPVMPTEYAGFMLVP  611

Query  238  HGFFN  224
             GFF+
Sbjct  612  DGFFD  616



>ref|WP_003350826.1| tyramine oxidase [Bacillus methanolicus]
 gb|EIJ82043.1| tyramine oxidase [Bacillus methanolicus PB1]
Length=651

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM +D      +  VVE N   EE G NN ++NAFY      KTE EA+R  +  SAR 
Sbjct  446  LDMQLDG----MNNSVVEINTVSEEKGPNNPYSNAFYPVTTTFKTEKEAVRRMDLASART  501

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N  ++N  GQ  GYK++PG NCLP A  ++  ++RA F+K++L VT +   E++  
Sbjct  502  WKIINPNSLNAVGQPVGYKIMPGENCLPFAYDDSSLMKRAGFIKNHLHVTKFDEKELYAS  561

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G +PNQ+ + G+GL  +V+ NR +E  DIV+WY  G  H+ R EDWPVMP   I F L P
Sbjct  562  GAYPNQH-KGGDGLTKYVQANRNIENEDIVVWYTMGHHHITRPEDWPVMPTAYINFQLKP  620

Query  238  HGFFN  224
             GFF+
Sbjct  621  VGFFD  625



>ref|WP_016205391.1| tyramine oxidase [Bacillus nealsonii]
 gb|EOR20880.1| tyramine oxidase [Bacillus nealsonii AAU1]
Length=652

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 103/171 (60%), Gaps = 1/171 (1%)
 Frame = -2

Query  736  QVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWIIKNTRTVNRTGQ  557
             VVE+    EE G  N H+NAFY +    KTE EA R+ +  + R W I N+ ++N  G 
Sbjct  454  SVVESYTVAEEEGPENPHSNAFYVKSTTFKTEQEAQRNLDIATQRTWKIINSNSLNAVGT  513

Query  556  LTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEGL  377
              GYK++PG NCLP A   +  ++RA FLKH L VT Y   E +  G++PNQ+ + GEGL
Sbjct  514  PVGYKIMPGENCLPFASENSSVMKRAGFLKHQLHVTKYDAKEKYATGDYPNQH-KGGEGL  572

Query  376  ASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  224
              ++  NR +E  DIV+WY  G  H+ R EDWPVMP   I F L P GFF+
Sbjct  573  PKYIAANRQIENEDIVVWYTMGHHHITRPEDWPVMPTAYINFQLKPVGFFD  623



>ref|WP_011440032.1| tyramine oxidase [Rhodopseudomonas palustris]
 gb|ABD05843.1| Amine oxidase (copper-containing) [Rhodopseudomonas palustris 
HaA2]
Length=652

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 115/185 (62%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DMAVD   G+A++ +VE N   EE G +N H NAFY  E LL +EL A R  NP S R+
Sbjct  450  LDMAVD---GDANS-IVECNTYAEEEGPHNPHGNAFYEAETLLGSELSAARRANPASHRY  505

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W + N   +N  G   GYKL   +   P  G  +   +RA F+++++WVT +  +E +P 
Sbjct  506  WKVINPNKLNYAGTPVGYKLEAMNCVTPFVGANSPSGKRAGFVQNHVWVTAFDPDERYPA  565

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GE+ N +   G GL  ++KQ+RPLE  DIVLW+VFG+ H  RLED+PV P    GF L+P
Sbjct  566  GEYMNHSDGSG-GLPDFIKQDRPLENADIVLWHVFGLHHPVRLEDFPVQPCISTGFKLVP  624

Query  238  HGFFN  224
            HGFFN
Sbjct  625  HGFFN  629



>ref|WP_020471082.1| hypothetical protein [Zavarzinella formosa]
Length=631

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 109/184 (59%), Gaps = 1/184 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
             +M +D      +  V   +V  E  G++N + NAFYA    LKTE+ A       +AR 
Sbjct  429  FNMRLDFDLDGVNNTVQRVDVVAEPEGKHNEYGNAFYARSEPLKTEVAARDHLKLETART  488

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G+  GYK +PG N  PLA   A + +RA F+ +++WV+PY   E F  
Sbjct  489  WKIVNPNVKNHVGEPAGYKFLPGDNSFPLASPNAWWRKRARFVDYHVWVSPYDETENFAA  548

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+   G+GL  +  Q+RP+E TD+V WY FG TH+PR ED+PVMP   IGF+L P
Sbjct  549  GDYPNQSSG-GDGLLKYTDQDRPIENTDVVFWYTFGHTHIPRPEDYPVMPTAYIGFLLKP  607

Query  238  HGFF  227
            +GFF
Sbjct  608  NGFF  611



>ref|WP_028930454.1| tyramine oxidase [Pseudonocardia asaccharolytica]
Length=644

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 105/185 (57%), Gaps = 1/185 (1%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
             +M +D         + E + + + PG  N   NA+   E LL TEL A R  +   AR 
Sbjct  445  FNMRLDLDVDGVANSIYEIDTETDPPGPQNPLGNAYRTRETLLDTELAAQRRMSLDRARC  504

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I N    N  G+  GY L P  N +PL   EA  +RRA F+ H+LWVTP+A  E    
Sbjct  505  WKIVNPHERNAVGEPPGYALKPRDNVVPLVQPEASVMRRAGFMAHHLWVTPHAERERHAA  564

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            GE+PNQ+ + GEGL  W   +RP+ +TD+V+WY FG  HV RLEDWPVMP +  GF L P
Sbjct  565  GEYPNQH-QGGEGLLRWTAADRPVADTDLVVWYTFGSHHVARLEDWPVMPAQYAGFSLQP  623

Query  238  HGFFN  224
             GFF+
Sbjct  624  TGFFD  628



>ref|WP_005168021.1| Monoamine oxidase [Amycolatopsis azurea]
 gb|EMD21941.1| Monoamine oxidase [Amycolatopsis azurea DSM 43854]
Length=621

 Score =   161 bits (407),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 117/185 (63%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+A+D   GE ++ +VE +V+    GE N + NAF  +E  L+TE EA R  +P  AR 
Sbjct  421  LDVAID---GERNS-LVEVDVERVPVGEQNPYGNAFTWKETPLRTEQEAQRHADPAKARV  476

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W ++++   NR GQ T Y+LVP  +   +A  E+   +RA F   +LW TPY  +E FP 
Sbjct  477  WEVRSSERTNRLGQPTAYQLVPRPSATLMAQPESTVHQRATFATRHLWATPYRADERFPA  536

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G+ PN +P  G GL +W   +R L +TD+VLW+VFG TH+PR EDWPVMPV+  GF L P
Sbjct  537  GDRPNAHPG-GAGLPAWTAADRDLTDTDLVLWHVFGPTHIPRPEDWPVMPVDYSGFSLRP  595

Query  238  HGFFN  224
            +GF +
Sbjct  596  YGFLD  600



>ref|WP_007029111.1| tyramine oxidase [Amycolatopsis decaplanina]
 gb|EME63408.1| tyramine oxidase [Amycolatopsis decaplanina DSM 44594]
Length=621

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D+A+D K       +VE +V+    GE N + NAF  +E  L+TELEA R  +P  AR 
Sbjct  421  LDVAIDGK----RNSLVEVDVERVPMGEQNPYGNAFTWKETPLRTELEARRFADPAKARV  476

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W I++    NR G  T Y+LVP  +   +A  E+   +RA F   +LW TPY  +E FP 
Sbjct  477  WEIRSAERTNRLGTPTAYQLVPRPSATLMAQPESTVHQRATFATRHLWATPYRADERFPA  536

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G+ PN +P  G GL +W   +R L +TD+VLW+VFG TH+PR EDWPVMPV+  GF L P
Sbjct  537  GDRPNAHPG-GAGLPAWTAADRDLTDTDLVLWHVFGPTHIPRPEDWPVMPVDYSGFSLRP  595

Query  238  HGFFN  224
            +GF +
Sbjct  596  YGFLD  600



>ref|WP_033288818.1| tyramine oxidase [Amycolatopsis jejuensis]
Length=623

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D AVD +       V E +      G++N + NAF    + L+TE EA R   P +AR 
Sbjct  427  LDFAVDGQ----RNSVYEVDTVGVPTGDDNPYGNAFTWRAKELRTEKEAQRHAKPATARV  482

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPYA +E FP 
Sbjct  483  WEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESSVHKRATFATNHLWVTPYAPDERFPA  542

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G+ P  +P  G GL++W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GF L P
Sbjct  543  GDRPGAHPG-GAGLSAWTAGDRSISDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFTLRP  601

Query  238  HGFFN  224
            +GFF+
Sbjct  602  YGFFD  606



>ref|WP_028390396.1| tyramine oxidase [Bacillus sp. FJAT-14515]
Length=653

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 103/181 (57%), Gaps = 0/181 (0%)
 Frame = -2

Query  766  VDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWIIK  587
            +D         V E N     P ENN H N FY E    KTELEA R  N  +AR W I 
Sbjct  446  IDTHIDGQKNSVQETNTVATRPDENNPHLNGFYHETTTFKTELEAQRKMNLETARGWKII  505

Query  586  NTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFP  407
            N  + N  GQ   Y+L+PG N  P    E+  ++RA F+K++L VT +  ++++  G++P
Sbjct  506  NPNSKNFIGQPVAYELIPGENASPFLHEESSIMKRAGFIKNHLHVTQFDSDQIYASGKYP  565

Query  406  NQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFF  227
            NQN    + L  +VK NR ++  DIV+WY   V H+ R EDWPVMPV  IGF L PHGFF
Sbjct  566  NQNKGGSDSLEHYVKANRSIDNEDIVVWYNMAVHHIVRPEDWPVMPVHHIGFKLKPHGFF  625

Query  226  N  224
            +
Sbjct  626  D  626



>ref|WP_014740127.1| tyramine oxidase [Modestobacter marinus]
 emb|CCH87532.1| Primary amine oxidase [Modestobacter marinus]
Length=678

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 114/185 (62%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +DM VD   GE ++ V E +     PGE+N + NA+  ++ LL  E EA R  +P +AR 
Sbjct  456  LDMQVD---GEGNS-VYEVDSVPLPPGEDNPYGNAWVTQKTLLARESEAQRLIDPFAART  511

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W + N  +VN  GQ  GYKL+PG N LP+    ++   RA F   +LWVT     E+F  
Sbjct  512  WQVVNPSSVNELGQPVGYKLMPGDNVLPMQQEGSQAYDRAQFAYKHLWVTRNTPGELFAA  571

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G++PNQ+ R G GL  +VK +R LE+TD+V+WY FG  H+ R EDWPVMPV  IGF L P
Sbjct  572  GDYPNQSQRPG-GLPEFVKADRSLEDTDVVVWYSFGAHHIVRPEDWPVMPVSTIGFHLKP  630

Query  238  HGFFN  224
             GFF+
Sbjct  631  VGFFD  635



>ref|WP_037817779.1| tyramine oxidase [Streptomyces sp. NRRL F-3213]
Length=623

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 115/185 (62%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D AVD +    + +V    + V   GE N + NAF  +   L+TE EA R  NP +AR 
Sbjct  427  LDFAVDGQRNSVY-EVDAVGIPV---GEKNPYGNAFTWKATELRTEQEAKRHANPATARV  482

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPYA +E FP 
Sbjct  483  WEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPA  542

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P
Sbjct  543  GDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRP  601

Query  238  HGFFN  224
            +GF +
Sbjct  602  YGFCD  606



>ref|WP_043836428.1| tyramine oxidase [Amycolatopsis orientalis]
Length=623

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 115/185 (62%), Gaps = 5/185 (3%)
 Frame = -2

Query  778  MDMAVDCKXGEAHTQVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARH  599
            +D AVD +    + +V    + V   GE N + NAF  +   L+TE EA R  NP +AR 
Sbjct  427  LDFAVDGQRNSVY-EVDAVGIPV---GEKNPYGNAFTWKATELRTEQEAKRHANPATARV  482

Query  598  WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPG  419
            W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPYA +E FP 
Sbjct  483  WEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPYAPDERFPA  542

Query  418  GEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMP  239
            G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+  GFM+ P
Sbjct  543  GDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVDYSGFMVRP  601

Query  238  HGFFN  224
            +GF +
Sbjct  602  YGFCD  606



>ref|WP_034266611.1| tyramine oxidase [Bacillus sp. Aph1]
Length=649

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 104/171 (61%), Gaps = 1/171 (1%)
 Frame = -2

Query  736  QVVEANVKVEEPGENNVHNNAFYAEERLLKTELEAMRDCNPLSARHWIIKNTRTVNRTGQ  557
             VVE N   E+ GE N ++NAFY + +  K E EA R  +  S R W I N  ++N  G+
Sbjct  456  SVVEINTLPEKKGEGNPYHNAFYIDTKTFKKEQEAQRIMDMASQRTWKIVNPNSLNAVGK  515

Query  556  LTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMFPGGEFPNQNPRVGEGL  377
              GYK++PG NCLP A  EA  ++RA FL  +L+VT Y  NEM+  G +PNQN + G+GL
Sbjct  516  PVGYKIMPGENCLPFASDEASVMKRAGFLNKHLFVTKYDPNEMYATGNYPNQN-QGGDGL  574

Query  376  ASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFMLMPHGFFN  224
              +   NR +E  D+V+WY  G  H+ R EDWPVMP   I F L P GFF+
Sbjct  575  PKYAAGNRDIENEDLVVWYTMGHHHITRPEDWPVMPTAYINFQLKPVGFFD  625



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730