BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003C19

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604890.1|  PREDICTED: subtilisin-like protease                211   8e-60   Nicotiana tomentosiformis
ref|XP_009595649.1|  PREDICTED: subtilisin-like protease                209   3e-59   Nicotiana tomentosiformis
gb|ACT34764.1|  subtilisin-like protease preproenzyme                   209   4e-59   Nicotiana tabacum [American tobacco]
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease                208   8e-59   Nicotiana sylvestris
ref|XP_009800439.1|  PREDICTED: subtilisin-like protease                205   8e-58   Nicotiana sylvestris
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease                204   4e-57   Nicotiana sylvestris
emb|CBI19502.3|  unnamed protein product                                189   2e-56   Vitis vinifera
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease                201   4e-56   Solanum lycopersicum
ref|XP_009610212.1|  PREDICTED: subtilisin-like protease                197   9e-55   Nicotiana tomentosiformis
ref|XP_009799242.1|  PREDICTED: subtilisin-like protease                193   1e-53   Nicotiana sylvestris
gb|EYU25437.1|  hypothetical protein MIMGU_mgv1a002005mg                192   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_010263512.1|  PREDICTED: subtilisin-like protease                189   8e-52   Nelumbo nucifera [Indian lotus]
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease                186   4e-51   Solanum lycopersicum
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like           186   8e-51   Solanum tuberosum [potatoes]
ref|XP_010059917.1|  PREDICTED: subtilisin-like protease                185   1e-50   Eucalyptus grandis [rose gum]
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061    187   3e-50   
ref|XP_010059916.1|  PREDICTED: subtilisin-like protease                184   3e-50   Eucalyptus grandis [rose gum]
gb|KCW62487.1|  hypothetical protein EUGRSUZ_H05125                     184   4e-50   Eucalyptus grandis [rose gum]
ref|XP_010025755.1|  PREDICTED: subtilisin-like protease                183   5e-50   
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like           182   9e-50   Solanum tuberosum [potatoes]
ref|XP_007017195.1|  Subtilisin-like serine endopeptidase family ...    176   1e-47   
ref|XP_006374911.1|  subtilase family protein                           176   3e-47   
ref|XP_006386505.1|  hypothetical protein POPTR_0002s12610g             174   8e-47   
ref|XP_008393790.1|  PREDICTED: subtilisin-like protease                174   9e-47   
ref|XP_011017184.1|  PREDICTED: subtilisin-like protease                174   9e-47   Populus euphratica
gb|ABK95622.1|  unknown                                                 174   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002523602.1|  Cucumisin precursor, putative                      173   2e-46   
ref|XP_011029640.1|  PREDICTED: subtilisin-like protease                173   2e-46   Populus euphratica
ref|XP_006374913.1|  subtilase family protein                           173   3e-46   Populus trichocarpa [western balsam poplar]
gb|KDO84130.1|  hypothetical protein CISIN_1g004809mg                   172   4e-46   Citrus sinensis [apfelsine]
ref|XP_002523603.1|  Cucumisin precursor, putative                      168   4e-46   
ref|XP_006434738.1|  hypothetical protein CICLE_v10000411mg             172   4e-46   
ref|XP_008351993.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    172   5e-46   
ref|XP_002510195.1|  Cucumisin precursor, putative                      171   1e-45   Ricinus communis
ref|XP_011029618.1|  PREDICTED: subtilisin-like protease                169   6e-45   Populus euphratica
emb|CBI18429.3|  unnamed protein product                                167   9e-45   Vitis vinifera
gb|KEH18576.1|  subtilisin-like serine protease                         169   1e-44   Medicago truncatula
ref|XP_007135313.1|  hypothetical protein PHAVU_010G118800g             168   1e-44   Phaseolus vulgaris [French bean]
ref|XP_010059918.1|  PREDICTED: subtilisin-like protease                169   1e-44   Eucalyptus grandis [rose gum]
ref|XP_009359804.1|  PREDICTED: subtilisin-like protease                168   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease                168   1e-44   Sesamum indicum [beniseed]
gb|KDP31945.1|  hypothetical protein JCGZ_12406                         167   2e-44   Jatropha curcas
ref|XP_002277899.1|  PREDICTED: subtilisin-like protease                168   2e-44   Vitis vinifera
emb|CDP17956.1|  unnamed protein product                                167   2e-44   Coffea canephora [robusta coffee]
ref|XP_002267740.1|  PREDICTED: subtilisin-like protease                167   2e-44   Vitis vinifera
gb|KDP41714.1|  hypothetical protein JCGZ_16121                         167   4e-44   Jatropha curcas
emb|CBI21415.3|  unnamed protein product                                167   6e-44   Vitis vinifera
ref|XP_004291093.1|  PREDICTED: subtilisin-like protease                166   6e-44   Fragaria vesca subsp. vesca
ref|XP_004514928.1|  PREDICTED: subtilisin-like protease-like           165   2e-43   
gb|KJB63881.1|  hypothetical protein B456_010G021600                    165   2e-43   Gossypium raimondii
ref|XP_008220244.1|  PREDICTED: subtilisin-like protease                165   2e-43   Prunus mume [ume]
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease                164   4e-43   Nelumbo nucifera [Indian lotus]
ref|XP_007221958.1|  hypothetical protein PRUPE_ppa001770mg             164   6e-43   Prunus persica
ref|XP_004514927.1|  PREDICTED: subtilisin-like protease-like           164   7e-43   Cicer arietinum [garbanzo]
ref|XP_002510196.1|  Cucumisin precursor, putative                      163   1e-42   Ricinus communis
gb|KEH18574.1|  subtilisin-like serine protease                         163   1e-42   Medicago truncatula
gb|KHN15890.1|  Subtilisin-like protease                                163   1e-42   Glycine soja [wild soybean]
ref|XP_008221259.1|  PREDICTED: subtilisin-like protease                163   1e-42   Prunus mume [ume]
ref|XP_002310134.2|  subtilase family protein                           162   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008220243.1|  PREDICTED: subtilisin-like protease                162   2e-42   Prunus mume [ume]
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease                162   3e-42   Populus euphratica
ref|XP_010112177.1|  Subtilisin-like protease                           161   4e-42   Morus notabilis
gb|KCW66392.1|  hypothetical protein EUGRSUZ_F00206                     161   4e-42   Eucalyptus grandis [rose gum]
gb|KEH42928.1|  subtilisin-like serine protease                         160   8e-42   Medicago truncatula
ref|XP_008785918.1|  PREDICTED: subtilisin-like protease                158   9e-42   
gb|KHN15886.1|  Subtilisin-like protease                                160   9e-42   Glycine soja [wild soybean]
gb|KEH18578.1|  subtilisin-like serine protease                         160   1e-41   Medicago truncatula
ref|XP_003626594.1|  Subtilisin-like protease                           159   2e-41   Medicago truncatula
ref|XP_008785865.1|  PREDICTED: subtilisin-like protease                159   3e-41   Phoenix dactylifera
ref|XP_003548151.1|  PREDICTED: subtilisin-like protease-like           159   3e-41   Glycine max [soybeans]
gb|KCW66398.1|  hypothetical protein EUGRSUZ_F00212                     158   4e-41   Eucalyptus grandis [rose gum]
ref|XP_010059919.1|  PREDICTED: subtilisin-like protease                159   4e-41   Eucalyptus grandis [rose gum]
ref|XP_008785921.1|  PREDICTED: subtilisin-like protease                158   8e-41   Phoenix dactylifera
ref|XP_002523606.1|  Cucumisin precursor, putative                      157   1e-40   
ref|XP_008785920.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    157   1e-40   
gb|KJB59847.1|  hypothetical protein B456_009G275900                    157   1e-40   Gossypium raimondii
ref|XP_003595551.1|  Subtilisin-like serine protease                    157   1e-40   Medicago truncatula
ref|XP_007204261.1|  hypothetical protein PRUPE_ppa001828mg             157   2e-40   
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg                155   5e-40   Erythranthe guttata [common monkey flower]
gb|KEH18575.1|  subtilisin-like serine protease                         155   6e-40   Medicago truncatula
ref|XP_011074591.1|  PREDICTED: subtilisin-like protease                155   6e-40   Sesamum indicum [beniseed]
ref|XP_008357385.1|  PREDICTED: subtilisin-like protease                155   7e-40   
ref|XP_008241490.1|  PREDICTED: subtilisin-like protease                155   7e-40   Prunus mume [ume]
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg                154   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_007047285.1|  Subtilisin-like serine endopeptidase family ...    154   2e-39   
ref|XP_004494864.1|  PREDICTED: subtilisin-like protease-like           154   2e-39   
ref|XP_003624105.1|  Xylem serine proteinase                            154   2e-39   Medicago truncatula
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease                153   4e-39   Sesamum indicum [beniseed]
ref|XP_010912031.1|  PREDICTED: subtilisin-like protease                153   4e-39   Elaeis guineensis
ref|XP_011464036.1|  PREDICTED: subtilisin-like protease                150   1e-38   Fragaria vesca subsp. vesca
gb|ABD28577.1|  Proteinase inhibitor I9, subtilisin propeptide          152   2e-38   Medicago truncatula
gb|KDP41713.1|  hypothetical protein JCGZ_16120                         151   2e-38   Jatropha curcas
gb|ACA64705.1|  subtilase                                               149   2e-38   Nicotiana tabacum [American tobacco]
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg                151   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_003529873.2|  PREDICTED: subtilisin-like protease-like           150   3e-38   
gb|KDP41710.1|  hypothetical protein JCGZ_16117                         149   4e-38   Jatropha curcas
gb|KDP41712.1|  hypothetical protein JCGZ_16119                         150   5e-38   Jatropha curcas
ref|XP_003624104.1|  Subtilisin-like protease                           152   5e-38   
ref|XP_009419397.1|  PREDICTED: subtilisin-like protease                149   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010267360.1|  PREDICTED: subtilisin-like protease                149   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010093626.1|  Subtilisin-like protease                           149   1e-37   
emb|CDP01317.1|  unnamed protein product                                147   1e-37   Coffea canephora [robusta coffee]
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease                149   2e-37   Vitis vinifera
emb|CAN60787.1|  hypothetical protein VITISV_034533                     149   2e-37   Vitis vinifera
ref|XP_006434737.1|  hypothetical protein CICLE_v10000364mg             148   2e-37   
ref|XP_003552427.1|  PREDICTED: subtilisin-like protease-like           148   2e-37   Glycine max [soybeans]
gb|KHN40450.1|  Subtilisin-like protease                                148   2e-37   Glycine soja [wild soybean]
ref|XP_009345959.1|  PREDICTED: subtilisin-like protease                148   2e-37   
ref|XP_009621569.1|  PREDICTED: subtilisin-like protease                148   2e-37   
ref|XP_009797476.1|  PREDICTED: subtilisin-like protease                148   2e-37   Nicotiana sylvestris
gb|ACA64703.1|  subtilase                                               148   3e-37   Nicotiana tabacum [American tobacco]
ref|XP_009343175.1|  PREDICTED: subtilisin-like protease                148   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_007047286.1|  Subtilisin-like serine endopeptidase family ...    148   4e-37   
ref|XP_011069660.1|  PREDICTED: subtilisin-like protease                147   5e-37   Sesamum indicum [beniseed]
gb|KDO79191.1|  hypothetical protein CISIN_1g004824mg                   146   8e-37   Citrus sinensis [apfelsine]
emb|CBI19501.3|  unnamed protein product                                148   1e-36   Vitis vinifera
ref|XP_006425911.1|  hypothetical protein CICLE_v10024929mg             147   1e-36   Citrus clementina [clementine]
gb|KDO84129.1|  hypothetical protein CISIN_1g004265mg                   146   1e-36   Citrus sinensis [apfelsine]
ref|XP_009787984.1|  PREDICTED: subtilisin-like protease                146   1e-36   Nicotiana sylvestris
emb|CDP01315.1|  unnamed protein product                                146   2e-36   Coffea canephora [robusta coffee]
gb|ACA64702.1|  subtilase                                               146   2e-36   Nicotiana tabacum [American tobacco]
pdb|3I6S|A  Chain A, Crystal Structure Of The Plant Subtilisin-Li...    145   2e-36   Solanum lycopersicum
ref|XP_004229665.1|  PREDICTED: subtilisin-like protease                145   2e-36   
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg                145   2e-36   Erythranthe guttata [common monkey flower]
gb|KEH23384.1|  subtilisin-like serine protease                         144   2e-36   Medicago truncatula
gb|EYU25438.1|  hypothetical protein MIMGU_mgv1a001996mg                144   4e-36   Erythranthe guttata [common monkey flower]
ref|XP_006466594.1|  PREDICTED: subtilisin-like protease-like           145   5e-36   Citrus sinensis [apfelsine]
ref|NP_001234774.1|  subtilisin-like protease precursor                 145   5e-36   Solanum lycopersicum
ref|XP_006345401.1|  PREDICTED: subtilisin-like protease-like           144   6e-36   Solanum tuberosum [potatoes]
ref|XP_007139760.1|  hypothetical protein PHAVU_008G056700g             144   6e-36   Phaseolus vulgaris [French bean]
ref|XP_006345406.1|  PREDICTED: subtilisin-like protease-like           144   1e-35   Solanum tuberosum [potatoes]
gb|EYU19442.1|  hypothetical protein MIMGU_mgv1a001731mg                143   1e-35   Erythranthe guttata [common monkey flower]
gb|KHN15887.1|  Subtilisin-like protease                                143   1e-35   Glycine soja [wild soybean]
gb|AAY63882.1|  subtilisin-like serine protease                         142   2e-35   Solanum tuberosum [potatoes]
ref|XP_004492811.1|  PREDICTED: subtilisin-like protease-like           143   2e-35   Cicer arietinum [garbanzo]
gb|KJB43733.1|  hypothetical protein B456_007G214100                    143   2e-35   Gossypium raimondii
ref|XP_010320327.1|  PREDICTED: subtilisin-like protease                142   2e-35   Solanum lycopersicum
emb|CAA07059.1|  SBT4B protein                                          143   2e-35   Solanum lycopersicum
emb|CDP01316.1|  unnamed protein product                                142   3e-35   Coffea canephora [robusta coffee]
gb|ABN05870.1|  Proteinase inhibitor I9, subtilisin propeptide          140   3e-35   Medicago truncatula
ref|XP_010687642.1|  PREDICTED: subtilisin-like protease                142   4e-35   
gb|EPS63009.1|  subtilisin-like protease preproenzyme                   141   5e-35   Genlisea aurea
gb|EYU45081.1|  hypothetical protein MIMGU_mgv1a002217mg                141   6e-35   Erythranthe guttata [common monkey flower]
ref|XP_011074394.1|  PREDICTED: subtilisin-like protease                141   7e-35   
ref|XP_011074393.1|  PREDICTED: subtilisin-like protease                141   7e-35   Sesamum indicum [beniseed]
ref|XP_009771925.1|  PREDICTED: subtilisin-like protease                141   8e-35   Nicotiana sylvestris
ref|XP_003548400.1|  PREDICTED: subtilisin-like protease-like           141   1e-34   Glycine max [soybeans]
ref|XP_004229664.2|  PREDICTED: subtilisin-like protease                141   1e-34   Solanum lycopersicum
ref|NP_001234780.1|  subtilisin-like protease                           140   2e-34   Solanum lycopersicum
ref|XP_006345400.1|  PREDICTED: subtilisin-like protease-like           139   4e-34   Solanum tuberosum [potatoes]
ref|XP_006345402.1|  PREDICTED: subtilisin-like protease-like           139   4e-34   Solanum tuberosum [potatoes]
gb|KHN06360.1|  Subtilisin-like protease                                140   4e-34   Glycine soja [wild soybean]
ref|XP_007139763.1|  hypothetical protein PHAVU_008G057000g             139   4e-34   Phaseolus vulgaris [French bean]
ref|XP_011069661.1|  PREDICTED: subtilisin-like protease                139   5e-34   Sesamum indicum [beniseed]
ref|XP_006345405.1|  PREDICTED: subtilisin-like protease-like           139   5e-34   
ref|XP_010112176.1|  Subtilisin-like protease                           135   6e-34   
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...    139   7e-34   
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease                139   7e-34   Vitis vinifera
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg                138   8e-34   Erythranthe guttata [common monkey flower]
ref|XP_009595146.1|  PREDICTED: subtilisin-like protease                139   8e-34   Nicotiana tomentosiformis
gb|AES61117.2|  subtilisin-like serine protease                         138   1e-33   Medicago truncatula
gb|ACL52543.1|  unknown                                                 135   1e-33   Zea mays [maize]
ref|XP_003590866.1|  Subtilisin-like protease                           137   1e-33   
ref|XP_010540359.1|  PREDICTED: subtilisin-like protease                137   2e-33   Tarenaya hassleriana [spider flower]
gb|AFW81832.1|  putative subtilase family protein                       135   2e-33   
gb|KHN04972.1|  Subtilisin-like protease                                135   2e-33   Glycine soja [wild soybean]
ref|XP_002510194.1|  Xylem serine proteinase 1 precursor, putative      137   2e-33   Ricinus communis
ref|XP_007147252.1|  hypothetical protein PHAVU_006G108700g             137   3e-33   Phaseolus vulgaris [French bean]
ref|XP_003566210.2|  PREDICTED: subtilisin-like protease                137   3e-33   
gb|ACA64704.1|  subtilase                                               137   3e-33   Nicotiana tabacum [American tobacco]
emb|CAA07060.1|  SBT4C protein                                          136   4e-33   Solanum lycopersicum
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease                136   4e-33   
emb|CAA07062.1|  SBT4E protein                                          136   5e-33   Solanum lycopersicum
ref|XP_004156411.1|  PREDICTED: subtilisin-like protease-like           135   9e-33   
ref|XP_004143027.1|  PREDICTED: subtilisin-like protease-like           135   1e-32   
gb|EAY98174.1|  hypothetical protein OsI_20091                          133   1e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease                135   1e-32   
ref|XP_007207210.1|  hypothetical protein PRUPE_ppa001938mg             134   2e-32   
gb|KHN06359.1|  Subtilisin-like protease                                127   2e-32   Glycine soja [wild soybean]
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease                134   2e-32   Eucalyptus grandis [rose gum]
ref|XP_009608286.1|  PREDICTED: subtilisin-like protease                134   2e-32   Nicotiana tomentosiformis
emb|CDP17236.1|  unnamed protein product                                134   3e-32   Coffea canephora [robusta coffee]
emb|CDP01318.1|  unnamed protein product                                134   3e-32   Coffea canephora [robusta coffee]
ref|XP_004229661.1|  PREDICTED: subtilisin-like protease                134   3e-32   
ref|XP_008370912.1|  PREDICTED: subtilisin-like protease                133   7e-32   
ref|XP_006339058.1|  PREDICTED: subtilisin-like protease-like           132   9e-32   Solanum tuberosum [potatoes]
ref|XP_006345494.1|  PREDICTED: subtilisin-like protease-like           132   9e-32   
ref|XP_004249505.1|  PREDICTED: subtilisin-like protease                132   1e-31   Solanum lycopersicum
ref|XP_009342993.1|  PREDICTED: subtilisin-like protease                132   1e-31   Pyrus x bretschneideri [bai li]
gb|KHN14785.1|  Subtilisin-like protease                                132   1e-31   Glycine soja [wild soybean]
ref|XP_003638681.1|  Subtilisin-like protease                           125   1e-31   
ref|XP_009337959.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    132   1e-31   
gb|AAO62352.1|  subtilase                                               132   1e-31   Casuarina glauca
ref|XP_009608285.1|  PREDICTED: subtilisin-like protease                132   1e-31   Nicotiana tomentosiformis
gb|AFW81831.1|  putative subtilase family protein                       132   2e-31   
ref|NP_001145972.1|  uncharacterized protein LOC100279499 precursor     132   2e-31   
ref|XP_009769989.1|  PREDICTED: subtilisin-like protease                132   2e-31   Nicotiana sylvestris
ref|XP_003535388.1|  PREDICTED: subtilisin-like protease-like           132   2e-31   Glycine max [soybeans]
gb|KJB58523.1|  hypothetical protein B456_009G213500                    132   2e-31   Gossypium raimondii
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease                131   2e-31   Prunus mume [ume]
ref|XP_008444560.1|  PREDICTED: subtilisin-like protease                131   4e-31   Cucumis melo [Oriental melon]
ref|XP_004249504.1|  PREDICTED: subtilisin-like protease                130   4e-31   Solanum lycopersicum
ref|XP_006655358.1|  PREDICTED: subtilisin-like protease-like           130   6e-31   
gb|EYU45084.1|  hypothetical protein MIMGU_mgv1a001942mg                130   6e-31   Erythranthe guttata [common monkey flower]
ref|XP_009338017.1|  PREDICTED: subtilisin-like protease                130   8e-31   Pyrus x bretschneideri [bai li]
emb|CAA59964.1|  subtilisin-like protease                               130   8e-31   Alnus glutinosa
ref|XP_009343011.1|  PREDICTED: subtilisin-like protease                130   8e-31   Pyrus x bretschneideri [bai li]
gb|KHN43135.1|  Subtilisin-like protease                                128   2e-30   Glycine soja [wild soybean]
ref|XP_009769987.1|  PREDICTED: subtilisin-like protease isoform X1     129   2e-30   Nicotiana sylvestris
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           129   2e-30   Cicer arietinum [garbanzo]
ref|XP_007143987.1|  hypothetical protein PHAVU_007G119500g             129   2e-30   Phaseolus vulgaris [French bean]
ref|XP_008370910.1|  PREDICTED: subtilisin-like protease                128   2e-30   
ref|NP_001055646.1|  Os05g0435800                                       128   3e-30   
dbj|BAJ88882.1|  predicted protein                                      128   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87233.1|  predicted protein                                      128   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006847107.1|  hypothetical protein AMTR_s00017p00219220          128   4e-30   
ref|XP_006345404.1|  PREDICTED: subtilisin-like protease-like           128   4e-30   Solanum tuberosum [potatoes]
ref|XP_003553772.1|  PREDICTED: subtilisin-like protease-like           127   8e-30   Glycine max [soybeans]
ref|XP_008355893.1|  PREDICTED: subtilisin-like protease                127   1e-29   
ref|XP_011468374.1|  PREDICTED: uncharacterized protein LOC101302380    127   2e-29   Fragaria vesca subsp. vesca
ref|XP_002441162.1|  hypothetical protein SORBIDRAFT_09g021490          124   7e-29   
gb|EMT05720.1|  Subtilisin-like protease                                122   8e-29   
gb|EAZ14292.1|  hypothetical protein OsJ_04216                          123   1e-28   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ88973.1|  predicted protein                                      123   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90426.1|  predicted protein                                      123   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg                123   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_007135314.1|  hypothetical protein PHAVU_010G118900g             115   2e-28   Phaseolus vulgaris [French bean]
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                     121   8e-28   Eucalyptus grandis [rose gum]
gb|EEC71868.1|  hypothetical protein OsI_04579                          120   8e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like           120   1e-27   Setaria italica
ref|NP_001044922.1|  Os01g0868900                                       118   1e-26   
ref|XP_008776814.1|  PREDICTED: cucumisin                               110   2e-26   Phoenix dactylifera
ref|XP_010446287.1|  PREDICTED: subtilisin-like protease SDD1           112   2e-26   
gb|EAY76626.1|  hypothetical protein OsI_04578                          115   4e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004972264.1|  PREDICTED: subtilisin-like protease-like           116   7e-26   
gb|KEH18652.1|  subtilase family protein, putative                      111   7e-26   Medicago truncatula
gb|KCW44172.1|  hypothetical protein EUGRSUZ_L024071                    112   1e-25   Eucalyptus grandis [rose gum]
gb|KDO36171.1|  hypothetical protein CISIN_1g030998mg                   107   4e-25   Citrus sinensis [apfelsine]
gb|EEE55729.1|  hypothetical protein OsJ_04215                          112   8e-25   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD82002.1|  putative subtilase                                     112   9e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010068558.1|  PREDICTED: subtilisin-like protease                112   1e-24   Eucalyptus grandis [rose gum]
ref|XP_006847079.1|  hypothetical protein AMTR_s00017p00212440          111   3e-24   
gb|KCW68720.1|  hypothetical protein EUGRSUZ_F02324                     108   3e-24   Eucalyptus grandis [rose gum]
ref|XP_006847081.1|  hypothetical protein AMTR_s00017p00213940          109   3e-24   
ref|XP_010464539.1|  PREDICTED: subtilisin-like protease                109   9e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007224572.1|  hypothetical protein PRUPE_ppa1027224mg            109   2e-23   
ref|XP_010484555.1|  PREDICTED: subtilisin-like protease                108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease                108   2e-23   
ref|XP_010547521.1|  PREDICTED: subtilisin-like protease SDD1           108   3e-23   Tarenaya hassleriana [spider flower]
emb|CDM85158.1|  unnamed protein product                                108   4e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like           108   4e-23   Citrus sinensis [apfelsine]
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                108   4e-23   Vitis vinifera
emb|CBI37888.3|  unnamed protein product                                108   4e-23   Vitis vinifera
ref|XP_010647877.1|  PREDICTED: subtilisin-like protease                107   4e-23   
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg             107   5e-23   Citrus clementina [clementine]
emb|CDO96926.1|  unnamed protein product                                107   7e-23   Coffea canephora [robusta coffee]
gb|AFW84453.1|  putative subtilase family protein                       107   7e-23   
dbj|BAJ89456.1|  predicted protein                                      107   7e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB84344.1|  hypothetical protein B456_N019700                       103   8e-23   Gossypium raimondii
ref|XP_007207718.1|  hypothetical protein PRUPE_ppa1027200mg            103   1e-22   
ref|XP_010927458.1|  PREDICTED: subtilisin-like protease                106   1e-22   
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like           106   1e-22   Citrus sinensis [apfelsine]
gb|KCW63761.1|  hypothetical protein EUGRSUZ_G01423                     106   1e-22   Eucalyptus grandis [rose gum]
ref|XP_006422997.1|  hypothetical protein CICLE_v10027850mg             106   2e-22   Citrus clementina [clementine]
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative        105   2e-22   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                105   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           105   2e-22   Glycine max [soybeans]
gb|KDP41709.1|  hypothetical protein JCGZ_16116                         105   3e-22   Jatropha curcas
ref|XP_009129098.1|  PREDICTED: subtilisin-like protease                105   3e-22   Brassica rapa
ref|XP_006280074.1|  hypothetical protein CARUB_v10025957mg             104   5e-22   
ref|XP_010927456.1|  PREDICTED: subtilisin-like protease                104   5e-22   Elaeis guineensis
ref|XP_006393907.1|  hypothetical protein EUTSA_v10005646mg             104   5e-22   Eutrema salsugineum [saltwater cress]
ref|XP_002518750.1|  Xylem serine proteinase 1 precursor, putative      104   5e-22   Ricinus communis
emb|CAN60788.1|  hypothetical protein VITISV_034534                     104   6e-22   Vitis vinifera
emb|CAN64995.1|  hypothetical protein VITISV_001779                     104   6e-22   Vitis vinifera
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                104   6e-22   Nicotiana tomentosiformis
ref|XP_006487123.1|  PREDICTED: subtilisin-like protease-like           104   7e-22   Citrus sinensis [apfelsine]
ref|XP_008793983.1|  PREDICTED: subtilisin-like protease                104   8e-22   
gb|EMS48839.1|  Subtilisin-like protease                                104   8e-22   Triticum urartu
ref|XP_002865029.1|  subtilase family protein                           103   9e-22   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                104   9e-22   
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g             103   9e-22   
emb|CDY09336.1|  BnaA02g26740D                                          103   1e-21   
ref|XP_002282856.2|  PREDICTED: subtilisin-like protease                103   1e-21   
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease                103   1e-21   
emb|CAN64996.1|  hypothetical protein VITISV_001780                     103   1e-21   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             103   1e-21   
ref|XP_006847088.1|  hypothetical protein AMTR_s00017p00215590          100   2e-21   
gb|KEH30495.1|  subtilisin-like serine protease                         103   2e-21   
ref|XP_007017192.1|  Subtilisin-like serine protease 2, putative        103   2e-21   
emb|CDM85157.1|  unnamed protein product                                102   2e-21   
ref|XP_009362303.1|  PREDICTED: subtilisin-like protease                102   3e-21   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           102   3e-21   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                102   3e-21   
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870          102   3e-21   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                102   3e-21   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                102   3e-21   
gb|KCW63759.1|  hypothetical protein EUGRSUZ_G01419                     102   4e-21   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                102   4e-21   
ref|XP_006847104.1|  hypothetical protein AMTR_s00017p00218650          102   4e-21   
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    102   5e-21   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           102   5e-21   
gb|KCW63767.1|  hypothetical protein EUGRSUZ_G01432                     101   5e-21   
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                102   5e-21   
ref|XP_010906270.1|  PREDICTED: subtilisin-like protease                100   7e-21   
ref|XP_010068466.1|  PREDICTED: subtilisin-like protease                101   7e-21   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           101   7e-21   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                101   7e-21   
gb|KJB08038.1|  hypothetical protein B456_001G060600                    100   1e-20   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           100   1e-20   
gb|KJB47389.1|  hypothetical protein B456_008G024400                    100   1e-20   
ref|XP_011464023.1|  PREDICTED: subtilisin-like protease                100   1e-20   
gb|KCW63764.1|  hypothetical protein EUGRSUZ_G01428                     100   1e-20   
emb|CBI32393.3|  unnamed protein product                              99.8    1e-20   
gb|KCW63975.1|  hypothetical protein EUGRSUZ_G01657                     100   2e-20   
ref|NP_001064523.2|  Os10g0394200                                     96.3    2e-20   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                100   2e-20   
ref|XP_010068463.1|  PREDICTED: subtilisin-like protease                100   2e-20   
ref|XP_007226597.1|  hypothetical protein PRUPE_ppa023578mg           99.8    2e-20   
gb|KDO37430.1|  hypothetical protein CISIN_1g039556mg                 99.0    3e-20   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease              99.8    3e-20   
emb|CBI32394.3|  unnamed protein product                                100   3e-20   
ref|XP_010066012.1|  PREDICTED: subtilisin-like protease              99.8    3e-20   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like         99.8    3e-20   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  99.8    3e-20   
ref|NP_569044.1|  Subtilisin-like serine endopeptidase family pro...  99.4    3e-20   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like         99.8    3e-20   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg           99.8    3e-20   
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease              97.8    3e-20   
ref|XP_002282333.2|  PREDICTED: subtilisin-like protease              99.4    4e-20   
emb|CBI32395.3|  unnamed protein product                              99.4    4e-20   
emb|CAN68827.1|  hypothetical protein VITISV_029978                   99.4    4e-20   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease              99.4    4e-20   
ref|XP_006847102.1|  hypothetical protein AMTR_s00017p00218450        96.3    4e-20   
ref|XP_006374912.1|  hypothetical protein POPTR_0014s02640g           99.4    4e-20   
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like         99.4    4e-20   
ref|XP_011029629.1|  PREDICTED: subtilisin-like protease              99.4    4e-20   
ref|XP_010647741.1|  PREDICTED: subtilisin-like protease              99.0    5e-20   
ref|XP_006422995.1|  hypothetical protein CICLE_v10030049mg           99.0    5e-20   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1   99.0    5e-20   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4   99.0    6e-20   
ref|XP_002282304.3|  PREDICTED: subtilisin-like protease              98.6    6e-20   
gb|EMT16255.1|  Subtilisin-like protease                              98.6    6e-20   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  99.0    6e-20   
gb|KCW63766.1|  hypothetical protein EUGRSUZ_G01430                   98.6    7e-20   
ref|XP_010068464.1|  PREDICTED: subtilisin-like protease              98.2    9e-20   
gb|KJB34438.1|  hypothetical protein B456_006G065800                  97.8    9e-20   
ref|XP_008372210.1|  PREDICTED: subtilisin-like protease              98.2    1e-19   
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g           98.2    1e-19   
ref|XP_010090327.1|  Subtilisin-like protease                         98.2    1e-19   
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease              98.2    1e-19   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g           97.8    1e-19   
ref|XP_006487072.1|  PREDICTED: subtilisin-like protease-like         97.8    1e-19   
ref|XP_009405278.1|  PREDICTED: subtilisin-like protease              97.8    1e-19   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease              97.8    1e-19   
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                 97.8    1e-19   
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease              97.8    1e-19   
gb|KJB34439.1|  hypothetical protein B456_006G065800                  97.1    1e-19   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease              97.4    2e-19   
ref|XP_010526897.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  97.4    2e-19   
gb|KJB34440.1|  hypothetical protein B456_006G065800                  97.4    2e-19   
ref|XP_006847097.1|  hypothetical protein AMTR_s00017p00216950        97.4    2e-19   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease              97.1    2e-19   
gb|AES62637.2|  subtilisin-like serine protease                       97.1    2e-19   
ref|XP_003592386.1|  Subtilisin-like protease                         97.4    2e-19   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g           97.1    2e-19   
ref|XP_004975630.1|  PREDICTED: subtilisin-like protease-like         97.1    3e-19   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease              96.7    3e-19   
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like         95.9    3e-19   
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease              96.7    3e-19   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like         96.7    3e-19   
gb|AHA84190.1|  subtilisin-like protease                              96.7    4e-19   
ref|XP_002321861.2|  subtilase family protein                         96.7    4e-19   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g           96.3    5e-19   
gb|EAY78354.1|  hypothetical protein OsI_33442                        96.3    5e-19   
ref|XP_008669405.1|  PREDICTED: subtilisin-like protease              96.3    5e-19   
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease    96.3    5e-19   
gb|KJB58524.1|  hypothetical protein B456_009G213600                  95.9    5e-19   
gb|ACL52505.1|  unknown                                               94.0    5e-19   
gb|EMS60034.1|  Subtilisin-like protease                              94.7    5e-19   
ref|XP_002446493.1|  hypothetical protein SORBIDRAFT_06g016860        95.9    5e-19   
gb|EMT32146.1|  Subtilisin-like protease                              92.0    6e-19   
gb|EEE50901.1|  hypothetical protein OsJ_31407                        95.9    6e-19   
ref|XP_001755716.1|  predicted protein                                95.9    6e-19   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                  95.9    6e-19   
gb|ACN28035.1|  unknown                                               93.2    6e-19   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              95.9    7e-19   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg              95.9    7e-19   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease              95.5    8e-19   
gb|KHN07895.1|  Subtilisin-like protease                              94.7    8e-19   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease              95.5    9e-19   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease              95.1    9e-19   
ref|XP_010525170.1|  PREDICTED: cucumisin                             90.5    9e-19   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease              95.1    9e-19   
ref|XP_007041871.1|  Subtilisin-like serine protease 2                95.1    1e-18   
gb|KHN12283.1|  Subtilisin-like protease                              93.2    1e-18   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease              94.7    1e-18   
ref|NP_001234288.1|  SBT2 protein precursor                           94.7    1e-18   
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1   94.7    1e-18   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease              94.7    2e-18   
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease              94.4    2e-18   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g           94.4    2e-18   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like         94.4    2e-18   
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like         94.4    2e-18   
gb|KJB34441.1|  hypothetical protein B456_006G065800                  93.2    2e-18   
gb|EYU40429.1|  hypothetical protein MIMGU_mgv1a001733mg              94.0    2e-18   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050        94.0    2e-18   
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  94.0    2e-18   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease              94.0    3e-18   
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease              94.0    3e-18   
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease              94.0    3e-18   
dbj|BAD36156.1|  putative serine protease                             93.6    3e-18   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like         93.6    3e-18   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease              94.0    3e-18   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg          93.6    3e-18   
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg           93.6    4e-18   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease              93.6    4e-18   
gb|KHN15704.1|  Subtilisin-like protease                              93.6    4e-18   
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like         93.2    4e-18   
ref|XP_002447536.1|  hypothetical protein SORBIDRAFT_06g002950        93.2    5e-18   
dbj|BAJ99639.1|  predicted protein                                    93.2    5e-18   
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease              93.2    5e-18   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159           93.2    5e-18   
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...  93.2    5e-18   
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease              92.8    6e-18   
gb|KGN57311.1|  hypothetical protein Csa_3G178520                     92.8    6e-18   
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like         92.8    6e-18   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease              92.8    6e-18   
gb|KHN13888.1|  Subtilisin-like protease                              92.8    6e-18   
gb|EMT30759.1|  Subtilisin-like protease                              92.8    6e-18   
gb|ACJ26761.1|  subtilisin-like protein                               88.6    7e-18   
ref|NP_567972.1|  subtilisin-like serine protease 2                   92.8    7e-18   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease              92.8    7e-18   
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1   92.8    7e-18   
gb|ABK96588.1|  unknown                                               89.0    7e-18   
dbj|BAK06243.1|  predicted protein                                    92.4    7e-18   
ref|XP_002533857.1|  Cucumisin precursor, putative                    92.4    9e-18   
emb|CAN81091.1|  hypothetical protein VITISV_040911                   90.9    9e-18   
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...  92.4    9e-18   
gb|KHN04600.1|  Subtilisin-like protease                              92.4    9e-18   
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190        92.4    9e-18   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease              92.4    9e-18   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like         92.0    1e-17   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...  92.0    1e-17   
emb|CDX99895.1|  BnaC09g28100D                                        92.0    1e-17   
emb|CDX72509.1|  BnaC07g45310D                                        92.0    1e-17   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease              92.0    1e-17   
emb|CDY40653.1|  BnaA03g53100D                                        92.0    1e-17   
ref|XP_003523496.1|  PREDICTED: subtilisin-like protease-like         92.0    1e-17   
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor   91.7    1e-17   
tpg|DAA50071.1|  TPA: putative subtilase family protein               91.7    1e-17   
gb|KDO84128.1|  hypothetical protein CISIN_1g047470mg                 91.7    1e-17   
ref|XP_006473885.1|  PREDICTED: subtilisin-like protease-like         91.7    1e-17   
gb|EAY90937.1|  hypothetical protein OsI_12551                        90.5    1e-17   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease              91.7    1e-17   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g           91.7    2e-17   
gb|KHN10472.1|  Subtilisin-like protease                              91.7    2e-17   
ref|XP_003609994.1|  Subtilisin-like protease                         91.7    2e-17   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg           91.7    2e-17   
ref|XP_006434736.1|  hypothetical protein CICLE_v10003898mg           91.7    2e-17   
gb|AES92191.2|  subtilisin-like serine protease                       91.7    2e-17   
ref|XP_008378050.1|  PREDICTED: subtilisin-like protease              91.3    2e-17   
gb|KDP32268.1|  hypothetical protein JCGZ_14789                       87.0    2e-17   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease              91.7    2e-17   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              91.3    2e-17   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease              91.3    2e-17   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like         91.3    2e-17   
gb|ADE77855.1|  unknown                                               89.0    2e-17   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg           90.9    3e-17   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g           90.9    3e-17   
emb|CDY00497.1|  BnaA10g07760D                                        90.9    3e-17   
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease              90.9    3e-17   
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease              90.9    3e-17   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease              90.9    3e-17   
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease              90.9    3e-17   
gb|EMS51375.1|  Subtilisin-like protease                              90.5    3e-17   
gb|ADE76648.1|  unknown                                               88.6    3e-17   
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like         90.5    3e-17   
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease              90.5    3e-17   
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease              90.5    3e-17   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease              90.5    4e-17   
gb|EYU39036.1|  hypothetical protein MIMGU_mgv1a026993mg              90.5    4e-17   
emb|CDY17670.1|  BnaA06g34890D                                        90.5    4e-17   
ref|XP_007016287.1|  Subtilase family protein, putative               85.9    4e-17   
gb|EPS74284.1|  hypothetical protein M569_00464                       90.5    4e-17   
gb|KHN17728.1|  Subtilisin-like protease                              87.0    4e-17   
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like         90.1    4e-17   
ref|XP_002272598.1|  PREDICTED: xylem serine proteinase 1             90.5    4e-17   
emb|CDX77828.1|  BnaC07g20820D                                        90.1    5e-17   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease              90.1    5e-17   
gb|KGN66306.1|  hypothetical protein Csa_1G597040                     89.7    5e-17   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g           90.1    5e-17   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like         90.1    5e-17   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease              90.1    6e-17   
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810        89.7    6e-17   
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative    89.7    6e-17   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease              89.7    7e-17   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease              89.7    7e-17   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease              89.7    7e-17   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease              89.7    7e-17   



>ref|XP_009604890.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=755

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+CA+ FT    +TI R+SSY CSNPSLDLNYPSFI FF  N++
Sbjct  594  LDPGLIYDATPQDYVNLLCALNFTSKQIKTITRSSSYTCSNPSLDLNYPSFIGFFNGNSS  653

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+QEF RT+TN+GDG+S Y+AKLT +G   V +VP+KLVF +K +K SYKLRIE 
Sbjct  654  ESDPRRIQEFQRTVTNIGDGMSVYTAKLTTMGKFKVNLVPEKLVFKEKYEKLSYKLRIEG  713

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M D +V+GSL+WVE  GK+VVRSPIVA
Sbjct  714  PLVMDDIVVYGSLSWVETEGKYVVRSPIVA  743



>ref|XP_009595649.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=763

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D++SQDYINL+CA+ FT    + I R+S+Y+CSNPSLDLNYPSFI +F  N++
Sbjct  606  LDPGLIYDITSQDYINLLCALNFTSQQIKAITRSSAYSCSNPSLDLNYPSFIGYFNYNSS  665

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+QEF RT+TN+GDG+S Y+AKLT +    V+V PDKLVF +K +KQSYKLRIE 
Sbjct  666  KSDPKRIQEFQRTVTNVGDGMSVYTAKLTSMDEYKVSVAPDKLVFKEKYEKQSYKLRIEG  725

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  726  PLLVDNYLVYGSLSWVETSGKYVVKSPIVA  755



>gb|ACT34764.1| subtilisin-like protease preproenzyme [Nicotiana tabacum]
Length=763

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D++SQDYINL+CA+ FT    + I R+S+Y+CSNPSLDLNYPSFI +F  N++
Sbjct  606  LDPGLIYDITSQDYINLLCALDFTSQQIKAITRSSAYSCSNPSLDLNYPSFIGYFNYNSS  665

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+QEF RT+TN+GDG+S Y+AKLT +    V+V PDKLVF +K +KQSYKLRIE 
Sbjct  666  KSDPKRIQEFQRTVTNVGDGMSVYTAKLTSMDEYKVSVAPDKLVFKEKYEKQSYKLRIEG  725

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  726  PLLVDNYLVYGSLSWVETSGKYVVKSPIVA  755



>ref|XP_009771086.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=772

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+CA+ FT    +TI R+SSY CSNPSLDLNYPSFI FF  N+ 
Sbjct  611  LDPGLIYDATPQDYVNLLCALNFTSKQIKTITRSSSYTCSNPSLDLNYPSFIGFFNGNSR  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+QEF RT+TNL DG S Y+A LTP+G   V+VVP+KLVF +K +K SYKLRIE 
Sbjct  671  ESDPKRIQEFKRTVTNLQDGTSVYTANLTPMGKFKVSVVPEKLVFKEKYEKLSYKLRIEG  730

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M D +V+GSL+WVE  GK+VVRSPIVA
Sbjct  731  PIVMDDNVVYGSLSWVETGGKYVVRSPIVA  760



>ref|XP_009800439.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D++SQDY NL+CA+ FT    ++I R+S+Y+CSNPSLDLNYPSFI +F  N++
Sbjct  607  LDPGLIYDITSQDYNNLLCALNFTSQQIKSITRSSAYSCSNPSLDLNYPSFIGYFNYNSS  666

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+QEF RT+TN+G+G+S Y+AKLT +    V+V PDKLVF +K +KQSYKLRIE 
Sbjct  667  KSDPKRIQEFQRTVTNVGEGMSVYTAKLTSMDEYKVSVAPDKLVFKEKYEKQSYKLRIEG  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  727  PLLVDNYLVYGSLSWVETSGKYVVKSPIVA  756



>ref|XP_009790288.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D++SQDY NL+CA+ FT    ++I R+S+Y+CSNPSLDLNYPSFI +F  N++
Sbjct  607  LEPGLIYDITSQDYNNLLCALDFTSQQIKSITRSSAYSCSNPSLDLNYPSFIGYFNYNSS  666

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+QEF RT+TN+G+G+S Y+AKLT +    V+V PDKLVF +K +KQSYKLRIE 
Sbjct  667  KSDPKRIQEFQRTVTNVGEGMSVYTAKLTSMDEYKVSVAPDKLVFKEKYEKQSYKLRIEG  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  727  PLLVDNYLVYGSLSWVETSGKYVVKSPIVA  756



>emb|CBI19502.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPG I DV+ +D+INL+CA+ ++    Q I R+SSY CS+PSLDLNYPSFIA F AN +
Sbjct  31   LDPGFIYDVNLEDHINLLCALNYSTKQIQIITRSSSYTCSDPSLDLNYPSFIASFDANDS  90

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   VQEF RT+TN+G+ +STY+AKLT +    V+VVPDKLVF  K  K SYKLRIE 
Sbjct  91   RSDSKTVQEFRRTVTNVGEAMSTYNAKLTGMDGFQVSVVPDKLVFKDKYQKLSYKLRIEG  150

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            PS M + + FGSL+WV+   KHVVRSPIVA
Sbjct  151  PSLMKETVAFGSLSWVDVEAKHVVRSPIVA  180



>ref|XP_010320328.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=751

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+N +C + FT    QTI R+S+Y CSNPSLDLNYPSFI +F  N++
Sbjct  590  LDPGLIYDATPQDYVNHLCGLNFTSKQIQTITRSSTYTCSNPSLDLNYPSFIGYFNRNSS  649

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+QEF RT+TNL DG S Y+AKLTP+G   V+VVP+KL F +K +KQSYKLRIE 
Sbjct  650  DSDPKRIQEFKRTVTNLQDGTSVYTAKLTPMGKFKVSVVPNKLTFKEKYEKQSYKLRIEG  709

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M D +V GSL+W+E  GK++V+SPIVA
Sbjct  710  PIIMDDIVVDGSLSWMETRGKYIVKSPIVA  739



>ref|XP_009610212.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=756

 Score =   197 bits (500),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D + QDYINL+CA+  T    +TI R SSY C NPSLDLNYPSFIA+F  N++
Sbjct  603  IDPGLIYDTTRQDYINLLCALNLTSEQIKTITR-SSYTCPNPSLDLNYPSFIAYFNVNSS  661

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              DP R+QEF RT+TN+G+G+S Y+AKLT +  + V+VVP+KLVF  K +KQSYKLR+E 
Sbjct  662  ELDPTRIQEFKRTVTNVGEGVSEYTAKLTAMPGLKVSVVPEKLVFKDKYEKQSYKLRVEC  721

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
               M DFLV GSL+WVE  GK VVRSPIVA
Sbjct  722  SKLMNDFLVHGSLSWVEKGGKRVVRSPIVA  751



>ref|XP_009799242.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=757

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D + QDYINL+CA+  T    +TI R SSY C NPSLDLNYPSFIA+F  N++
Sbjct  604  IDPGLIYDTTPQDYINLLCALNLTSKQIKTITR-SSYTCPNPSLDLNYPSFIAYFNVNSS  662

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              DP R+QEF RT+TN+G+ +S Y+A+LT +  + V++VP+KLVF  K +KQSYKLRIE 
Sbjct  663  ELDPTRIQEFKRTVTNVGERVSEYTAELTAMPGLKVSIVPEKLVFKDKYEKQSYKLRIEC  722

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M DFLV GSL W+E  GK+VVRSPIVA
Sbjct  723  PKLMNDFLVHGSLRWMEKGGKYVVRSPIVA  752



>gb|EYU25437.1| hypothetical protein MIMGU_mgv1a002005mg [Erythranthe guttata]
Length=728

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D +S+DYINLICA+ FT N  +TI R+++YNCSNPSLDLNYPSFIAFF  N T
Sbjct  574  LDPGLVYDATSEDYINLICALNFTENQIKTITRSTAYNCSNPSLDLNYPSFIAFFNPNGT  633

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V+EF RT+TN+G G S YS++LT    + V+V PD+L F+ K +K+SYKLRIE+
Sbjct  634  SSEKLAVREFRRTVTNVGVGKSVYSSELTTFDGLKVSVSPDRLEFSDKYEKKSYKLRIES  693

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             + M D LV+GSLTW+E++GK+ VRSPIVA
Sbjct  694  QTLMKDSLVYGSLTWIESSGKYQVRSPIVA  723



>ref|XP_010263512.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=767

 Score =   189 bits (479),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D S+ DY++L+CA+ +T N  + I R+S +NCSNPSLDLNYPSFIAFF A  +
Sbjct  610  LDPGLIYDASTDDYVSLLCALNYTMNEIKMITRSSDFNCSNPSLDLNYPSFIAFFNAQDS  669

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   VQEF RT+TN+G+G+STY+A LTP+    V VVPD LVF +K +K SYKL IE 
Sbjct  670  GSDAKVVQEFQRTVTNVGEGMSTYTAYLTPMDGFQVAVVPDTLVFREKYEKLSYKLSIEG  729

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            P+ M + +V GS++W ++ GKHVVRSPIV
Sbjct  730  PTRMKEKVVHGSISWTDSGGKHVVRSPIV  758



>ref|XP_004252763.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + +DY+NL+C + FT    ++I R+SSY+CS PSLDLNYPSFI +F  N++
Sbjct  618  LDPGLIYDATPEDYVNLLCGLDFTSKQIKSITRSSSYSCSKPSLDLNYPSFIGYFNFNSS  677

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+Q F+RT+TNLGDG STY+AKLTP+G   V+V PDKLVF +K +KQSYKLRIE 
Sbjct  678  KSDPKRIQVFNRTVTNLGDGQSTYTAKLTPMGEYTVSVTPDKLVFKEKYEKQSYKLRIEG  737

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  738  PLLVDNYLVYGSLSWVETSGKYVVKSPIVA  767



>ref|XP_006342632.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + +DY+NL+C + FT    ++I R+SSY+CS PSLDLNYPSFI +F  N++
Sbjct  592  LDPGLIYDATPEDYVNLLCGLDFTSKQIKSITRSSSYSCSKPSLDLNYPSFIGYFNFNSS  651

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SDP R+QEF+RT+TNLGDG  TY+AKLTP+G   V+V PDKLVF +K +KQSYKLRIE 
Sbjct  652  KSDPKRIQEFNRTVTNLGDGQLTYTAKLTPMGKYTVSVAPDKLVFKEKYEKQSYKLRIEG  711

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + ++LV+GSL+WV+ +GK+VV+SPIVA
Sbjct  712  PLLVDNYLVYGSLSWVDTSGKYVVKSPIVA  741



>ref|XP_010059917.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66393.1| hypothetical protein EUGRSUZ_F00207 [Eucalyptus grandis]
Length=768

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 115/150 (77%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+ QDY+NL+CA+ +T    Q + R+SSYNCSNPSLDLNYPSFIAFF +N+ 
Sbjct  609  LDPGLIYDVTPQDYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFSSNS-  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   VQ+F+RT+TN+G G STY+A++ P+    V+VVPDKL F +K +K SYKL IE 
Sbjct  668  -SDSLTVQDFYRTVTNVGAGASTYTAEVNPMEEFKVSVVPDKLTFKEKYEKLSYKLTIEG  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M   +V GSL+W+++ GK+VV+SPIVA
Sbjct  727  PKQMKQTVVSGSLSWMDDGGKYVVKSPIVA  756



>ref|XP_002282841.2| PREDICTED: uncharacterized protein LOC100259061 [Vitis vinifera]
Length=1529

 Score =   187 bits (475),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -1

Query  661   LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
             LDPG I DV+ +D+INL+CA+ ++    Q I R+SSY CS+PSLDLNYPSFIA F AN +
Sbjct  1372  LDPGFIYDVNLEDHINLLCALNYSTKQIQIITRSSSYTCSDPSLDLNYPSFIASFDANDS  1431

Query  481   LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              SD   VQEF RT+TN+G+ +STY+AKLT +    V+VVPDKLVF  K  K SYKLRIE 
Sbjct  1432  RSDSKTVQEFRRTVTNVGEAMSTYNAKLTGMDGFQVSVVPDKLVFKDKYQKLSYKLRIEG  1491

Query  301   PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             PS M + + FGSL+WV+   KHVVRSPIVA
Sbjct  1492  PSLMKETVAFGSLSWVDVEAKHVVRSPIVA  1521


 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 95/149 (64%), Gaps = 1/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D + QDY+NL+C++ FT     TI R+++Y C   S DLNYPSFIA +  N  
Sbjct  614  LDPGLVYDATPQDYVNLLCSMNFTKKQILTITRSNTYTCPKTSPDLNYPSFIALYSQNDN  673

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    VQ+F RT+TN+GDG +TY A +       VTV P  LVF KK +KQSY + I+ 
Sbjct  674  KST-TVVQKFQRTVTNVGDGTATYHATVIAPRGSKVTVSPTTLVFEKKYEKQSYTMSIKY  732

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     + FG LTW+E+ G+H VRSPIV
Sbjct  733  KSDKDGKISFGWLTWIEDDGEHTVRSPIV  761



>ref|XP_010059916.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=768

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+ QDY+NL+CA+ +T    Q + R+SSYNCSNPSLDLNYPSFIAFF +N+ 
Sbjct  609  LDPGLIYDVTPQDYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFGSNS-  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   VQEF+RT+TN+G G STY A++ P+    V++VPDKL F +K +K SYKL IE 
Sbjct  668  -SDSPMVQEFYRTVTNVGAGASTYRAEVNPMEGFKVSIVPDKLTFKEKYEKLSYKLTIEG  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M   +V GSL+W+++ GK+ V+SPIVA
Sbjct  727  PKQMKQTVVSGSLSWMDDGGKYAVKSPIVA  756



>gb|KCW62487.1| hypothetical protein EUGRSUZ_H05125 [Eucalyptus grandis]
Length=768

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV  QDY+NL+CA+ +T    Q + R+SSYNCSNPSLDLNYPSFIAFF +N+ 
Sbjct  609  LDPGLIYDVMPQDYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFSSNS-  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   VQEF+RT+TN+G G STY+A++ P+    V+VVPDKL F  K +K SYKL IE 
Sbjct  668  -SDSPTVQEFYRTVTNVGAGGSTYTAEVNPMEGFKVSVVPDKLTFKVKYEKLSYKLTIEG  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M   +V GSL+W+++ GK+VV+SPIVA
Sbjct  727  PKQMKQTVVSGSLSWMDDGGKYVVKSPIVA  756



>ref|XP_010025755.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=759

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV  QDY+NL+CA+ +T    Q + R+SSYNCSNPSLDLNYPSFIAFF +N+ 
Sbjct  600  LDPGLIYDVMPQDYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFSSNS-  658

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   VQEF+RT+TN+G G STY+A++ P+    V+VVPDKL F  K +K SYKL IE 
Sbjct  659  -SDSPTVQEFYRTVTNVGAGGSTYTAEVNPMEGFKVSVVPDKLTFKVKYEKLSYKLTIEG  717

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M   +V GSL+W+++ GK+VV+SPIVA
Sbjct  718  PKQMKQTVVSGSLSWMDDGGKYVVKSPIVA  747



>ref|XP_006342631.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=755

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+ +DYINL+C + FT    + I R+SSY+CSNPSLDLNYPSFI +F  N++
Sbjct  598  LDPGLIYDVTPEDYINLLCGLDFTSQQIKAITRSSSYSCSNPSLDLNYPSFIGYFNRNSS  657

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD  R QEF RT+TNLGDG+STY+AKLTP+    V+V P KLVF +K +KQ+YKLRIE 
Sbjct  658  KSDTKRTQEFQRTVTNLGDGMSTYTAKLTPMDEYKVSVAPHKLVFKEKYEKQNYKLRIEG  717

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + ++LV+GSL+WVE +GK+VV+SPIVA
Sbjct  718  PLLLDNYLVYGSLSWVETSGKYVVKSPIVA  747



>ref|XP_007017195.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14420.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=760

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + +DY+NL+C + FT    +TI + SS NCSNP+LDLNYPSFIAFF     
Sbjct  605  LDPGLIYDATVEDYVNLLCGLNFTAEQIKTITK-SSNNCSNPALDLNYPSFIAFFNDRDA  663

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              +   V+EF RT+TN+G+G STY A +TPI  V VTV PD+LVF +K+DK+++KL +EA
Sbjct  664  KRNSKTVKEFQRTVTNVGEGSSTYKATVTPINGVKVTVEPDQLVFKEKNDKKNFKLSVEA  723

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            PS + + + FG LTW +  GKHVVRSPIVA
Sbjct  724  PSQLDEAVSFGYLTWEDIGGKHVVRSPIVA  753



>ref|XP_006374911.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52708.1| subtilase family protein [Populus trichocarpa]
Length=778

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +S DY+ L+CA  FT    Q I R+SS +CSNPS DLNYPSFIA+F    +
Sbjct  614  LDPGLIYDANSTDYVRLLCATNFTEKEIQVITRSSSTDCSNPSSDLNYPSFIAYFNERFS  673

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V+EFHRT+TN+G+GISTY+  +TP+  + V V+PDKL F  K +K SYKL IE 
Sbjct  674  PSNLTTVREFHRTVTNVGEGISTYTVSVTPMSGLKVNVMPDKLEFKTKYEKLSYKLTIEG  733

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P+ + + + FG L+W +  GKHVVRSPIVA
Sbjct  734  PALLDEAVTFGYLSWADAGGKHVVRSPIVA  763



>ref|XP_006386505.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
 gb|ERP64302.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
Length=739

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+S DY+ L+CA+KFT    Q I R+SS NCSNPS DLNYPSFIA+F A  +
Sbjct  582  LDPGLIYDVNSNDYVRLLCALKFTEKQIQAITRSSSTNCSNPSTDLNYPSFIAYFNAKDS  641

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V+EF RT+TN+G  +STY+  +TP+  + V+V+PDKL F  K +K SYKL IE 
Sbjct  642  PSNLTTVREFQRTVTNVGAEMSTYTVNVTPMIGLKVSVIPDKLEFRAKYEKLSYKLIIEG  701

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P+ + + + FG L+WV+  GKH+VRSPIV+
Sbjct  702  PALLDETVTFGYLSWVDVGGKHIVRSPIVS  731



>ref|XP_008393790.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=766

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D   +DY+NL+CA+ +T    QTI + +S NCS PSLDLNYPSFIAFF +N  
Sbjct  612  LDPGLIYDAKIEDYVNLLCALNYTNKQIQTITKYASNNCSTPSLDLNYPSFIAFFNSNKK  671

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD     EF RT+TNLG G STY A LTP+    V VVP+KL FT+  +K S+ + I+ 
Sbjct  672  HSDVQTTHEFRRTVTNLGKGPSTYVASLTPLKGFVVGVVPEKLEFTEVGEKLSFVMSIKG  731

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M + +VFGSL+WVE+ G+HVVRSP+VA
Sbjct  732  PRVMKETVVFGSLSWVESGGEHVVRSPVVA  761



>ref|XP_011017184.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=772

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+S DY+ L+CA+KFT    Q I R+SS NCSNPS DLNYPSFIA+F A  +
Sbjct  615  LDPGLIYDVNSNDYVRLLCALKFTEKQIQAITRSSSTNCSNPSTDLNYPSFIAYFNAKDS  674

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V+EFHRT+TN+G  +STY+  +TP+  + V+V+PDKL F  K +K SYKL IE 
Sbjct  675  PSNLTTVREFHRTVTNVGAEMSTYTVNMTPMIGLKVSVIPDKLEFKAKYEKLSYKLIIEG  734

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P+ + + + FG L WV+  GKH+V SPIV+
Sbjct  735  PALLDETVTFGYLRWVDVGGKHIVSSPIVS  764



>gb|ABK95622.1| unknown [Populus trichocarpa]
Length=778

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +S DY+ L+CA  FT    Q I R+SS +CSNPS DLNYPSFIA+F    +
Sbjct  614  LDPGLIYDANSTDYVRLLCATNFTEKEIQVITRSSSTDCSNPSSDLNYPSFIAYFNERFS  673

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V EFHRT+TN+G+GISTY+  +TP+  + V V+PDKL F  K +K SYKL IE 
Sbjct  674  PSNLTTVCEFHRTVTNVGEGISTYTVSVTPMSGLKVNVMPDKLEFKTKYEKLSYKLTIEG  733

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P+ + + + FG L+W +  GKHVVRSPIVA
Sbjct  734  PALLDEAVTFGYLSWADAGGKHVVRSPIVA  763



>ref|XP_002523602.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38797.1| Cucumisin precursor, putative [Ricinus communis]
Length=665

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +++DY+ L+CA+ +T    Q II  S+YNC+N SLDLNYPSFIA+F    +
Sbjct  508  LDPGLIYDAAAEDYVKLLCAMNYTEKQIQ-IITNSTYNCANQSLDLNYPSFIAYFLGGDS  566

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V EF RT+TN+G+ +S+Y+AKLTP+  +NVTV P KLVF K+ +K SYKL +E 
Sbjct  567  DSE-KIVHEFQRTVTNVGEAVSSYTAKLTPMNGINVTVEPKKLVFNKQYEKLSYKLTLEG  625

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P +M + +V GSL+WV + GK+VVRSPIVA
Sbjct  626  PKSMKEDVVHGSLSWVHDEGKYVVRSPIVA  655



>ref|XP_011029640.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +S DY+ L+CA  FT    Q I R+SS +CSNPS DLNYPSFIA+F    +
Sbjct  614  LDPGLIYDANSTDYVRLLCATNFTEKQIQVITRSSSTDCSNPSTDLNYPSFIAYFNERFS  673

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V+EFHRT+TN+G+GISTY+  +TP+  + V V+PDKL F  K +K SYKL I  
Sbjct  674  PSNLTSVREFHRTVTNVGEGISTYTVSVTPMSGLKVNVMPDKLEFKTKYEKLSYKLTIVG  733

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P+ + + + FG L+W +  GKHVVRSPIVA
Sbjct  734  PALLDEAVTFGYLSWADAGGKHVVRSPIVA  763



>ref|XP_006374913.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52710.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 105/150 (70%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+S DY+ L+CA  FT    Q I R+SS +CSNPS DLNYPSFIA+F    +
Sbjct  615  LDPGLIYDVNSTDYVRLLCATNFTEKQIQVITRSSSIDCSNPSSDLNYPSFIAYFNDKKS  674

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V+EFHRT+TN+G+G   Y+A +TP+  + + V+PDKL F  K +K SYKL IE 
Sbjct  675  PSNLTIVREFHRTVTNVGEGTCIYTASVTPMSGLKINVIPDKLEFKTKYEKLSYKLTIEG  734

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P+ + + + FGSL W +  GKHVVRSPI A
Sbjct  735  PALLDETVTFGSLNWADAGGKHVVRSPIAA  764



>gb|KDO84130.1| hypothetical protein CISIN_1g004809mg [Citrus sinensis]
Length=729

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 108/151 (72%), Gaps = 6/151 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +++DY++L+CA+  T    QTI R+ S NCS  SLDLNYPSFIAFF AN +
Sbjct  573  LDPGLIYDATTEDYVSLLCALNLTMKRIQTITRSYSVNCSTSSLDLNYPSFIAFFNANES  632

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    VQEF RT+TN+G+G+STY+A +TP+   N +V PDKL F  K  KQSYKLRIE 
Sbjct  633  KS----VQEFQRTVTNVGEGVSTYTASVTPLKGFNFSVDPDKLTFKGKYAKQSYKLRIEG  688

Query  301  PSTMGD--FLVFGSLTWVENAGKHVVRSPIV  215
            P+ M +   + F  L+W+E  GKHVV+SPIV
Sbjct  689  PNQMDEETVVAFCYLSWIETGGKHVVKSPIV  719



>ref|XP_002523603.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38798.1| Cucumisin precursor, putative [Ricinus communis]
Length=373

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D S +DYI L+CA+ +T    + I + S+++C N SLDLNYPSFIA+F  N +
Sbjct  217  LDPGLIYDASVEDYIELLCAMNYTEKQIRNITK-STHSCLNKSLDLNYPSFIAYFIGNDS  275

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    V EF RT+TN+G+ IS+Y+AKLTP+  + V+VVP KLVF KK +K SYKL +E 
Sbjct  276  DSG-KTVHEFQRTVTNVGEAISSYTAKLTPMKGIKVSVVPKKLVFRKKYEKLSYKLTLEG  334

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P +M + +V GSL+WV + GK+VVRSPIVA
Sbjct  335  PKSMKEDVVHGSLSWVHDEGKYVVRSPIVA  364



>ref|XP_006434738.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
 gb|ESR47978.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
Length=729

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 6/151 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +++DY++L+CA+  T    QTI R+ S NCS  +LDLNYPSFIAFF AN +
Sbjct  573  LDPGLIYDATTEDYVSLLCALNLTMKRIQTITRSYSVNCSTSALDLNYPSFIAFFNANES  632

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S     QEF RT+TN+G+G+STY+A +TP+   NV+V PDKL F  K  KQSYKLRIE 
Sbjct  633  KS----AQEFQRTVTNVGEGVSTYTASVTPLKGFNVSVDPDKLTFKGKYAKQSYKLRIEG  688

Query  301  PSTMGD--FLVFGSLTWVENAGKHVVRSPIV  215
            P+ M +   + F  L+W+E  GKHVV+SPIV
Sbjct  689  PNQMDEETVVAFCYLSWIETGGKHVVKSPIV  719



>ref|XP_008351993.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=764

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D   +DY+NL+CA+ +T    QTI + +S NCS PSLDLNYPSFIAFF +N  
Sbjct  610  LDPGLIYDAKIEDYVNLLCALNYTNKQIQTITKYASNNCSTPSLDLNYPSFIAFFNSNNK  669

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD     EF RT+TNLG G STY A +TP+    V VVP+KL FT+  +K S+ + I+ 
Sbjct  670  HSDVQTTHEFRRTVTNLGRGPSTYVASVTPLKGFVVGVVPEKLEFTEVGEKLSFVMSIKG  729

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M + +VFGSL+WVE+ G+HVVRSP+VA
Sbjct  730  PRVMKEAVVFGSLSWVESGGEHVVRSPVVA  759



>ref|XP_002510195.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52382.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D+ S DY+ L+CA+ FT    Q I R+SS +CS+PSLDLNYPSFIAFF  N+ 
Sbjct  611  LDPGLIYDLKSTDYVKLLCALNFTEKQIQIITRSSSNDCSSPSLDLNYPSFIAFF--NSN  668

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
            +S  + VQEFHRT+TN+G+G+STY+A LTPI  + V+VVPDKL F  K++K SYKL IE 
Sbjct  669  VSKSSTVQEFHRTVTNVGEGMSTYTANLTPINGLKVSVVPDKLEFKAKNEKLSYKLVIEG  728

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P+ + + ++FG L+WV++ GKH V+SPIVA
Sbjct  729  PTMLKESIIFGYLSWVDDEGKHTVKSPIVA  758



>ref|XP_011029618.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=775

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+S DY+ L+CA  FT    Q I R+SS +CSNPS DLNYPSFIA+F    +
Sbjct  615  LDPGLIYDVNSTDYVRLLCATNFTEKQIQVITRSSSTDCSNPSSDLNYPSFIAYFNEKNS  674

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V+EFHRT+TN+G+G  TY+  +TP+  + V V+PDKL F  K +K SYKL IE 
Sbjct  675  PSNLTIVREFHRTVTNVGEGTCTYTVSVTPMSGLKVNVMPDKLEFKTKYEKLSYKLTIEG  734

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P+ + + + FG L W +  GKHVV+SPI A
Sbjct  735  PALLDETVTFGYLNWADAGGKHVVKSPIAA  764



>emb|CBI18429.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI + ++QDYINL+C +K T    Q I R SS+ C NPSLDLNYPSFIA+F  N  
Sbjct  397  LEPGLIYNATAQDYINLLCGMKLTKREIQVITRASSHKCLNPSLDLNYPSFIAYF--NDV  454

Query  481  LSDPNR--VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
             S PN   VQ F RTLTN+G+G S+Y+AKLTP+  + V V P KLVF+ K +K SYKL +
Sbjct  455  GSSPNEQIVQVFSRTLTNVGEGGSSYTAKLTPMEGLKVKVEPRKLVFSHKYEKLSYKLIL  514

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            E P  M + +V G L+WV + GK+VVRSPIVA
Sbjct  515  EGPKWMEEDVVHGHLSWVSSDGKYVVRSPIVA  546



>gb|KEH18576.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 106/150 (71%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D+  QDY+N +CA+ FT  H   I R+SS +CSNPSL LNYPSFIAFF  NA 
Sbjct  611  LDPGLVYDIGVQDYVNFLCALNFTQKHITAITRSSSNDCSNPSLHLNYPSFIAFF--NAG  668

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S P   QEFHRT+TN+G+G + Y A +TPI   NV V+P++LVF +K++K SY+LRIE 
Sbjct  669  NSSPRTAQEFHRTVTNVGEGQTVYVASITPIEGFNVGVIPNRLVFNEKNEKLSYRLRIEH  728

Query  301  PS-TMGDFLVFGSLTWVENAGKHVVRSPIV  215
               T  + L FG LTW    GKHVVRSPIV
Sbjct  729  RRMTQKNELSFGYLTWKN--GKHVVRSPIV  756



>ref|XP_007135313.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
 gb|ESW07307.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
Length=744

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV +QDY+NL+CA+ FT  + + I R+SSYNCS PSLDLNYPSFIAFF  N +
Sbjct  596  LDPGLVYDVGAQDYVNLLCAMNFTQENIKAITRSSSYNCSKPSLDLNYPSFIAFF--NDS  653

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              +     EF RT+T  G+G ++Y+A +TPI   NV+++P+KLVF +K++KQSYKLRIE 
Sbjct  654  SKESTLTWEFVRTVTYFGEGQTSYTASITPIKGFNVSIIPNKLVFKEKNEKQSYKLRIEG  713

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            P   G    FG +TW +   KHVVRSPIV
Sbjct  714  PKIEG----FGYITWTDV--KHVVRSPIV  736



>ref|XP_010059918.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66394.1| hypothetical protein EUGRSUZ_F00208 [Eucalyptus grandis]
Length=768

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDYINL+CA+ +T    QT+ R+SSYNCS+ S+DLNYPSFIAFF  N++
Sbjct  609  LDPGLIYDATPQDYINLMCAMNYTSKQIQTVTRSSSYNCSDSSMDLNYPSFIAFFSPNSS  668

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    VQEF RT+TN+GDG STY AK+TP+    + V PDKL F +K +K  YKL IE 
Sbjct  669  GS--LMVQEFFRTVTNVGDGPSTYIAKVTPMEGFKIEVAPDKLTFKEKYEKLRYKLTIEG  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M + LVFGSL+W++N GKHVV+SPIVA
Sbjct  727  PKQMNEPLVFGSLSWMDNGGKHVVKSPIVA  756



>ref|XP_009359804.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=765

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D   +DY+NL+CA+ +T    QTI + +S +CS PSLDLNYPSFIAFF +N  
Sbjct  611  LDPGLIYDAKIEDYVNLLCALNYTNKQIQTITKYASNDCSTPSLDLNYPSFIAFFNSNKR  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD     EF RT+TNLG G STY A + P+    V VVP+KL FT+   K S+ + I+ 
Sbjct  671  HSDVQTTHEFRRTVTNLGKGPSTYVASVAPLKGFVVGVVPEKLEFTEVGQKLSFVMSIKG  730

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M + +VFGSL+WVE+ G+HVVRSP+VA
Sbjct  731  PRVMKEAVVFGSLSWVESEGEHVVRSPVVA  760



>ref|XP_011069659.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=754

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D SS+DYINL+CA+ FT    QTI R++SY+C NPSLDLNYPSFIA+F  N T
Sbjct  600  LDPGLIYDASSEDYINLLCALNFTAKQIQTITRSTSYDCKNPSLDLNYPSFIAYFNTNDT  659

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    V+EF RT+TN+GD  S Y AKLT +  + V+V P +L F+KK +K+SYKLRIE 
Sbjct  660  NSTSTTVKEFQRTVTNIGDENSIYIAKLTALDGLKVSVSPGRLEFSKKYEKKSYKLRIEG  719

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M D L+ GSLTW++++GK+ VRSPIVA
Sbjct  720  PGLMRDGLIHGSLTWIDSSGKYSVRSPIVA  749



>gb|KDP31945.1| hypothetical protein JCGZ_12406 [Jatropha curcas]
Length=569

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D  ++DYI  +CA+  T    Q I R+S +NC N SLDLNYPSFIA+F  + +
Sbjct  414  LEPGLIYDAKTEDYIKFLCAMNLTKKQIQFITRSSHHNCLNKSLDLNYPSFIAYFTGDES  473

Query  481  LSDPNRV-QEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             S+   V QEF RT+TN+G+GIS Y+AKLT +  + V+V P KL F KK++K  YKL IE
Sbjct  474  KSNGKMVVQEFPRTVTNVGEGISNYTAKLTKMNGIKVSVEPQKLAFKKKNEKLRYKLIIE  533

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             P  + + +V+GSL+WV + GK+VVRSPIVA
Sbjct  534  GPKLLEEDVVYGSLSWVHDGGKYVVRSPIVA  564



>ref|XP_002277899.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=769

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 109/151 (72%), Gaps = 4/151 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI + +++DY+ L+CA+ FT    Q I R SSY C NPSLDLNYPSFIA+F  N  
Sbjct  607  LDPGLIYNATAEDYVQLLCAMGFTAKEIQKITR-SSYECLNPSLDLNYPSFIAYF--NDE  663

Query  481  LSDPNR-VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             S P+  VQ FHRT+TN+G+G S Y+A+LTP+  + V V P+KLVF  K +  SY L +E
Sbjct  664  SSAPDELVQVFHRTVTNVGEGQSNYTAELTPLKGLKVKVDPEKLVFNCKHETLSYNLTLE  723

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             P +M ++LV+G L+WV + GK+VVRSPIVA
Sbjct  724  GPKSMTEYLVYGHLSWVSDGGKYVVRSPIVA  754



>emb|CDP17956.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D   +DY+NL+CA+ +  +  QT+ R+SS+NCS PSLDLNYPSFIA+F A+  
Sbjct  566  LDPGLIYDAGIEDYVNLLCALNYNSSQIQTVTRSSSHNCSKPSLDLNYPSFIAYFAASGN  625

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S     QEF RT+TN+G  +S Y AKL P+    V+V PD L F +K +K+SYKL IE 
Sbjct  626  RS---TTQEFSRTVTNIGSEMSVYVAKLVPLDGFKVSVTPDTLSFRQKYEKKSYKLTIEG  682

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             S + + LVFG L+W +  G HVVRSPIVA
Sbjct  683  FSVLKNSLVFGYLSWEDTGGNHVVRSPIVA  712



>ref|XP_002267740.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=762

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI + ++QDYINL+C +K T    Q I R SS+ C NPSLDLNYPSFIA+F  N  
Sbjct  605  LEPGLIYNATAQDYINLLCGMKLTKREIQVITRASSHKCLNPSLDLNYPSFIAYF--NDV  662

Query  481  LSDPNR--VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
             S PN   VQ F RTLTN+G+G S+Y+AKLTP+  + V V P KLVF+ K +K SYKL +
Sbjct  663  GSSPNEQIVQVFSRTLTNVGEGGSSYTAKLTPMEGLKVKVEPRKLVFSHKYEKLSYKLIL  722

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            E P  M + +V G L+WV + GK+VVRSPIVA
Sbjct  723  EGPKWMEEDVVHGHLSWVSSDGKYVVRSPIVA  754



>gb|KDP41714.1| hypothetical protein JCGZ_16121 [Jatropha curcas]
Length=724

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV++ DY+ L+CA+ FT    Q I +T++ +CS+PSLDLNYPSF+ FF  N +
Sbjct  562  LDPGLVYDVNTSDYVKLLCALNFTQKQIQIITKTANNDCSSPSLDLNYPSFLGFF-NNES  620

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGN-VNVTVVPDKLVFTKKSDKQSYKLRIE  305
              +P +V EFHRT+ N+GD  +TY+AKLT + + +NVTVVP+KLVF  ++ K S+KL IE
Sbjct  621  EPNPRKVVEFHRTVMNVGDAAATYTAKLTQLNHGLNVTVVPNKLVFKSRNQKLSFKLVIE  680

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             P  + + +VFG L+WVE+ GKH+V+SPI 
Sbjct  681  GPRKVDEDIVFGYLSWVESNGKHIVKSPIA  710



>emb|CBI21415.3| unnamed protein product [Vitis vinifera]
Length=822

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI + +++DY+ L+CA+ FT    Q I R SSY C NPSLDLNYPSFIA+F   ++
Sbjct  408  LDPGLIYNATAEDYVQLLCAMGFTAKEIQKITR-SSYECLNPSLDLNYPSFIAYFNDESS  466

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D   VQ FHRT+TN+G+G S Y+A+LTP+  + V V P+KLVF  K +  SY L +E 
Sbjct  467  APD-ELVQVFHRTVTNVGEGQSNYTAELTPLKGLKVKVDPEKLVFNCKHETLSYNLTLEG  525

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P +M ++LV+G L+WV + GK+VVRSPIVA
Sbjct  526  PKSMTEYLVYGHLSWVSDGGKYVVRSPIVA  555



>ref|XP_004291093.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=767

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D +  DY+NL+CA+ +T  H Q I  ++S NCS PSLDLNYPSFIAFF AN +
Sbjct  603  LNPGLIYDATIDDYVNLLCALNYTQKHIQIITGSASNNCSTPSLDLNYPSFIAFFNANDS  662

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
            +S     QEF RT+TN+G G STY A +T +    V VVP+KLVF ++ +K S+K+ I  
Sbjct  663  MSGVQATQEFKRTVTNVGKGQSTYVASVTAMKGFEVGVVPNKLVFGREGEKLSFKMSIRG  722

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
               M +   FG LTWV++ G+HVVRSPIVA
Sbjct  723  RRLMEETEAFGYLTWVDSEGQHVVRSPIVA  752



>ref|XP_004514928.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=712

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 106/150 (71%), Gaps = 7/150 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D   QDY+NL+CA+ FT     TI R+SS +CS PSLD+NYPSFIAFF +  +
Sbjct  563  LDPGLVYDAGVQDYVNLLCALNFTQQQITTITRSSSNDCSKPSLDINYPSFIAFFNSEKS  622

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    +QEFHRT+TNLG+G + Y A +TPI   NVTV+P+KL F +K++K SYKLRIE 
Sbjct  623  SS----IQEFHRTVTNLGEGKTVYVASVTPIKGFNVTVIPNKLTFNQKNEKMSYKLRIEN  678

Query  301  PSTMGDF-LVFGSLTWVENAGKHVVRSPIV  215
              T  +  + FG LTW  N  KHVVRSPIV
Sbjct  679  TGTTKEKNVAFGFLTW--NDVKHVVRSPIV  706



>gb|KJB63881.1| hypothetical protein B456_010G021600 [Gossypium raimondii]
Length=764

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 102/150 (68%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D + QDY++L+C + FT    +TI +TSS NCSNPSLDLNYPSFIAFF     
Sbjct  608  LNPGLIYDATVQDYVDLLCGLNFTQQQIKTITKTSSNNCSNPSLDLNYPSFIAFFNDRGA  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              +   V EF RT+TN+GDG  TY A +TPI  + V V PD LVF  K +K+SYKL IE 
Sbjct  668  KPNSTTVVEFGRTVTNVGDGSFTYKANVTPINGLKVIVEPDTLVFKTKYEKKSYKLSIEG  727

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  +   ++FG LTW ++  +HVV SPIVA
Sbjct  728  PKQLHKAVLFGYLTWEDSGKEHVVTSPIVA  757



>ref|XP_008220244.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 103/150 (69%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D   +DYINL+CA+ +T    QTI +++S NCS+PSLDLNYPSFIAFF AN +
Sbjct  606  LDPGLIYDADIEDYINLLCALNYTNKQIQTITKSASNNCSSPSLDLNYPSFIAFFNANDS  665

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D    QEF RT+T +G G STY A +TP+    V VVP+ L F K+ +K S+ L I+ 
Sbjct  666  KPDVQTTQEFRRTVTYIGKGQSTYVASVTPLKGFEVAVVPNTLKFKKEGEKLSFVLIIKG  725

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P    + + FG LTW E+ G+HVVRSP+VA
Sbjct  726  PRRTKETVAFGYLTWAESGGEHVVRSPVVA  755



>ref|XP_010263511.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            LDPGLI D ++QDY  L+CA+ +T      I R+SS +NC NPSLDLNYPSFIA    + 
Sbjct  612  LDPGLIYDANAQDYARLLCALNYTREQMNKITRSSSGHNCLNPSLDLNYPSFIALLRDDL  671

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
               D   ++EF RT+TN+GDG++ Y+A+LTPI    + V PD+LVF  K +KQSYKL +E
Sbjct  672  P-PDAKVIREFRRTVTNVGDGMAEYTAELTPIDGFRLKVEPDRLVFKDKYEKQSYKLTLE  730

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             P ++   +V GSL WVE  G+HVVRSPIVA
Sbjct  731  GPGSVESGVVHGSLNWVEVGGRHVVRSPIVA  761



>ref|XP_007221958.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
 gb|EMJ23157.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
Length=767

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 102/150 (68%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D   +DYINL+CA+ +T    QTI +++S NCS PSLDLNYPSFIAFF AN +
Sbjct  606  LDPGLIYDAEIEDYINLLCALNYTNKQIQTITKSASNNCSTPSLDLNYPSFIAFFNANDS  665

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              +    QEF RT+T +G G STY A +TP+    V VVP+ L F ++ +K S+ L I+ 
Sbjct  666  KPNVQTTQEFRRTVTYIGKGQSTYVASVTPLKGFEVAVVPNTLKFKEEGEKLSFVLSIKG  725

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P    + L FG LTW E+ G+HVVRSP+VA
Sbjct  726  PRRTKETLAFGYLTWAESGGEHVVRSPVVA  755



>ref|XP_004514927.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=762

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 109/150 (73%), Gaps = 7/150 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ FT     TI R+SS +CS PSLDLNYPSFIAFF A   
Sbjct  611  LDPGLVYDVGVQDYVNLLCALNFTQQQITTITRSSSNDCSKPSLDLNYPSFIAFFNAK--  668

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              + +  QEFHRT+TN+G+G + Y A +TPI  ++V+V+P+KLVF +K++K S+KLRIE 
Sbjct  669  --NSSSTQEFHRTVTNVGEGQTIYVANITPIKGLSVSVMPNKLVFNEKNEKLSFKLRIEV  726

Query  301  PS-TMGDFLVFGSLTWVENAGKHVVRSPIV  215
            P  T    + FG LTW++   KHVVRSPIV
Sbjct  727  PRMTKVKKVAFGYLTWMDV--KHVVRSPIV  754



>ref|XP_002510196.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52383.1| Cucumisin precursor, putative [Ricinus communis]
Length=777

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +   YIN +CA+  T    QTI ++ + +CS+PS DLNYPSF+A+F A+++
Sbjct  618  LDPGLIYDANLTSYINFLCALNLTQKQIQTITKSPNNDCSSPSSDLNYPSFLAYFNADSS  677

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             ++   VQE+HRT+TN+GD +STY+A LTPI  +  +VVP+KLVF  K +K SYKL I+ 
Sbjct  678  EANLTAVQEYHRTVTNVGDPVSTYTANLTPINGIKASVVPNKLVFKAKYEKLSYKLSIQG  737

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPI  218
            P+ + + +VFG L+WV++ GK+VV+SPI
Sbjct  738  PNPVPEDVVFGYLSWVDSKGKYVVKSPI  765



>gb|KEH18574.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 106/150 (71%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ FT  +  TI R+S  +CS PSLDLNYPSFIAFF  NA 
Sbjct  610  LDPGLVYDVGVQDYVNLLCALNFTQKNITTITRSSFNDCSKPSLDLNYPSFIAFF--NAG  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    +QEFHRT+TN+G+G + Y A + P+    V+ +P+KL+F KK++  SYKLRIE 
Sbjct  668  NSSSRAIQEFHRTVTNVGEGQAIYVASIMPVEGYRVSAIPNKLMFNKKNEMLSYKLRIEG  727

Query  301  PS-TMGDFLVFGSLTWVENAGKHVVRSPIV  215
            P  T  + + FG +TW +  GKHVVRSPIV
Sbjct  728  PRMTQNNEVAFGYITWQD--GKHVVRSPIV  755



>gb|KHN15890.1| Subtilisin-like protease [Glycine soja]
Length=757

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 103/149 (69%), Gaps = 6/149 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+  T  +   I R+S+ NCSNPSLDLNYPSFI FF +N +
Sbjct  603  LDPGLVYDVGVQDYVNLLCAMSSTQQNISIITRSSTNNCSNPSLDLNYPSFIGFFSSNGS  662

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             ++     EF RT+TN+G+  + YSA +TPI   NV+VVP KLVF +K++K SYKLRIE 
Sbjct  663  SNESRVAWEFQRTVTNVGEKQTIYSANVTPIKGFNVSVVPSKLVFKEKNEKLSYKLRIEG  722

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            P   G    FG LTW +   KH VRSPIV
Sbjct  723  PMVEG----FGYLTWTDM--KHAVRSPIV  745



>ref|XP_008221259.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 102/150 (68%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D   +DYINL+CA+ +T    QTI +++S NCS+PSLDLNYPSFIAFF AN +
Sbjct  606  LDPGLIYDADIEDYINLLCALNYTNKQIQTITKSASNNCSSPSLDLNYPSFIAFFNANDS  665

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D    QEF RT+T +G G STY A +TP+    V VVP+   F ++ +K S+ L I+ 
Sbjct  666  KPDVQTTQEFRRTVTYIGKGQSTYVASVTPLKGFEVAVVPNTFKFKEEGEKLSFVLSIKG  725

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P    + + FG LTW E+ G+HVVRSP+VA
Sbjct  726  PRRTKETVAFGYLTWAESGGEHVVRSPVVA  755



>ref|XP_002310134.2| subtilase family protein [Populus trichocarpa]
 gb|EEE90584.2| subtilase family protein [Populus trichocarpa]
Length=757

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +++DYI L+CA+ +T    Q I R+S ++C N SLDLNYPSFIA+F +  +
Sbjct  603  LDPGLIYDATAEDYIKLLCAMNYTNKQIQIITRSSHHDCKNRSLDLNYPSFIAYFDSYDS  662

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    V +F RTLTN+G+ +S+Y+AKL  +  + V+V P KLVF K+ +K SY L +E 
Sbjct  663  GSKEKVVHKFQRTLTNVGERMSSYTAKLLGMDGIKVSVEPQKLVFKKEHEKLSYTLTLEG  722

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P ++ + ++ GSL+WV + GK+VVRSPIVA
Sbjct  723  PKSLEEDVIHGSLSWVHDGGKYVVRSPIVA  752



>ref|XP_008220243.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 101/150 (67%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D   +DYINL+CA+ +T    QTI +++S NCS PSLDLNYPSFIAFF  N +
Sbjct  606  LDPGLIYDADIEDYINLLCALNYTNKQIQTITKSASNNCSTPSLDLNYPSFIAFFNTNDS  665

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D    QEF RT+T +G G STY A +TP+    V VVP+ L F ++ +K S+ L I+ 
Sbjct  666  KPDVQTTQEFRRTVTYIGKGQSTYVASVTPLKGFEVAVVPNTLKFKEEGEKLSFVLSIKG  725

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P    + + FG LTW E+ G+HVVRSP+VA
Sbjct  726  PRRTKETVAFGYLTWAESGGEHVVRSPVVA  755



>ref|XP_011043530.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=757

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +++DYI  +CA+ +T    Q I R+S ++C N SLDLNYPSFIA+F +  +
Sbjct  603  LDPGLIYDATAEDYIRFLCAMNYTNKQIQIITRSSHHDCKNRSLDLNYPSFIAYFESYDS  662

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    V +F RTLTN+G+ +S+Y+AKL  +  + V+V P KLVF K+ +K SY L +E 
Sbjct  663  GSKEKVVHKFQRTLTNVGERMSSYTAKLLGMDGIKVSVEPQKLVFNKEHEKLSYTLTLEG  722

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P ++ + +V GSL+WV + GK+VVRSPIVA
Sbjct  723  PKSLKEDIVHGSLSWVHDGGKYVVRSPIVA  752



>ref|XP_010112177.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32843.1| Subtilisin-like protease [Morus notabilis]
Length=767

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 111/151 (74%), Gaps = 1/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY-NCSNPSLDLNYPSFIAFFPANA  485
            LDPGLI DV  QDY+N++CA+ +T  H + I ++SS  +CS PSLDLNYPSFIAFF AN 
Sbjct  608  LDPGLIYDVEIQDYVNVLCALNYTVEHIKVITKSSSLVDCSKPSLDLNYPSFIAFFNAND  667

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
            + SD   V++F RT+TN+G+G STY A +T +  + V VVP KLVF +K++K+ +KL IE
Sbjct  668  SKSDAKTVKDFQRTVTNVGEGKSTYIASVTSMEGLKVNVVPKKLVFKEKNEKKKFKLSIE  727

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             P  M   +VFG LTWV+N  KHVVRSPIVA
Sbjct  728  GPRMMKQRVVFGYLTWVDNDNKHVVRSPIVA  758



>gb|KCW66392.1| hypothetical protein EUGRSUZ_F00206 [Eucalyptus grandis]
Length=756

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 104/150 (69%), Gaps = 14/150 (9%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+ QDY+NL+CA+ +T    Q + R+SSYNCSNPSLDLNYPSFIAFF +N+ 
Sbjct  609  LDPGLIYDVTPQDYVNLMCAMNYTSKQIQMVTRSSSYNCSNPSLDLNYPSFIAFFGSNS-  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   VQEF+RT+TN+G G STY A++ P+               KK +K SYKL IE 
Sbjct  668  -SDSPMVQEFYRTVTNVGAGASTYRAEVNPMEGF------------KKYEKLSYKLTIEG  714

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M   +V GSL+W+++ GK+ V+SPIVA
Sbjct  715  PKQMKQTVVSGSLSWMDDGGKYAVKSPIVA  744



>gb|KEH42928.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 107/150 (71%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+K++  +  TI R+SS +CS PSLDLNYPSFIAFF    +
Sbjct  607  LDPGLVYDVGVQDYVNLLCALKYSQKNITTITRSSSNDCSKPSLDLNYPSFIAFFNDGNS  666

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S P  +QEF RT+TN+GDG + Y A + PI    VTV+P+ LVF +K++K SYKLRIE 
Sbjct  667  SSRP--IQEFRRTVTNVGDGQAIYVASIAPIKGFRVTVIPNNLVFNEKNEKLSYKLRIEV  724

Query  301  PS-TMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S T    + FG LTW++   KHVVRSPIV
Sbjct  725  ASMTKLKKVAFGYLTWMDV--KHVVRSPIV  752



>ref|XP_008785918.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=456

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D S++DY+ L+CA+K+T    + I +T S++CS+ SLDLNYPSFIAFF  N T
Sbjct  298  LDPGLVYDASTEDYVRLLCAMKYTSKQIKMITKTYSFDCSHASLDLNYPSFIAFFNPNKT  357

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL-RIE  305
             +    VQEF RT+TN+GD +++Y+AK+  +    + VVP+KLVF +K +K+S+ L  + 
Sbjct  358  AASDKVVQEFRRTVTNVGDAMASYNAKVVAMKGFAIRVVPEKLVFHEKYEKKSFALILVG  417

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
                  D ++ GSL+WV++ GK+VVRSPIVA
Sbjct  418  QMGKKADEVLHGSLSWVDDKGKYVVRSPIVA  448



>gb|KHN15886.1| Subtilisin-like protease [Glycine soja]
Length=712

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 107/150 (71%), Gaps = 7/150 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ +T  +   I  TSS +CS PSLDLNYPSFIAFF +N++
Sbjct  561  LDPGLVYDVGVQDYVNLLCALGYTQKNITVITGTSSNDCSKPSLDLNYPSFIAFFKSNSS  620

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                +  QEF RT+TN+G+G + Y A +TP+   +V+V+P KLVF +K++KQSYKLRIE 
Sbjct  621  ----STTQEFERTVTNVGEGQTIYVASVTPVKGYHVSVIPKKLVFKEKNEKQSYKLRIEG  676

Query  301  PSTMGDF-LVFGSLTWVENAGKHVVRSPIV  215
            P    +  + FG LTW +   KHV+RSPIV
Sbjct  677  PRKKKEKNVAFGYLTWTDL--KHVIRSPIV  704



>gb|KEH18578.1| subtilisin-like serine protease [Medicago truncatula]
Length=728

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGL+ DV  QDY+NL+CA+ FT  +   I R+S+ +CS PSLDLNYPSFIAFF  NA 
Sbjct  575  LNPGLVYDVGVQDYVNLLCALNFTQKNITIITRSSTNDCSKPSLDLNYPSFIAFF--NAA  632

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE-  305
             S     QEFHRT+TN+G G S Y A +T I   +V V+P+KLVF KK++K SYKLRIE 
Sbjct  633  NSSSRTTQEFHRTITNVGQGKSIYVAHITRIEGFHVRVIPNKLVFNKKNEKLSYKLRIED  692

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            A     + + FG LTW +  GKHVVRSPIV
Sbjct  693  ARVAQKNEVSFGYLTWQD--GKHVVRSPIV  720



>ref|XP_003626594.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES82812.1| subtilisin-like serine protease [Medicago truncatula]
Length=765

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D   QDY+NL+CA+ FT  +   I R+S  NCSNPSLDLNYPSFI+FF  NA+
Sbjct  609  LDPGLVYDAGKQDYVNLLCALNFTQKNIAAITRSSFNNCSNPSLDLNYPSFISFF-NNAS  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
            +      QEF RT+TN+G+  + Y A +TPI   +V+V+P+KLVF +K++K +YKLRIE 
Sbjct  668  VKSKVITQEFQRTVTNVGEEPTIYVANITPIEGFHVSVIPNKLVFKEKNEKVAYKLRIEG  727

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            P    + +VFG LTW ++  KH VRSPIV
Sbjct  728  PKMEENKVVFGYLTWTDS--KHNVRSPIV  754



>ref|XP_008785865.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D S+ DY+ L+CA+K+T    + I +T S++CSN SLDLNYPSFIAFF  N T
Sbjct  602  LDPGLIYDASTDDYVRLLCAMKYTSKQIKMITKTYSFDCSNASLDLNYPSFIAFFNPNKT  661

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL-RIE  305
                  VQEF RT+TN+GD + TY+AK+  +  + ++V+P+KLVF +K +K+S+ L  + 
Sbjct  662  AISYKVVQEFQRTVTNVGDAVVTYNAKVVAMKGIEISVMPEKLVFHEKYEKKSFTLIMVG  721

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
                  D ++ GSL+WV++ GK+VVRSPIVA
Sbjct  722  QMGKKADEVLHGSLSWVDDKGKYVVRSPIVA  752



>ref|XP_003548151.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=750

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 107/150 (71%), Gaps = 7/150 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ +T  +   I  TSS +CS PSLDLNYPSFIAFF +N++
Sbjct  599  LDPGLVYDVGVQDYVNLLCALGYTQKNITVITGTSSNDCSKPSLDLNYPSFIAFFKSNSS  658

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                +  QEF RT+TN+G+G + Y A +TP+   +V+V+P KLVF +K++KQSYKLRIE 
Sbjct  659  ----STTQEFERTVTNVGEGQTIYVASVTPVKGYHVSVIPKKLVFKEKNEKQSYKLRIEG  714

Query  301  PSTMGDF-LVFGSLTWVENAGKHVVRSPIV  215
            P    +  + FG LTW +   KHV+RSPIV
Sbjct  715  PIKKKEKNVAFGYLTWTDL--KHVIRSPIV  742



>gb|KCW66398.1| hypothetical protein EUGRSUZ_F00212 [Eucalyptus grandis]
Length=728

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+ QDY++L+CA+ +T    Q + R+SSYNCS+ SLDLNYPSFIAFF +N+ 
Sbjct  569  LDPGLIYDVTPQDYVDLMCAMNYTSKQIQIVTRSSSYNCSDSSLDLNYPSFIAFFSSNSL  628

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
            +S     QEF RT+TN+GDG STY AK+TP+    + V PDKL F +K +K  YKL IE 
Sbjct  629  VSP--TAQEFFRTVTNVGDGPSTYVAKVTPMEGYKINVKPDKLTFKEKYEKLRYKLTIEG  686

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M   L+FGS++W++  GK+VV+SPIVA
Sbjct  687  PKQMNQKLMFGSVSWMDKGGKYVVKSPIVA  716



>ref|XP_010059919.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=766

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV+ QDY++L+CA+ +T    Q + R+SSYNCS+ SLDLNYPSFIAFF +N+ 
Sbjct  607  LDPGLIYDVTPQDYVDLMCAMNYTSKQIQIVTRSSSYNCSDSSLDLNYPSFIAFFSSNSL  666

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
            +S     QEF RT+TN+GDG STY AK+TP+    + V PDKL F +K +K  YKL IE 
Sbjct  667  VSP--TAQEFFRTVTNVGDGPSTYVAKVTPMEGYKINVKPDKLTFKEKYEKLRYKLTIEG  724

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  M   L+FGS++W++  GK+VV+SPIVA
Sbjct  725  PKQMNQKLMFGSVSWMDKGGKYVVKSPIVA  754



>ref|XP_008785921.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 109/153 (71%), Gaps = 5/153 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D S+ DY+ L+CA+K+T    +TI +T S++CS+ SLDLNYPSFIAFF  N T
Sbjct  602  LDPGLVYDASTDDYVRLLCAMKYTSKQIKTITKTYSFDCSHASLDLNYPSFIAFFNPNKT  661

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +    VQEF RT+TN+GD + TY+AK+  +    + +VP+KLVF +K +K+S+ L +  
Sbjct  662  AASDEVVQEFRRTVTNVGDAVVTYNAKVVAMKGFAIRIVPEKLVFYEKYEKKSFALILVG  721

Query  301  PSTMG---DFLVFGSLTWVENAGKHVVRSPIVA  212
               MG   D ++ GSL+WV++ GK+VVRSPIVA
Sbjct  722  --QMGKKDDEVLHGSLSWVDDKGKYVVRSPIVA  752



>ref|XP_002523606.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38801.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D ++ DY+ L+CA+ +T    Q I R S+ NC N SLDLNYPSFIA+F  + +
Sbjct  612  LDPGLIYDATADDYMKLLCAMNYTKKQIQIITR-SNPNCVNKSLDLNYPSFIAYFNNDDS  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              +   V+EF RTLTN+G G+S+YSAK+TP+  V  TV P +LVF  K +K SYKL +E 
Sbjct  671  DLNEKVVREFRRTLTNVGMGMSSYSAKVTPMYGVRATVEPKELVFRNKYEKLSYKLTLEG  730

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + + +V GSL+WV + GK+VV SPIVA
Sbjct  731  PKILEEMVVHGSLSWVHDEGKYVVTSPIVA  760



>ref|XP_008785920.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=764

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 110/153 (72%), Gaps = 5/153 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D S++DY+ L+CA+K+T    + I +T S++CS+ SLDLNYPSFIAFF  N T
Sbjct  606  LDPGLVYDASTEDYVRLLCAMKYTSKQIKMITKTYSFDCSHASLDLNYPSFIAFFDPNKT  665

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +    VQEF RT+TN+GD +++Y+AK+  +    + VVP+KLVF +K +K+S+ L +  
Sbjct  666  AASDKVVQEFRRTVTNMGDAVASYNAKVVAMKGFAIRVVPEKLVFHEKYEKKSFALILVG  725

Query  301  PSTMG---DFLVFGSLTWVENAGKHVVRSPIVA  212
               MG   D ++ GSL+W+++ GK+VVRSPIVA
Sbjct  726  --QMGKKADEVLHGSLSWMDDKGKYVVRSPIVA  756



>gb|KJB59847.1| hypothetical protein B456_009G275900 [Gossypium raimondii]
Length=746

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPG++ D + QDYI+ +C + FTP   +TI   SS NCSNPSLDLNYPSFIA+F     
Sbjct  591  LDPGIVYDATVQDYIDFLCGLNFTPQQIKTIT-GSSNNCSNPSLDLNYPSFIAYFNDRNV  649

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D N V+EF RT+TN+G+G   Y A LT +  V V+V PD LVF + ++K+S+KL IE 
Sbjct  650  KPDSNTVKEFQRTVTNVGEGSFIYKASLTAMKGVKVSVEPDTLVFKEINEKKSFKLSIEG  709

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  +   + FG L W ++  KHVVRSPIVA
Sbjct  710  PRQLDKTVSFGYLIWEDSQRKHVVRSPIVA  739



>ref|XP_003595551.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES65802.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 105/150 (70%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D+  QDYINL+CA+ FT  +   I R+S  +CS PSLDLNYPSFIAF  A  +
Sbjct  610  LDPGLVYDIGVQDYINLLCALNFTQKNISAITRSSFNDCSKPSLDLNYPSFIAFSNARNS  669

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                N   EFHRT+TN+G+  +TY A +TPI    VTV+P+KLVF KK++K SYKL+IE 
Sbjct  670  SRTTN---EFHRTVTNVGEKKTTYFASITPIKGFRVTVIPNKLVFKKKNEKISYKLKIEG  726

Query  301  PS-TMGDFLVFGSLTWVENAGKHVVRSPIV  215
            P  T  + + FG L+W +  GKHVVRSPIV
Sbjct  727  PRMTQKNKVAFGYLSWRD--GKHVVRSPIV  754



>ref|XP_007204261.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
 gb|EMJ05460.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
Length=759

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 107/150 (71%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGL+ D +++DYI L+CA+ +T    Q +I  S+++C N S+DLNYPSFIA+F +  +
Sbjct  602  LEPGLVYDTTAEDYIKLLCAMNYTAKQIQ-VITGSTHSCVNRSIDLNYPSFIAYFNSKGS  660

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    VQEF+RT+TN+G+  S Y+AKLT +  + V V P++LVF  K +K SYKL +E 
Sbjct  661  KSSAKVVQEFNRTVTNVGEQRSGYTAKLTAMAGLKVKVEPERLVFKNKYEKLSYKLTLEG  720

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  +   +V GSL+WV++ GK+VVRSPIVA
Sbjct  721  PKLLKKVVVQGSLSWVDDGGKYVVRSPIVA  750



>gb|EYU36340.1| hypothetical protein MIMGU_mgv1a001790mg [Erythranthe guttata]
Length=759

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D S QD++NL+C+  FT   TQTI RTS YNCS+PS DLNYPSFIA F  +  
Sbjct  605  LDPGLVYDASPQDFVNLVCSRNFTREQTQTITRTS-YNCSSPSSDLNYPSFIALFNNDEI  663

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                NR   FHRT+TN+ DG +TY  KL    N  V + P  LVF KK +KQSY L I  
Sbjct  664  GMTFNRT--FHRTVTNVADGAATYKVKLEKPANTRVRIQPKTLVFQKKYEKQSYSLNIRY  721

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                  F   GSLTWVE  GKHVVRSPIV
Sbjct  722  RGDNNAFPRHGSLTWVEETGKHVVRSPIV  750



>gb|KEH18575.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 106/150 (71%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV  QDY+NL+CA+ ++  +   I R+SS +CS PSLDLNYPSFIAFF     
Sbjct  612  LDPGLIYDVGVQDYVNLLCALSYSQKNITAITRSSSNDCSEPSLDLNYPSFIAFFDNGN-  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE-  305
             S     QEFHRT+TN+G+G + Y + +T +   +V+V+P+KLVF +K++K SYKLRIE 
Sbjct  671  -SSSRTTQEFHRTITNVGEGETVYVSSITQVEGFHVSVIPNKLVFNEKNEKLSYKLRIEV  729

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            A +T    + FG LTW++   KHVVRSPIV
Sbjct  730  ARTTKMKKVAFGYLTWMDT--KHVVRSPIV  757



>ref|XP_011074591.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 100/149 (67%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D S QDY+NL+C++ FT N   TI R SSYNCS PS DLNYPSFIA +  N T
Sbjct  606  LDPGLIYDASPQDYVNLLCSMNFTHNQISTITR-SSYNCSTPSSDLNYPSFIALY-TNKT  663

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                + VQEFHR +TN+GD +++Y  ++T      VTV P  LVF  K +KQSY L I+ 
Sbjct  664  RD--SLVQEFHRVVTNVGDDVTSYKVQVTAPSGSTVTVYPTTLVFGHKYEKQSYSLTIQY  721

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     + FGS+TW+E+ GKH VRSPIV
Sbjct  722  KSNSTGAITFGSITWIEDNGKHTVRSPIV  750



>ref|XP_008357385.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 0/142 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV+  DY+NL+CA+ +T    QTI ++ S NCS PSLDLNYPSFIAFF +N +
Sbjct  610  LDPGLLYDVNIDDYVNLLCALNYTNKQIQTITKSXSNNCSTPSLDLNYPSFIAFFNSNDS  669

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD     EF RT+ N+G G+STY A +TP+    V VVP KL F ++ +K S+ L I+ 
Sbjct  670  NSDVQSTHEFRRTVXNIGKGLSTYVASVTPLKGFVVGVVPKKLEFKEEGEKLSFVLSIKG  729

Query  301  PSTMGDFLVFGSLTWVENAGKH  236
            P  M + +VFG L+WVE+ G+H
Sbjct  730  PRVMKEAVVFGYLSWVESGGQH  751



>ref|XP_008241490.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=745

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 107/150 (71%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGL+ D +++DYI L+CA+ +T    Q +I  S+++C N S++LNYPSFIA+F +  +
Sbjct  588  LEPGLVYDTTAEDYIKLLCAMNYTAKQIQ-VITGSTHSCVNRSINLNYPSFIAYFNSKGS  646

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    VQEF RT+TN+G+  S Y+AKLT +  + V V P++LVF  K +K SYKL +E 
Sbjct  647  KSSAKVVQEFKRTVTNVGEQRSGYTAKLTAMAGLKVKVEPERLVFKNKYEKLSYKLTLEG  706

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  + + +V GSL+WV++ GK+VVRSPIVA
Sbjct  707  PKLLKEVVVQGSLSWVDDGGKYVVRSPIVA  736



>gb|EYU36339.1| hypothetical protein MIMGU_mgv1a001782mg [Erythranthe guttata]
Length=760

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 96/149 (64%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D + QD++NL+C++  T   TQTI R S+YNCS+PS DLNYPSFIA F  +  
Sbjct  606  LDPGLVYDATPQDFVNLVCSMNLTREQTQTITR-STYNCSSPSSDLNYPSFIALFNFDER  664

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                NR   FHRT+TN+ DG +TY  KL    N  V + P  LVF KK +KQSY L I  
Sbjct  665  GMTFNRT--FHRTVTNVADGAATYKVKLEKPANTRVRIQPKTLVFQKKYEKQSYSLNIRY  722

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
               +  F  FGSLTWVE  GKH VRSPIV
Sbjct  723  RGDIDSFPTFGSLTWVEETGKHKVRSPIV  751



>ref|XP_007047285.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91442.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=779

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
             DPGL+ D + QDYI L+CA+ +T    + I   SS+NC + SLDLNYPSFIA F    +
Sbjct  626  FDPGLVYDAAPQDYIKLLCAMNYTSKQIR-IFTNSSHNCMSQSLDLNYPSFIALFTDEHS  684

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S+   V+EF RT+TN+G G   Y+AKL  +  + V V P+KL+F ++ +KQSYKL +E 
Sbjct  685  TSNQKVVKEFQRTVTNVGKGGMAYTAKLAGMDGIKVMVKPEKLIFKQRYEKQSYKLSLEV  744

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P ++   ++FG L+WV++ GK+VVRSPIVA
Sbjct  745  PKSLKIEVIFGYLSWVDDDGKYVVRSPIVA  774



>ref|XP_004494864.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 107/152 (70%), Gaps = 6/152 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPA--N  488
            LDPGLI D   QDY+NL+CA+ FT  +   I R+   NCSNPSLDLNYPSFI+F  A  N
Sbjct  618  LDPGLIYDAQKQDYVNLLCALNFTRKNIMAITRSFFNNCSNPSLDLNYPSFISFVNAANN  677

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
             T+    + QEFHRT+TN+G+  +TY AK+TPI   +V V+P KLVF ++++K +YKLRI
Sbjct  678  GTVGSKVK-QEFHRTVTNVGEEATTYVAKITPIEGFHVNVIPKKLVFKERNEKVTYKLRI  736

Query  307  EAPSTM-GDFLVFGSLTWVENAGKHVVRSPIV  215
            E    +  + + FG LTW+++  KH+VRSPIV
Sbjct  737  EGRRILEKNKVAFGYLTWIDS--KHIVRSPIV  766



>ref|XP_003624105.1| Xylem serine proteinase [Medicago truncatula]
 gb|ABD28576.1| Protease-associated PA; Proteinase inhibitor I9, subtilisin propeptide 
[Medicago truncatula]
 gb|AES80323.1| subtilisin-like serine protease [Medicago truncatula]
Length=769

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 106/150 (71%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            ++PGLI D + QDY+NL+C +KFT N   TI R++SY+C NPSLDLNYPSFIAF+ +N T
Sbjct  618  MNPGLIYDATPQDYVNLLCGLKFTKNQILTITRSNSYDCENPSLDLNYPSFIAFY-SNKT  676

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             S    V +F R +TN+GDG +TY AK+T P G+V VTV PD L F  K++KQSY + I+
Sbjct  677  RS---MVHKFKRIVTNVGDGAATYRAKVTYPKGSV-VTVSPDILTFKYKNEKQSYNIIIK  732

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                  + + FG L W+E+ G H+VRSPIV
Sbjct  733  YVMYKKENVSFGDLVWIEDGGAHIVRSPIV  762



>ref|XP_011069662.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=769

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 98/149 (66%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D + QDY+NL+C++ FTP  T+TIIR SSYNCS PS DLNYP+FIA +    T
Sbjct  616  LNPGLIYDATVQDYVNLVCSMNFTPEQTRTIIR-SSYNCSTPSPDLNYPTFIALYEVQET  674

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +   R  +F RTLTN+GDG +TY  K+       +TV P  LVF KK +KQSY L I  
Sbjct  675  RTTLTR--KFKRTLTNVGDGAATYKVKVKEPNGSTITVSPQTLVFRKKYEKQSYSLTIRY  732

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     +  GS+TW+E  GKH VRSPIV
Sbjct  733  RSNSEFVITDGSITWIEENGKHTVRSPIV  761



>ref|XP_010912031.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=765

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 6/153 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D SS DY+ L+CA+ +T    +TI RT S++CS  SLDLNYPSFIAFF  N T
Sbjct  608  LDPGLVYDASSDDYVRLLCAMNYTIQQIKTITRTYSFDCSKASLDLNYPSFIAFFNPNKT  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +    VQEF RT+TN+GD  +TY +K+  +   ++TV+PD LVF +K +K+S+ + IE 
Sbjct  668  TTRDKVVQEFRRTVTNVGDA-ATYYSKVVAMKGFSITVMPDMLVFHEKYEKKSFTIIIEG  726

Query  301  PSTMG---DFLVFGSLTWVENAGKHVVRSPIVA  212
               MG   D ++ G+L+WV++ GK+VVRSPIVA
Sbjct  727  --QMGKKKDEVLHGALSWVDDKGKYVVRSPIVA  757



>ref|XP_011464036.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=474

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNP-SLDLNYPSFIAFFPANA  485
            LDPGL+ D ++ DYI L+CA+ +T    Q II  S Y C+N  ++DLNYPSFIA+F  N 
Sbjct  314  LDPGLVYDAAADDYIALLCAMNYTAKQIQ-IITGSIYICTNRFNIDLNYPSFIAYFNNNG  372

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
            + SD   VQEF RTLTN+G+  S+Y   LTP+  + + V P KLVFTKK +K  YKL I 
Sbjct  373  SNSDAKVVQEFRRTLTNVGEKQSSYFVNLTPMVGLKLKVEPQKLVFTKKYEKLRYKLTIV  432

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             P  + + +V GSL W+++ GK+VVR PIVA
Sbjct  433  GPKLLKEDVVQGSLIWIDDGGKYVVRCPIVA  463



>gb|ABD28577.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
 gb|AES80322.2| subtilisin-like serine protease [Medicago truncatula]
Length=771

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            ++PGLI D + QDY+N +C +KFT N   TI R+SSY C NPSLDLNYPSFIAF+     
Sbjct  620  MNPGLIYDATPQDYVNFLCGLKFTKNQILTITRSSSYGCENPSLDLNYPSFIAFYNKKTR  679

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                + V  F+RT+TN+GDG +TYSA +T      +TV+PD L F  +++KQSY L I+ 
Sbjct  680  ----SMVHTFNRTVTNVGDGAATYSANVTHPKGCVMTVLPDILTFKYRNEKQSYSLVIKC  735

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 D + FG L W+E  G H VRSPIV
Sbjct  736  VMYKKDNVSFGDLVWIEYGGAHTVRSPIV  764



>gb|KDP41713.1| hypothetical protein JCGZ_16120 [Jatropha curcas]
Length=767

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D++S DY+ L+C + FT N  +TI R+SS +CS+PSLDLNYP+FIAFF +N +
Sbjct  608  LDPGLIYDLNSTDYVKLLCGLNFTANQIKTITRSSSNDCSSPSLDLNYPAFIAFFNSNES  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                  V EFHRT+TN+G+  S Y+AK+TP+  + V+VVPDKL F  K +K SYKL +E+
Sbjct  668  KLGLATVTEFHRTVTNVGERTSIYTAKVTPMDGLKVSVVPDKLEFKSKYEKLSYKLVVES  727

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S +   +++G L+WV + GK+VV+SPIV
Sbjct  728  QSQLRQNVIYGYLSWVHSEGKYVVKSPIV  756



>gb|ACA64705.1| subtilase, partial [Nicotiana tabacum]
Length=531

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 98/150 (65%), Gaps = 3/150 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S ++NCSNPS DLNYPSFIA +P   
Sbjct  375  LDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEG  434

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
              +     Q+F RT+TN+G G +TY AKL    N  V+V P  LVF KK++KQSY L I 
Sbjct  435  PFTFLE--QKFRRTVTNVGQGAATYKAKLKAPKNTTVSVSPQTLVFKKKNEKQSYTLTIR  492

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                +G     GS+TWVE  G H VRSPIV
Sbjct  493  YLGDVGQSRNVGSITWVEENGNHSVRSPIV  522



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 96/149 (64%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D S QD++NL+C++  T   TQTI R S+YNCS PS DLNYPSFIA F  +  
Sbjct  605  LDPGLIYDASPQDFVNLVCSMNLTREETQTITR-STYNCSTPSSDLNYPSFIAVFNNDER  663

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                N  Q FHRT+TN+ +G +TY  KL    N  V + P  LVF KK +KQSY L I  
Sbjct  664  GMMFN--QTFHRTVTNVANGAATYKVKLEKPENTRVRIQPKTLVFQKKYEKQSYTLNIRY  721

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
               +  F  +GSLTWVE  GKH+VRSPIV
Sbjct  722  RGDIDAFPTYGSLTWVEKTGKHLVRSPIV  750



>ref|XP_003529873.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 104/150 (69%), Gaps = 7/150 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ +T  +   I  TSS +CS PSLDLNYPSFIAF  +N +
Sbjct  602  LDPGLVYDVRVQDYVNLLCALGYTQKNITIITGTSSNDCSKPSLDLNYPSFIAFINSNGS  661

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                +  QEF RT+TN+G+G + Y A +TP+   +++V+P KLVF +K++K SYKL IE 
Sbjct  662  ----SAAQEFQRTVTNVGEGKTIYDASVTPVKGYHLSVIPKKLVFKEKNEKLSYKLTIEG  717

Query  301  PSTMG-DFLVFGSLTWVENAGKHVVRSPIV  215
            P+    + + FG LTW +   KHVVRSPIV
Sbjct  718  PTKKKVENVAFGYLTWTDV--KHVVRSPIV  745



>gb|KDP41710.1| hypothetical protein JCGZ_16117 [Jatropha curcas]
Length=651

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 94/149 (63%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D +  DY+N++C++ +T     TI R+  Y CSNPS DLNYPSFIA +  N T
Sbjct  498  LDPGLIYDATPHDYVNILCSMNYTKKQILTITRSKRYTCSNPSPDLNYPSFIALYD-NKT  556

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +    VQ F RTLTN+GDG +TY AK+       VTV PD LVF KK DKQ+Y L I+ 
Sbjct  557  AA--VAVQRFRRTLTNVGDGAATYKAKIVVTKGSKVTVSPDSLVFGKKYDKQTYTLTIKY  614

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                G  + FGS+ W+E  G H VRSPI 
Sbjct  615  SKDKGGRVSFGSIVWIEQNGVHTVRSPIA  643



>gb|KDP41712.1| hypothetical protein JCGZ_16119 [Jatropha curcas]
Length=732

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 98/150 (65%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L PGLI D + QDY+N++C++ +T N   TI R+  YNCSNPS D+NYPSFIA +  N T
Sbjct  580  LQPGLIYDATPQDYVNILCSMNYTKNQILTITRSIRYNCSNPSSDMNYPSFIALY-NNKT  638

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKL-TPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             S     Q F RT+TN+G+G +TY AKL  P G++ VTV PD LVF KK DKQSY LRI 
Sbjct  639  TS--TVTQSFQRTVTNVGEGAATYKAKLIAPRGSI-VTVSPDTLVFGKKYDKQSYNLRIR  695

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                    + FGS+ W+E  G H VRSPI 
Sbjct  696  YRRDEKGVVSFGSIVWIEENGVHTVRSPIA  725



>ref|XP_003624104.1| Subtilisin-like protease [Medicago truncatula]
Length=1278

 Score =   152 bits (383),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            ++PGLI D + QDY+N +C +KFT N   TI R+SSY C NPSLDLNYPSFIAF+     
Sbjct  620  MNPGLIYDATPQDYVNFLCGLKFTKNQILTITRSSSYGCENPSLDLNYPSFIAFYNKKTR  679

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                + V  F+RT+TN+GDG +TYSA +T      +TV+PD L F  +++KQSY L I+ 
Sbjct  680  ----SMVHTFNRTVTNVGDGAATYSANVTHPKGCVMTVLPDILTFKYRNEKQSYSLVIKC  735

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 D + FG L W+E  G H VRSPIV
Sbjct  736  VMYKKDNVSFGDLVWIEYGGAHTVRSPIV  764


 Score =   143 bits (361),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = -1

Query  661   LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
             ++PGL+ D + QDY+N +C +KFT     TI R+SS+ C N SLDLNYPSFIAF+     
Sbjct  1127  MNPGLVYDCTPQDYVNFLCGLKFTKRQILTITRSSSHGCENTSLDLNYPSFIAFYNKKTR  1186

Query  481   LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 + V  F+RT+TN+GDG +TYSAK+T      V V+P+ L F+ +++KQSY + I+ 
Sbjct  1187  ----SMVHTFNRTVTNVGDGAATYSAKVTQPKGCVVRVLPEILTFSYRNEKQSYYIIIKC  1242

Query  301   PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                   ++ FG L W+E+ G H VRSPIV
Sbjct  1243  DMYKKKYVSFGDLVWIEDGGVHTVRSPIV  1271



>ref|XP_009419397.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=761

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGL+ D  ++DY+NL+CA+ FT    +TI  T++ +CSNP+LDLNYPSFIA+F  N T
Sbjct  602  LEPGLVYDADTKDYVNLLCAMNFTSKQLRTITGTATVDCSNPTLDLNYPSFIAYFDPNET  661

Query  481  LSDPNRVQEFHRTLTNLGDG-ISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI-  308
             +    V++F RT+TN+GD  ++TY AKL  I    V+VVP+KL F +K  KQS+ L + 
Sbjct  662  SASAPSVRQFRRTVTNVGDNPVATYIAKLVDIKGFTVSVVPEKLSFKEKYQKQSFTLTLK  721

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            E      D +  GSLTWV++  K+VVRSPIVA
Sbjct  722  ENTREKKDAVRHGSLTWVDDEEKYVVRSPIVA  753



>ref|XP_010267360.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=772

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D +++DY+ L+CA+ +T    + I R+SS  +CSNP LDLNYPSFIA    ++
Sbjct  613  LDPGLVYDANAEDYVRLLCALNYTKKEIKKITRSSSKADCSNPLLDLNYPSFIAILHEDS  672

Query  484  TLSDPNR--VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            ++   N   V+EF RT+TN+G+G++TY AKL PI    + V PD+LVF +K  K S+KL 
Sbjct  673  SILPLNTKVVKEFSRTVTNVGEGMATYVAKLAPIDGFKLKVKPDRLVFKEKYQKLSFKLT  732

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            ++ P  + +  V G L+W E  GKHVVRSPIVA
Sbjct  733  LKGPRVVENGDVHGYLSWEEVGGKHVVRSPIVA  765



>ref|XP_010093626.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB54387.1| Subtilisin-like protease [Morus notabilis]
Length=724

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            ++PGLI D +++DYI ++C + +T    Q II  S + C + SLDLNYPSF+A+F     
Sbjct  565  VEPGLIYDATAEDYIKVLCGMNYTAKQIQ-IITKSDHKCVDRSLDLNYPSFVAYFNGLGG  623

Query  481  LSDPNRV-QEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             S   +V +EF RT+TN+G+  STY AKL  +  +NV V P+KLVF KK +KQSYKL +E
Sbjct  624  SSPSGKVVREFKRTVTNVGEENSTYKAKLKAMNELNVKVEPEKLVFKKKYEKQSYKLTLE  683

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             P  +      GSL+WVE+ GK+VVRSPI+A
Sbjct  684  GPKLLKAETSLGSLSWVEDTGKYVVRSPILA  714



>emb|CDP01317.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY++++C++ FT    QTI R SSYNCS  S DLNYPSFIA +P N T
Sbjct  334  LDPGLIYDATPQDYVSILCSMNFTQKQIQTITR-SSYNCSKTSSDLNYPSFIALYP-NKT  391

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +     ++F R +TN+GDG +TY  ++T      VTV P+ LVF +K DKQSY L+++ 
Sbjct  392  KNA--LAKKFERIVTNVGDGAATYKVQVTAPKGSGVTVYPEALVFGQKYDKQSYSLKLKY  449

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +     + FGS+ WVE  GKH+VRSPIV
Sbjct  450  KANQNKTVTFGSVIWVEVNGKHIVRSPIV  478



>ref|XP_002284869.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 96/149 (64%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C++ FT     TI R+++Y CSNPS DLNYPSFIA +   +T
Sbjct  626  LDPGLIYDATPQDYVNLLCSMNFTTKQILTITRSNTYTCSNPSPDLNYPSFIALYNNKST  685

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                  VQ+F RT+TN+GDG S+Y A +T      V V P  L F  K +K SY L IE 
Sbjct  686  A----FVQKFQRTVTNVGDGASSYKAIVTAPKGSKVMVSPATLAFENKYEKLSYTLTIEY  741

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     + FGSLTW+E+ GKH VRSPIV
Sbjct  742  KSEKDGKVSFGSLTWIEDDGKHTVRSPIV  770



>emb|CAN60787.1| hypothetical protein VITISV_034533 [Vitis vinifera]
Length=763

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 96/149 (64%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C++ FT     TI R+++Y CSNPS DLNYPSFIA +   +T
Sbjct  611  LDPGLIYDATPQDYVNLLCSMNFTTKQILTITRSNTYTCSNPSPDLNYPSFIALYNNKST  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                  VQ+F RT+TN+GDG S+Y A +T      V V P  L F  K +K SY L IE 
Sbjct  671  A----FVQKFQRTVTNVGDGASSYKAIVTAPKGSKVMVSPATLAFENKYEKLSYTLTIEY  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     + FGSLTW+E+ GKH VRSPIV
Sbjct  727  KSEKDGKVSFGSLTWIEDDGKHTVRSPIV  755



>ref|XP_006434737.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
 gb|ESR47977.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
Length=765

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 98/149 (66%), Gaps = 6/149 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C++ FT N   +I R++ YNCS P+ DLNYPSFI      +T
Sbjct  615  LDPGLIYDATPQDYVNLLCSMNFTQNQILSITRSNRYNCSTPTSDLNYPSFITLHDNTST  674

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
                  VQ FHRT+TN+G   +TY AK+T P+G V ++V PD LVF K+ ++QSY L I 
Sbjct  675  ----KFVQTFHRTVTNVGGSAATYKAKITAPLGTV-ISVSPDTLVFGKQYEQQSYTLTIN  729

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPI  218
              +  G+ + FG L WVE  G H VRSPI
Sbjct  730  YKTDGGEIISFGELVWVEENGNHTVRSPI  758



>ref|XP_003552427.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=764

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 100/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D + QDY+NL+CA+K+T     TI R++SYNC+ PS DLNYPSFIAF+  N  
Sbjct  613  LDPGLVYDATPQDYVNLLCALKYTQKQILTITRSTSYNCAKPSFDLNYPSFIAFYRNNTR  672

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
                + V +F RT+TN+GDG +TY AK+T P G+V VTV P+ L F  K++K SY + I+
Sbjct  673  ----SVVHKFRRTVTNVGDGAATYRAKVTQPKGSV-VTVSPETLTFRYKNEKLSYDVVIK  727

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                    + FG L WVE  G H VRSPIV
Sbjct  728  YSKYKKKNISFGDLVWVEEGGTHSVRSPIV  757



>gb|KHN40450.1| Subtilisin-like protease [Glycine soja]
Length=765

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 100/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D + QDY+NL+CA+K+T     TI R++SYNC+ PS DLNYPSFIAF+  N  
Sbjct  614  LDPGLVYDATPQDYVNLLCALKYTQKQILTITRSTSYNCAKPSFDLNYPSFIAFYRNNTR  673

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
                + V +F RT+TN+GDG +TY AK+T P G+V VTV P+ L F  K++K SY + I+
Sbjct  674  ----SVVHKFRRTVTNVGDGAATYRAKVTQPKGSV-VTVSPETLTFRYKNEKLSYDVVIK  728

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                    + FG L WVE  G H VRSPIV
Sbjct  729  YSKYKKKNISFGDLVWVEEGGTHSVRSPIV  758



>ref|XP_009345959.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=767

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D ++QDYINL+CA+ +T    Q +I  S  NC++ S+ LNYPSFIA+F +  +
Sbjct  610  IDPGLIYDATAQDYINLLCAMNYTSKGIQ-VITGSKNNCTDRSIHLNYPSFIAYFNSEGS  668

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    VQEF RT+TN+G   S+Y+AKL  +  + V V P +LVF KK +K SYK+ +E 
Sbjct  669  NSSAKVVQEFRRTVTNVGGEKSSYTAKLMAMTGLKVKVEPQRLVFKKKYEKLSYKVTLEG  728

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
               + + +V GSL W+++ GK+VVRSPIVA
Sbjct  729  LKLLKEDVVQGSLIWIDDGGKYVVRSPIVA  758



>ref|XP_009621569.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S ++NCSNPS DLNYPSFIA +P   
Sbjct  610  LDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYP---  666

Query  484  TLSDPNRV--QEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
             L  P  +  Q+F RT+TN+G G +TY AKL    N  V+V P  LVF KK++KQSY L 
Sbjct  667  -LEGPFTLLEQKFRRTVTNVGQGAATYKAKLKAPKNSTVSVSPQTLVFKKKNEKQSYTLT  725

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I      G     GS+TWVE  G H VRSPIV
Sbjct  726  IRYLGDEGQSRNVGSITWVEENGNHSVRSPIV  757



>ref|XP_009797476.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=766

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 97/150 (65%), Gaps = 3/150 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S ++NCSNPS DLNYPSFIA +P   
Sbjct  610  LDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEG  669

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
              +     Q+F RT+TN+G G +TY AKL    N  V+V P  LVF KK++KQSY L I 
Sbjct  670  PFTFLE--QKFRRTVTNVGQGAATYKAKLKAPKNTTVSVSPQTLVFKKKNEKQSYTLTIR  727

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 G     GS+TWVE  G H VRSPIV
Sbjct  728  YLGDEGQSRNVGSITWVEENGNHSVRSPIV  757



>gb|ACA64703.1| subtilase [Nicotiana tabacum]
Length=766

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S ++NCSNPS DLNYPSFIA +P   
Sbjct  610  LDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYP---  666

Query  484  TLSDPNRV--QEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
             L  P  +  Q+F RT+TN+G G +TY AKL    N  V+V P  LVF KK++KQSY L 
Sbjct  667  -LEGPFTLLEQKFRRTVTNVGQGAATYKAKLKAPKNSTVSVSPQTLVFKKKNEKQSYTLT  725

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I      G     GS+TWVE  G H VRSPIV
Sbjct  726  IRYLGDEGQSRNVGSITWVEENGNHSVRSPIV  757



>ref|XP_009343175.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=761

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D ++QDYINL+CA+ +T    Q +I  S  NC++ S+ LNYPSFIA+F    +
Sbjct  604  IDPGLIYDATAQDYINLLCAMNYTSKGIQ-VITGSKNNCTDRSIHLNYPSFIAYFNIEGS  662

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    VQEF RT+TN+G   S+Y+AKL  +  + V V P +LVF KK +K SYK+ +E 
Sbjct  663  NSSAKVVQEFRRTVTNVGGEKSSYTAKLMAMTGLKVKVEPQRLVFKKKYEKLSYKVTLEG  722

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
               + + +V GSL W+++ GK+VVRSPIVA
Sbjct  723  SKLLKEDVVQGSLIWIDDGGKYVVRSPIVA  752



>ref|XP_007047286.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91443.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=767

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 104/153 (68%), Gaps = 4/153 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D + +DYI L+CA+ +T    + +   SS+NC + SLDLNYPSFIAFF    +
Sbjct  611  LDPGLVYDAAPEDYIKLLCAMNYTSKQIR-VFANSSHNCLSRSLDLNYPSFIAFFTDEQS  669

Query  481  LSDPNRVQ---EFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
             S+   V+   EF RT+TN+G G   Y+A +T +  + V V P KL+F +  +KQSYKL 
Sbjct  670  TSNQKVVKVVKEFRRTVTNVGKGGMAYTAMVTGMDGIKVMVEPQKLIFKQSYEKQSYKLS  729

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            +E P ++   ++FGSL+WV++ GK++VRSPIVA
Sbjct  730  LEGPKSLKTEVIFGSLSWVDDDGKYMVRSPIVA  762



>ref|XP_011069660.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=762

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 102/149 (68%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DV++QDY+NL+CA+ +T   TQ+IIR S+YNCS+PS DLNYP+F+A +  +  
Sbjct  610  LDPGLIYDVTAQDYVNLVCALNYTREQTQSIIR-STYNCSSPSTDLNYPAFVALY--DPL  666

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                   Q+F RT+TN+G+G +TY  K+    +  +TV P+KLVF KK++KQ + L I  
Sbjct  667  QERTTLTQKFQRTVTNVGNGAATYKVKVKRPKDSVITVSPEKLVFQKKNEKQRFSLTIRY  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     +  GS+TWVE  GKH VRSPIV
Sbjct  727  KSYDEYVINHGSITWVEENGKHNVRSPIV  755



>gb|KDO79191.1| hypothetical protein CISIN_1g004824mg [Citrus sinensis]
Length=728

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D +++DYI L+CA+ + P   + I   SS  C+N SLDLNYPSFI FF    +
Sbjct  572  LDPGLVYDATAEDYIKLLCAMNYKPEQIR-IFTKSSQKCNNRSLDLNYPSFITFFNDYDS  630

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   V+EF RT+TN  +  + Y+AKLT I  + V V P +LVF +K +KQSYKL +E 
Sbjct  631  SSDEKVVKEFWRTVTNAEEVGTAYTAKLTGIDGLKVYVEPRRLVFKQKYEKQSYKLTLEG  690

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  +   +V+GS++WV++ G++ VRSPIVA
Sbjct  691  PKLLEKDVVYGSISWVDDDGRYEVRSPIVA  720



>emb|CBI19501.3| unnamed protein product [Vitis vinifera]
Length=1686

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 96/149 (64%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C++ FT     TI R+++Y CSNPS DLNYPSFIA +   +T
Sbjct  445  LDPGLIYDATPQDYVNLLCSMNFTTKQILTITRSNTYTCSNPSPDLNYPSFIALYNNKST  504

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                  VQ+F RT+TN+GDG S+Y A +T      V V P  L F  K +K SY L IE 
Sbjct  505  ----AFVQKFQRTVTNVGDGASSYKAIVTAPKGSKVMVSPATLAFENKYEKLSYTLTIEY  560

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     + FGSLTW+E+ GKH VRSPIV
Sbjct  561  KSEKDGKVSFGSLTWIEDDGKHTVRSPIV  589


 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 4/149 (3%)
 Frame = -1

Query  661   LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
             LDPGLI D + QDY+NL+C++ FT     TI R+++Y CSN S DLNYPSFIA +   +T
Sbjct  1018  LDPGLIYDATPQDYVNLLCSMNFTTKQILTITRSNTYTCSNSSPDLNYPSFIALYNNKST  1077

Query  481   LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                   VQ+F RT+TN+GD  ++Y A +T      V + P  L F  K +K  Y L I+ 
Sbjct  1078  ----TFVQKFQRTVTNVGDKAASYKAMVTAPKGSKVMISPATLAFENKYEKLDYTLTIKY  1133

Query  301   PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
              S     + FGSLTWVE+ GKH VRSPIV
Sbjct  1134  KSHKDGKVSFGSLTWVEDDGKHTVRSPIV  1162


 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = -1

Query  652   GLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANATLSD  473
             GL+ D + QDY+NL+C++ FT     TI R+++Y C   S DLNYPSFIA +  N   S 
Sbjct  1533  GLVYDATPQDYVNLLCSMNFTKKQILTITRSNTYTCPKTSPDLNYPSFIALYSQNDNKST  1592

Query  472   PNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPST  293
                VQ+F RT+TN+GDG +TY A +       VTV P  LVF KK +KQSY + I+  S 
Sbjct  1593  -TVVQKFQRTVTNVGDGTATYHATVIAPRGSKVTVSPTTLVFEKKYEKQSYTMSIKYKSD  1651

Query  292   MGDFLVFGSLTWVENAGKHVVRSPIV  215
                 + FG LTW+E+ G+H VRSPIV
Sbjct  1652  KDGKISFGWLTWIEDDGEHTVRSPIV  1677



>ref|XP_006425911.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
 gb|ESR39151.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
Length=786

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D +++DYI L+CA+ + P   + I   SS  C+N SLDLNYPSFI FF    +
Sbjct  630  LDPGLVYDATAEDYIKLLCAMNYKPEQIR-IFTKSSQKCNNRSLDLNYPSFITFFNDYDS  688

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             SD   V+EF RT+TN  +  + Y+AKLT I  + V V P +LVF +K +KQSYKL +E 
Sbjct  689  SSDEKVVKEFWRTVTNAEEVGTAYTAKLTGIDGLKVYVEPRRLVFKQKYEKQSYKLTLEG  748

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  +   +V+GS++WV++ G++ VRSPIVA
Sbjct  749  PKLLEKDVVYGSISWVDDDGRYEVRSPIVA  778



>gb|KDO84129.1| hypothetical protein CISIN_1g004265mg [Citrus sinensis]
Length=765

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 98/149 (66%), Gaps = 6/149 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY++L+C++ FT N   +I R++ YNCS P+ DLNYPSFI      +T
Sbjct  615  LDPGLIYDATPQDYVSLLCSMNFTQNQILSITRSNRYNCSTPTSDLNYPSFITLHDNTST  674

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
                  VQ FHRT+TN+G   +TY AK+T P+G V ++V PD LVF K+ ++QSY L I 
Sbjct  675  ----KFVQTFHRTVTNVGGSAATYKAKITAPLGTV-ISVSPDTLVFGKQYEQQSYTLTIN  729

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPI  218
              +  G+ + FG L WVE  G H VRSPI
Sbjct  730  YKTDGGEIISFGELVWVEENGNHTVRSPI  758



>ref|XP_009787984.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S ++NCSNPS DLNYPSFIA +P   
Sbjct  617  LDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEG  676

Query  484  --TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
              TL +    Q+F RT+TN+G G +TY AK+    N  V+V P  L+F KK++KQSY L 
Sbjct  677  PFTLLE----QKFRRTVTNVGKGAATYKAKIKAPKNTTVSVSPQTLMFKKKNEKQSYTLT  732

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I      G     GS+TWVE  G H VRSPIV
Sbjct  733  IRYLGDEGQSRNVGSITWVEENGSHSVRSPIV  764



>emb|CDP01315.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 97/149 (65%), Gaps = 1/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDYIN IC++ FT   T  I R++SYNCSNPS DLNYPSF+A +   + 
Sbjct  609  LDPGLIYDATPQDYINFICSMNFTRMQTLAITRSTSYNCSNPSSDLNYPSFVALY-ETSD  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +    V++F RTLTN+G+G +TY+AK+T      VT+ P  + F KK +KQSY L I  
Sbjct  668  QAKSKLVKKFRRTLTNVGNGAATYTAKVTAPKGSAVTISPKTIKFGKKYEKQSYSLTISY  727

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                   +  GS+TW+E+ G HVV SPIV
Sbjct  728  YGNENQIVSSGSVTWIEDDGNHVVTSPIV  756



>gb|ACA64702.1| subtilase [Nicotiana tabacum]
Length=773

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S ++NCSNPS DLNYPSFIA +P   
Sbjct  617  LDPGLVYDATPQDYLNLLCSLNFTEEQFKTIARSSDNHNCSNPSADLNYPSFIALYPLEG  676

Query  484  --TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
              TL +    Q+F RT+TN+G G +TY AK+    N  V+V P  L+F KK++KQSY L 
Sbjct  677  PFTLLE----QKFRRTVTNVGKGAATYKAKIKAPKNTTVSVSPQTLMFKKKNEKQSYTLT  732

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I      G     GS+TWVE  G H VRSPIV
Sbjct  733  IRYLGDEGQSRNVGSITWVEENGSHSVRSPIV  764



>pdb|3I6S|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3
 pdb|3I6S|B Chain B, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3
 pdb|3I74|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3 In Complex With A Chloromethylketone Inhibitor
 pdb|3I74|B Chain B, Crystal Structure Of The Plant Subtilisin-Like Protease 
Sbt3 In Complex With A Chloromethylketone Inhibitor
Length=649

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFF--PA  491
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S S+NCSNPS DLNYPSFIA +    
Sbjct  494  LDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSASHNCSNPSADLNYPSFIALYSIEG  553

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N TL +    Q+F RT+TN+G G +TY AKL    N  ++V P  LVF  K++KQSY L 
Sbjct  554  NFTLLE----QKFKRTVTNVGKGAATYKAKLKAPKNSTISVSPQILVFKNKNEKQSYTLT  609

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I      G     GS+TWVE  G H VRSPIV
Sbjct  610  IRYIGDEGQSRNVGSITWVEQNGNHSVRSPIV  641



>ref|XP_004229665.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS--YNCSNPSLDLNYPSFIAFFPAN  488
            LDPGLI D + QDYINLIC++ FT    +T  R+S+  +NCSNPS DLNYPSFIA +P +
Sbjct  616  LDPGLIYDATPQDYINLICSLNFTEEQFKTFARSSANYHNCSNPSADLNYPSFIALYPFS  675

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G +TY  K+    N  ++V P  LVF  K+DKQSY L I
Sbjct  676  IERNYTWLEQKFRRTLTNVGKGEATYKVKIETPKNSTISVSPRTLVFKGKNDKQSYSLTI  735

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                       FGS+TWVE  G H VRSPIV
Sbjct  736  RYIGDSDQSTNFGSITWVEEKGNHSVRSPIV  766



>gb|EYU36350.1| hypothetical protein MIMGU_mgv1a001799mg [Erythranthe guttata]
Length=757

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D + QDY+NL+C++ FT N   TI R SSY CSNPS DLNYPSFIA +  N T
Sbjct  604  LDPGLVYDAAPQDYVNLLCSMNFTSNQIATITR-SSYKCSNPSSDLNYPSFIALYATNQT  662

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                  V++F RT+TN+G    +Y  ++       V+V P  LVF KK +KQSY + +E 
Sbjct  663  TG--GLVRKFERTVTNVGGDSGSYKVQVIAPSGSKVSVDPSNLVFGKKYEKQSYSVTVEY  720

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                   + FGS+TWVE+ GKH VRSPIV
Sbjct  721  NGDKSGGVTFGSITWVEDNGKHTVRSPIV  749



>gb|KEH23384.1| subtilisin-like serine protease [Medicago truncatula]
Length=515

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            ++PGL+ D + QDY+N +C +KFT     TI R+SS+ C N SLDLNYPSFIAF+     
Sbjct  364  MNPGLVYDCTPQDYVNFLCGLKFTKRQILTITRSSSHGCENTSLDLNYPSFIAFYNKKTR  423

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                + V  F+RT+TN+GDG +TYSAK+T      V V+P+ L F+ +++KQSY + I+ 
Sbjct  424  ----SMVHTFNRTVTNVGDGAATYSAKVTQPKGCVVRVLPEILTFSYRNEKQSYYIIIKC  479

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                  ++ FG L W+E+ G H VRSPIV
Sbjct  480  DMYKKKYVSFGDLVWIEDGGVHTVRSPIV  508



>gb|EYU25438.1| hypothetical protein MIMGU_mgv1a001996mg [Erythranthe guttata]
Length=729

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 101/150 (67%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+CA+ +T   T+TIIR S+YNCSNPSLDLNYP+F+A +     
Sbjct  576  LDPGLIYDATPQDYVNLVCALNYTREQTRTIIR-SNYNCSNPSLDLNYPAFVALYDPLEE  634

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
            +S   + + F RT+TN+GDG +TY   +    +  +TV P+KLVF KK+ K S+ L I  
Sbjct  635  VS--TKTRRFRRTVTNVGDGAATYKVSVKRPKDSVITVSPEKLVFQKKNQKLSFSLTISY  692

Query  301  PSTMGDFLV-FGSLTWVENAGKHVVRSPIV  215
              T  D+++  GS+ W E  GKH VRSPIV
Sbjct  693  -KTYRDYVINHGSIIWAEEKGKHTVRSPIV  721



>ref|XP_006466594.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=786

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D +++DYI L+CA+ + P   + I   SS  C++ SLDLNYPSFI FF    +
Sbjct  630  LDPGLVYDATAEDYIKLLCAMNYKPEQIR-IFTKSSQECNDLSLDLNYPSFITFFNDYDS  688

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S    V+EF RT+TN  +  + Y+AKLT I  + V V P +LVF +K +KQSYKL +E 
Sbjct  689  SSAEKVVKEFWRTVTNAEEVGTAYTAKLTGIDGLKVYVEPQRLVFKQKYEKQSYKLTLEG  748

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            P  +   +V+GS++WV++ G++VVRSPIVA
Sbjct  749  PKLLEKEVVYGSISWVDDDGRYVVRSPIVA  778



>ref|NP_001234774.1| subtilisin-like protease precursor [Solanum lycopersicum]
 emb|CAA06997.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA07001.1| subtilisin-like protease [Solanum lycopersicum]
Length=761

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFF--PA  491
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S S+NCSNPS DLNYPSFIA +    
Sbjct  606  LDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSASHNCSNPSADLNYPSFIALYSIEG  665

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N TL +    Q+F RT+TN+G G +TY AKL    N  ++V P  LVF  K++KQSY L 
Sbjct  666  NFTLLE----QKFKRTVTNVGKGAATYKAKLKAPKNSTISVSPQILVFKNKNEKQSYTLT  721

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I      G     GS+TWVE  G H VRSPIV
Sbjct  722  IRYIGDEGQSRNVGSITWVEQNGNHSVRSPIV  753



>ref|XP_006345401.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=761

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFF--PA  491
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S+ +NCSNPS DLNYPSFIA +    
Sbjct  606  LDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSANHNCSNPSADLNYPSFIALYSIEG  665

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N TL +    Q+F RT+TN+G G +TY AKL    N  ++V P  LVF  K++KQSY L 
Sbjct  666  NFTLLE----QKFKRTVTNVGKGAATYKAKLKAPKNSTISVSPQTLVFKNKNEKQSYTLT  721

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I      G     GS+TWVE  G H VRSPIV
Sbjct  722  IRYIGDEGQSRNVGSITWVEQNGNHSVRSPIV  753



>ref|XP_007139760.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
 gb|ESW11754.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
Length=765

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 101/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+CA+ +T     TI R+SSYNC+ PS DLNYPSFIAF+ +N T
Sbjct  614  LDPGLIYDATPQDYVNLLCALHYTQKQILTITRSSSYNCAKPSFDLNYPSFIAFY-SNKT  672

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             S    VQ+F RT+TN+GDG + Y  K T P G+V VTV P+ L F  K++K SY + I+
Sbjct  673  RS---VVQKFKRTVTNVGDGGAIYRVKTTQPNGSV-VTVSPETLAFRYKNEKLSYDVMIK  728

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                  + + +G L W+E+ G H VRSPIV
Sbjct  729  YRKYKKENISYGDLVWIEDGGAHSVRSPIV  758



>ref|XP_006345406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 96/151 (64%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSLDLNYPSFIAFFPAN  488
            LDPGLI D + QDYINLIC++ FT    +T  R+S+   NCSNPS DLNYPSFIA +P +
Sbjct  616  LDPGLIYDATPQDYINLICSLNFTEEQFKTFARSSANYNNCSNPSADLNYPSFIALYPFS  675

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G +TY+ K+    N  ++V P  LVF  K+DKQSY L I
Sbjct  676  IERNYTWLEQKFRRTLTNVGKGGATYNVKIETPKNSTISVSPRTLVFKGKNDKQSYSLTI  735

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            +          FGS+TWVE  G H VRSP+V
Sbjct  736  QYIGDSDQSTNFGSITWVEEKGNHSVRSPVV  766



>gb|EYU19442.1| hypothetical protein MIMGU_mgv1a001731mg [Erythranthe guttata]
Length=768

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 97/151 (64%), Gaps = 6/151 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D ++QD +NL+C++ FT   TQTI+R+++YNCSNPS DLNYPSF+A       
Sbjct  613  LDPGLIYDATTQDLVNLVCSMNFTSEQTQTIVRSTNYNCSNPSSDLNYPSFVALI----N  668

Query  481  LSDPNRV--QEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
              D  RV  + F RT+TN+GD  + Y  K+    N  V V P  LVF KK++KQSY + I
Sbjct  669  FEDIGRVLTRRFERTVTNVGDAAAKYRVKVEAPVNTTVRVRPQTLVFQKKNEKQSYTVTI  728

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 +      GSLTW+E +GK+ VRSPI+
Sbjct  729  RYNGDIETQHRPGSLTWIEQSGKYTVRSPIM  759



>gb|KHN15887.1| Subtilisin-like protease [Glycine soja]
Length=716

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 100/150 (67%), Gaps = 7/150 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ +T  +   I   SS +CS PSLDLNYPSFI    A   
Sbjct  565  LDPGLVYDVGVQDYVNLLCALGYTQKNITVITGNSSNDCSKPSLDLNYPSFI----AFFN  620

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +  +  QEF RT+TN+G+G + Y A +TP+    V+V+P+KLVF +K++K SYKLRIE 
Sbjct  621  SNSSSTSQEFQRTVTNVGEGQTIYVASVTPVKGYYVSVIPNKLVFKEKNEKLSYKLRIEG  680

Query  301  PSTMG-DFLVFGSLTWVENAGKHVVRSPIV  215
            P+    + + FG  TW +   KHVVRSPIV
Sbjct  681  PTNKKVENVAFGYFTWTDV--KHVVRSPIV  708



>gb|AAY63882.1| subtilisin-like serine protease [Solanum tuberosum]
Length=656

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+   NCSNPS DLNYPSFIA +P +
Sbjct  498  LDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYDNCSNPSADLNYPSFIALYPFS  557

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G ++Y  K+    N  V+V P  LVF +K+DKQSY L I
Sbjct  558  LEGNFTWLEQKFRRTLTNVGKGGASYKVKIETPKNSTVSVSPRTLVFKEKNDKQSYNLTI  617

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                       FGS+TW+E  G H VRSPIV
Sbjct  618  RYIGDSDQSRNFGSITWIEQNGNHTVRSPIV  648



>ref|XP_004492811.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            ++PGLI D + QDY+NL+C + +T     +I R+S YNC NPSLDLNYPSFIAFF    +
Sbjct  608  MNPGLIYDATPQDYVNLLCGLNYTKEQILSITRSSHYNCDNPSLDLNYPSFIAFFSNKTS  667

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
            L+     Q+F RT+TN+GDG ++Y  K+T      VTV PD L F+  ++K+SY + I+ 
Sbjct  668  LTG----QKFKRTVTNVGDGGASYRVKVTQPKGYVVTVSPDILDFSYGNEKKSYYVFIKC  723

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 + + FG L W+E+ GKH VRSPIV
Sbjct  724  VVYNEENVSFGDLVWIEDGGKHSVRSPIV  752



>gb|KJB43733.1| hypothetical protein B456_007G214100 [Gossypium raimondii]
Length=758

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 103/151 (68%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D + +DY+ L+CA+ +T    +   + S ++C N SLDLNYP+FIAFF  +  
Sbjct  603  LDPGLVYDATPEDYMKLLCAMNYTSKKIRMFTKLS-HDCMNRSLDLNYPTFIAFFNDDGL  661

Query  481  LSDPNRV-QEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             +  ++  QEF RT+TN+G     Y+AK+T +  + V V P KLVF +K +KQSYKLR+E
Sbjct  662  STSADKFEQEFQRTVTNVGKEGMAYTAKVTGMDGIKVVVEPPKLVFKQKYEKQSYKLRLE  721

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             P  +   ++FG+L+W ++AGK++V SPI+A
Sbjct  722  GPKLLKKDVIFGALSWRDDAGKYMVTSPIMA  752



>ref|XP_010320327.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=757

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 96/151 (64%), Gaps = 7/151 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFF--PAN  488
            L+PGLI D + QDYINL+CA+KFT     TI R+S+Y C N S DLNYPSFIA +     
Sbjct  604  LNPGLIYDATPQDYINLLCAMKFTRKQILTITRSSTYTCQNASSDLNYPSFIALYTNETG  663

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
            ATLS     Q+F RT+TN+GDG + YS  +T   N N++V P  L F+ K DK SY L +
Sbjct  664  ATLS-----QKFIRTVTNVGDGPANYSINMTVPSNTNISVYPSTLSFSSKYDKLSYTLTV  718

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            E        +VFGS+TWV+  G H V SPIV
Sbjct  719  EYSGNRTGEIVFGSITWVDVLGLHAVTSPIV  749



>emb|CAA07059.1| SBT4B protein [Solanum lycopersicum]
Length=777

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+   NCSNPS DLNYPSFIA +P +
Sbjct  615  LDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYNNCSNPSADLNYPSFIALYPFS  674

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G +TY  K+    N  V+V P  LVF  K+DKQSY L I
Sbjct  675  LEGNFTWLEQKFRRTLTNVGKGGATYKVKIETPKNSTVSVSPRTLVFKGKNDKQSYNLTI  734

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                       FGS+TWVE  G H VRSPIV
Sbjct  735  RYIGDSDQSKNFGSITWVEENGNHTVRSPIV  765



>emb|CDP01316.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 97/149 (65%), Gaps = 5/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D ++QDY+ L+C++ +T    +TI R SSYNCS  S DLNYPSF++ + +   
Sbjct  606  LDPGLIYDATAQDYMELLCSINYTRKQIRTITR-SSYNCSKASSDLNYPSFVSLYTSGTN  664

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S     Q F R +TN+GDG +TY AK+TP     VTV P+ LVF KK +K+SY L I  
Sbjct  665  AS----TQNFKRIVTNVGDGAATYKAKVTPPEGSVVTVFPETLVFRKKYEKRSYSLTIHT  720

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 + + +G++ WVE+ GKH VRSPIV
Sbjct  721  KIDENNQVTYGAVIWVEDNGKHSVRSPIV  749



>gb|ABN05870.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
Length=511

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 95/149 (64%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L  GL+ D + QDY+N +C +KFT     TI R+SS+ C N SLDLNYPSFIAF+     
Sbjct  360  LGNGLVYDCTPQDYVNFLCGLKFTKRQILTITRSSSHGCENTSLDLNYPSFIAFYNKKTR  419

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                + V  F+RT+TN+GDG +TYSAK+T      V V+P+ L F+ +++KQSY + I+ 
Sbjct  420  ----SMVHTFNRTVTNVGDGAATYSAKVTQPKGCVVRVLPEILTFSYRNEKQSYYIIIKC  475

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                  ++ FG L W+E+ G H VRSPIV
Sbjct  476  DMYKKKYVSFGDLVWIEDGGVHTVRSPIV  504



>ref|XP_010687642.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 102/150 (68%), Gaps = 4/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D++ QDY+NLIC++ FT N   +IIR++ +NCS  S DLNYPSFIA++  ++T
Sbjct  625  LDPGLVYDLTPQDYMNLICSMNFTRNQMLSIIRSNKHNCSASSSDLNYPSFIAYYNYDST  684

Query  481  LSDPNRVQEFHRTLTNLG-DGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             +       F+RT+TN+G DG + Y A +T      V V P  LVF ++++KQSY+LRI+
Sbjct  685  KT---AAMTFYRTVTNVGKDGFTAYKAVVTAPKGARVRVHPRTLVFNRRNEKQSYQLRIK  741

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
              S     + FGS+ W+EN G+H VRSPIV
Sbjct  742  YKSVDKLGISFGSIVWMENNGQHSVRSPIV  771



>gb|EPS63009.1| subtilisin-like protease preproenzyme [Genlisea aurea]
Length=716

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 97/149 (65%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D  ++DYINL+C + FT    +TI R+   +CS PSLDLNYPSFIA+F  N  
Sbjct  568  LNPGLIYDAGTEDYINLLCGLNFTARQIKTIARSKPRSCSKPSLDLNYPSFIAYFDGNG-  626

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                  V+ F RT+TN+GD  S Y A+L+    VN+TV P++L F +K  K+ + +RIE 
Sbjct  627  --GGKTVKAFRRTVTNVGDVDSVYVARLSKFNGVNLTVSPERLEFDEKHRKRRFTVRIEG  684

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 + +++G LTWV+  GK+ V++PIV
Sbjct  685  RKRSINSVIYGYLTWVDTNGKYTVKTPIV  713



>gb|EYU45081.1| hypothetical protein MIMGU_mgv1a002217mg [Erythranthe guttata]
Length=700

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 12/152 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGL+ D SS+DY+N +CA+ FT N  QTI R+   +C+NPSLDLNYPSFI F  AN T
Sbjct  556  LNPGLVYDTSSEDYVNFLCAMNFTKNQIQTITRSVISSCTNPSLDLNYPSFITFSDANGT  615

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPI-GNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
                N V+EF RT+T +G G S Y+A+++     ++V V PD + F +K +K+++ L IE
Sbjct  616  ----NSVREFRRTVTYVGQGSSVYTARISEFYEGLSVRVSPDTIEFKRKFEKKNFTLTIE  671

Query  304  APSTMGDFL--VFGSLTWVENAGKHVVRSPIV  215
                 G  +   FGSL+WVE+ GK VVRSPIV
Sbjct  672  -----GKMMNKTFGSLSWVESKGKIVVRSPIV  698



>ref|XP_011074394.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=761

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 99/154 (64%), Gaps = 12/154 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D S QD +NL+C++ FT   TQTIIR SSYNCS PS +LNYPSFIA +  N+ 
Sbjct  607  LDPGLVYDASQQDLVNLVCSMNFTLEQTQTIIR-SSYNCSTPSSNLNYPSFIAIY--NSP  663

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI--  308
                   + F RTLTN+GDG +TY  KL    N  + + P  LVF KK +KQSY L I  
Sbjct  664  DQGRTLTRRFQRTLTNVGDGAATYRVKLEKPKNTKIQIRPQILVFKKKYEKQSYSLTITF  723

Query  307  EAPSTMGDFLVF---GSLTWVENAGKHVVRSPIV  215
            +AP    DF      GS+TW++N GK+ VRSPI+
Sbjct  724  KAP----DFTTGAPDGSITWIDNRGKYSVRSPIM  753



>ref|XP_011074393.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=767

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 97/151 (64%), Gaps = 7/151 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI DVS QD +NL+C++ FT   TQTIIR SS+NCS PS DLNYPSF+A F    +
Sbjct  613  LDPGLIYDVSHQDLVNLVCSMNFTREQTQTIIR-SSHNCSTPSADLNYPSFVALF----S  667

Query  481  LSDPNR--VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
             ++  R   + F RT+TN+GDG + Y  KL    N  V + P  LVF KK +K+SY L I
Sbjct  668  FAERGRTLTRRFQRTVTNVGDGAARYRVKLETPENTTVRIQPQTLVFQKKYEKKSYVLTI  727

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
               + +      GSLTW+E  GK+ VRSPI+
Sbjct  728  RYKADIETQNRDGSLTWIEENGKYRVRSPIM  758



>ref|XP_009771925.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=781

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS--YNCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+  +NCSNPS DLNYPSFIA +P +
Sbjct  619  LDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYHNCSNPSADLNYPSFIALYPFS  678

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G +TY  K+    N  V++ P  LVF KK++KQSY L I
Sbjct  679  LEGNFTWLEQKFRRTLTNVGKGGATYKVKIETPKNSTVSMSPKTLVFKKKNEKQSYTLTI  738

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                        GS+TWVE  G H VRSPIV
Sbjct  739  RYIGDENQSRNVGSITWVEENGNHSVRSPIV  769



>ref|XP_003548400.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 100/150 (67%), Gaps = 7/150 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ +T  +   I   SS +CS PSLDLNYPSFI    A   
Sbjct  602  LDPGLVYDVGVQDYVNLLCALGYTQKNITVITGNSSNDCSKPSLDLNYPSFI----AFFN  657

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +  +  QEF RT+TN+G+G + Y A +TP+    V+V+P+KLVF +K++K SYKLRIE 
Sbjct  658  SNSSSASQEFQRTVTNVGEGQTIYVASVTPVKGYYVSVIPNKLVFKEKNEKLSYKLRIEG  717

Query  301  PSTMG-DFLVFGSLTWVENAGKHVVRSPIV  215
            P+    + + FG  TW +   KHVVRSPIV
Sbjct  718  PTNKKVENVAFGYFTWTDV--KHVVRSPIV  745



>ref|XP_004229664.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=781

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS--YNCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+   NCSNPS DLNYPSFIA +P +
Sbjct  619  LDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYENCSNPSADLNYPSFIALYPYS  678

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G + Y  K+    N  V+V P  LVF  K+D+QSY L I
Sbjct  679  LEGNFTWLEQKFRRTLTNVGKGGAIYKVKIETPKNSTVSVSPQTLVFKGKNDRQSYNLTI  738

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                       FGS+TWVE  G H VRSPIV
Sbjct  739  RYIGDSDQGRNFGSITWVEENGNHTVRSPIV  769



>ref|NP_001234780.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA06998.1| subtilisin-like protease [Solanum lycopersicum]
Length=779

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 97/153 (63%), Gaps = 7/153 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS--YNCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+  +NCSNPS DLNYPSFIAF+  +
Sbjct  618  LDPGLVYDATPQDYINLICSLNFTEEQFKTFARSSANYHNCSNPSADLNYPSFIAFYSYS  677

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               + P   Q+F RTLTN+G G +TY  K+    N  ++V P  LVF  K++KQSY L I
Sbjct  678  QEGNYPWLEQKFRRTLTNVGKGGATYKVKIESPKNSTISVSPQTLVFKNKNEKQSYTLTI  737

Query  307  EAPSTMGDF--LVFGSLTWVENAGKHVVRSPIV  215
                  GDF     GS+TWVE  G   VRSPIV
Sbjct  738  R---YRGDFNSGQTGSITWVEKNGNRSVRSPIV  767



>ref|XP_006345400.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+   NCSNPS DLNYPSFIA +P +
Sbjct  615  LDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYDNCSNPSADLNYPSFIALYPFS  674

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN G G +TY  K+    N  V+V P  LVF +K+DKQSY L I
Sbjct  675  LEGNFTWLEQKFRRTLTNAGKGRATYKVKIETPKNSTVSVSPRTLVFKEKNDKQSYTLSI  734

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                        GS+TWVE  G H VRSPIV
Sbjct  735  RYIGDSDQSRNVGSITWVEENGNHSVRSPIV  765



>ref|XP_006345402.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=760

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 10/152 (7%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFF--PA  491
            LDPGL+ D + QDY+NL+C++ FT    +TI R+S+ +NCS+PS DLNYPSFIA +    
Sbjct  608  LDPGLVYDATPQDYVNLLCSMNFTEEQFKTIARSSANHNCSDPSADLNYPSFIALYSNEG  667

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N T  +    Q+F RT+TN+G G +TY AK+    N  V+V P  LV+  K++KQSY L 
Sbjct  668  NYTWLE----QKFRRTVTNVGQGAATYKAKIKAPKNSKVSVSPQTLVYKNKNEKQSYTLT  723

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I     +G    +GS+TWVE  G H VRSPIV
Sbjct  724  IR---YIGPNWNYGSITWVEEHGNHTVRSPIV  752



>gb|KHN06360.1| Subtilisin-like protease [Glycine soja]
Length=902

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ FT  +   I R+SS NCSNPSLDLNYPSFIAF+  NA+
Sbjct  570  LDPGLVYDVQVQDYVNLLCALNFTQQNITIITRSSSNNCSNPSLDLNYPSFIAFYSGNAS  629

Query  481  LSDPNRVQ--EFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
             +  +RV   EF RT+TN+G+G +TY+A +T I   NV+V+P KL F KKS++ SYKLRI
Sbjct  630  SNHESRVNNWEFQRTVTNVGEGRTTYTASVTFIKGFNVSVIPGKLAFKKKSERLSYKLRI  689

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPI  218
            E P   G    FG LTW +   KHV   P 
Sbjct  690  EGPRIEG----FGHLTWTDM--KHVGTRPF  713



>ref|XP_007139763.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
 gb|ESW11757.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
Length=739

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 100/150 (67%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+CA+ +T      + R+ SYNC+ PS DLNYPSFIA + +N T
Sbjct  588  LDPGLIYDATPQDYVNLLCALNYTLKQILALTRSGSYNCAKPSFDLNYPSFIAIY-SNKT  646

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
            +S    V +F RT+TN+G G +TY AK+T P G+V VTV P+ L F  K++K SY + I+
Sbjct  647  MS---VVHKFRRTVTNVGVGAATYRAKVTQPKGSV-VTVSPETLAFRYKNEKLSYDVMIK  702

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                  + + +G L W+E+ G H VRSPIV
Sbjct  703  YRKYKKEDISYGDLIWIEDGGAHRVRSPIV  732



>ref|XP_011069661.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 94/149 (63%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY++L+C++ FT   TQTI+R SSYNCS PS DLNYPSFI  +    T
Sbjct  632  LDPGLIYDATMQDYVDLVCSMNFTTAQTQTILR-SSYNCSTPSSDLNYPSFIVLYETQET  690

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +   R  +F RTLTN+G+G + Y  K+       + V P  L+FT+K +KQSY L I  
Sbjct  691  TTTSTR--KFRRTLTNVGNGPAAYKVKVEEPNGSTIAVSPQTLMFTRKDEKQSYSLTIRY  748

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
              +    L  GS+TW+E  G H VRSPIV
Sbjct  749  TISSEFVLAPGSITWIEENGNHTVRSPIV  777



>ref|XP_006345405.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=779

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 96/153 (63%), Gaps = 7/153 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+   NCSNPS DLNYPSFIAF+  +
Sbjct  618  LDPGLVYDATPQDYINLICSLNFTEEQFKTFARSSTNYDNCSNPSADLNYPSFIAFYSDS  677

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL--  314
               + P   Q+F RTLTN+G G +TY  K+    N  ++V P  LVF  K++KQSY L  
Sbjct  678  QEGNYPWLEQKFKRTLTNVGKGGATYRVKIENPRNSTISVSPQTLVFMNKNEKQSYTLTI  737

Query  313  RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            R   P   G     GS+TWVE  G H VRSPIV
Sbjct  738  RYRGPFNSGQ---DGSITWVEKNGNHSVRSPIV  767



>ref|XP_010112176.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32842.1| Subtilisin-like protease [Morus notabilis]
Length=344

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 91/149 (61%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C+  FT      II T+ Y+C     DLNYPSFIA +  +A 
Sbjct  193  LDPGLIYDATPQDYVNLLCSTNFTKKQILAIINTNKYDCPRAYYDLNYPSFIALYHDHAK  252

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D    Q++ RTLTN+G+ + TY A +T      V V P+ LVF KK +++SY L I+ 
Sbjct  253  WMD----QKYTRTLTNVGESVVTYKAMVTAPNFSEVVVSPNVLVFMKKHERKSYNLTIKY  308

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
               M   +  GSL WVE+ GKH VRSPIV
Sbjct  309  KGNMERRVSSGSLVWVEDNGKHTVRSPIV  337



>ref|XP_007017194.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14419.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=793

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 91/149 (61%), Gaps = 3/149 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C + FT +   TI R+ SYNCSNPS DLNYPSFIA +  N T
Sbjct  611  LDPGLIYDATPQDYVNLLCTMNFTRSQILTITRSKSYNCSNPSSDLNYPSFIALYNPNVT  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                   + F RT+TN+G+G +TY+ K+       + V P+ LVF    +KQ + + I  
Sbjct  671  ---ETVAKIFRRTVTNMGEGAATYNVKIVQPEGSTIVVSPETLVFKNTYEKQIFSVTISY  727

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     + FG L WVE  GKH VRSP+V
Sbjct  728  SSHKKGRVSFGELVWVEENGKHTVRSPVV  756



>ref|XP_002284864.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=763

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C++ FT     TI R+++Y CSN S DLNYPSFIA +   +T
Sbjct  611  LDPGLIYDATPQDYVNLLCSMNFTTKQILTITRSNTYTCSNSSPDLNYPSFIALYNNKST  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                  VQ+F RT+TN+GD  ++Y A +T      V + P  L F  K +K  Y L I+ 
Sbjct  671  ----TFVQKFQRTVTNVGDKAASYKAMVTAPKGSKVMISPATLAFENKYEKLDYTLTIKY  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S     + FGSLTWVE+ GKH VRSPIV
Sbjct  727  KSHKDGKVSFGSLTWVEDDGKHTVRSPIV  755



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D + QD +NL+C++ FT   TQTI+++++YNCSNPS DLNYPSF+A   +   
Sbjct  579  LNPGLIYDANIQDLVNLVCSMNFTRKQTQTIVKSTNYNCSNPSSDLNYPSFVALTHS---  635

Query  481  LSDPNR--VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
             +D  R   + F RT+TN+GDG + Y  K+    N  V V P  LVF KK++K SY ++I
Sbjct  636  -ADIGRFVTRRFKRTVTNVGDGAAKYRVKVEVPANTTVRVRPHTLVFQKKNEKLSYIVKI  694

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
               + +      GSLTW+E +GK+ VRSPI+
Sbjct  695  RYNADIDTLHRAGSLTWIEQSGKYTVRSPIM  725



>ref|XP_009595146.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=781

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+   NCS+PS DLNYPSFIA +P +
Sbjct  619  LDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYNNCSSPSADLNYPSFIALYPFS  678

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G +TY  K+    N  V+V P  LVF KK++KQSY L I
Sbjct  679  LEGNFTWLKQKFRRTLTNVGKGGTTYKVKIETPKNSTVSVSPKTLVFKKKNEKQSYTLTI  738

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                        GS+TWVE  G H VRSPIV
Sbjct  739  RYIGDENQSRNVGSITWVEENGNHSVRSPIV  769



>gb|AES61117.2| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C   +T + T TI R+  YNC NPS DLNYPSFIA + AN T
Sbjct  612  LDPGLIYDATPQDYVNLLCDFGYTHSQTLTITRSKKYNCDNPSSDLNYPSFIALY-ANKT  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S     Q+F RT+TN+GDG ++Y+ K+T      VTVVP+KL F+ K++KQSY L ++ 
Sbjct  671  RSIE---QKFVRTVTNVGDGAASYNVKVTKPKGCVVTVVPEKLEFSVKNEKQSYSLVVKY  727

Query  301  PSTMGDFL--VFGSLTWVEN-AGKHVVRSPIV  215
                   L  +FG + WVE   G H VRSPIV
Sbjct  728  KRKNKKELNVLFGDIVWVEQGGGAHNVRSPIV  759



>gb|ACL52543.1| unknown [Zea mays]
Length=500

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 103/161 (64%), Gaps = 19/161 (12%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTII----RTSSY--NCSNPSLDLNYPSFIAF  500
            +DPGL+ D + +DY+ L+CA+ +T    +T++     +SSY  +C+  SLDLNYPSFIAF
Sbjct  340  VDPGLVYDAAPEDYVKLMCAMNYTAAQIRTVVAQSPSSSSYAVDCTGASLDLNYPSFIAF  399

Query  499  FPANATLSDPNR---VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDK  329
            F       DPN     + F RT+TN+GDG ++YS K+  +  + V V PDKL F  K++K
Sbjct  400  F-------DPNGGSVERTFTRTVTNVGDGPASYSVKVLGLSGLTVIVSPDKLAFGGKNEK  452

Query  328  QSYKLRIEAPST--MGDFLVFGSLTWVENAGKHVVRSPIVA  212
            Q Y L I    T   GD L  GSLTWV++AGK+ VRSPIVA
Sbjct  453  QKYTLVIRGKMTNKSGDVL-HGSLTWVDDAGKYTVRSPIVA  492



>ref|XP_003590866.1| Subtilisin-like protease [Medicago truncatula]
Length=752

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C   +T + T TI R+  YNC NPS DLNYPSFIA + AN T
Sbjct  598  LDPGLIYDATPQDYVNLLCDFGYTHSQTLTITRSKKYNCDNPSSDLNYPSFIALY-ANKT  656

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S     Q+F RT+TN+GDG ++Y+ K+T      VTVVP+KL F+ K++KQSY L ++ 
Sbjct  657  RSIE---QKFVRTVTNVGDGAASYNVKVTKPKGCVVTVVPEKLEFSVKNEKQSYSLVVKY  713

Query  301  PSTMGDFL--VFGSLTWVEN-AGKHVVRSPIV  215
                   L  +FG + WVE   G H VRSPIV
Sbjct  714  KRKNKKELNVLFGDIVWVEQGGGAHNVRSPIV  745



>ref|XP_010540359.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L PGL+ D ++QDYINL+CA+  TP     +  +SS +CS+PSLDLNYPSFIAFF  N T
Sbjct  607  LKPGLVYDATTQDYINLMCAMNLTPKQINVVTGSSSPDCSSPSLDLNYPSFIAFFDGNNT  666

Query  481  --LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
                D +  + F RT+TN+G+G + Y AK+T I    V V P+KLVF +K +K+S+++RI
Sbjct  667  KKTEDSSVEKVFKRTVTNVGEGAARYEAKVTAIEGFKVEVKPEKLVFAEKKEKKSFEVRI  726

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            E P  M    +FG L W +  GK++VRSPIV
Sbjct  727  EGPRFMEVDKLFGFLIWEDEEGKYMVRSPIV  757



>gb|AFW81832.1| putative subtilase family protein [Zea mays]
Length=500

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 103/161 (64%), Gaps = 19/161 (12%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTII----RTSSY--NCSNPSLDLNYPSFIAF  500
            +DPGL+ D + +DY+ L+CA+ +T    +T++     +SSY  +C+  SLDLNYPSFIAF
Sbjct  340  VDPGLVYDAAPEDYVKLMCAMNYTAAQIRTVVAQSPSSSSYAVDCTGASLDLNYPSFIAF  399

Query  499  FPANATLSDPNR---VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDK  329
            F       DPN     + F RT+TN+GDG ++YS K+  +  + V V PDKL F  K++K
Sbjct  400  F-------DPNGGSVERTFTRTVTNVGDGPASYSVKVLGLSGLTVIVSPDKLAFGGKNEK  452

Query  328  QSYKLRIEAPST--MGDFLVFGSLTWVENAGKHVVRSPIVA  212
            Q Y L I    T   GD L  GSLTWV++AGK+ VRSPIVA
Sbjct  453  QKYTLVIRGKMTNKSGDVL-HGSLTWVDDAGKYTVRSPIVA  492



>gb|KHN04972.1| Subtilisin-like protease [Glycine soja]
Length=454

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 7/151 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCS-NPSLDLNYPSFIAFFPANA  485
            LDPGLI D + Q+Y+NL+CA+ +T N   +I R+ SY CS NPS DLNYPSFI  + +N 
Sbjct  302  LDPGLIYDATPQNYVNLLCALGYTNNQILSITRSRSYECSANPSSDLNYPSFIVLY-SNK  360

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
            T S    V+EF R +TN+GDG +TY  K+T P G+V V V P+ L F  K++KQSY + +
Sbjct  361  TRST---VREFRRIVTNVGDGAATYKVKVTQPKGSV-VKVSPETLAFGYKNEKQSYSVTV  416

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            +      + + FG + WVE+ G   VRSPIV
Sbjct  417  KYTRNKKENISFGDIVWVEDGGARTVRSPIV  447



>ref|XP_002510194.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52381.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 98/150 (65%), Gaps = 3/150 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D + QDY+NL+C++ +T     TI R++SYNC++ S  LNYPSFIA +  N T
Sbjct  611  LNPGLIYDATPQDYVNLLCSMNYTKKQILTITRSNSYNCTSSSSGLNYPSFIALYD-NKT  669

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAK-LTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             +     ++F RT+TN+G+G + Y+AK + P+G   VTV P+ LVF KK DKQSY+L I 
Sbjct  670  SAGVTLTRKFRRTVTNVGEGAAIYNAKVIAPLG-ATVTVWPETLVFGKKHDKQSYRLTIY  728

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
              +     + FGS+ W E  G H VRSPI 
Sbjct  729  YGADKKGKVSFGSIVWTEENGVHTVRSPIA  758



>ref|XP_007147252.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
 gb|ESW19246.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
Length=765

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+CA+ FT      I R+  YNCS+PS D+NYPSF+AF    + 
Sbjct  611  LDPGLIYDATPQDYVNLLCAMNFTQAQILAITRSKDYNCSSPSYDVNYPSFVAFSVDKSV  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              +    ++F R++T +GDG + Y+A+++      ++V P++LVF  K +K+ + L +++
Sbjct  671  AVE----RKFRRSVTYVGDGSAVYTARVSSSNGTQISVSPNRLVFKAKYEKRKFSLMLKS  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 + + FGSL WVE  G+HVVRSP+V
Sbjct  727  EMKKENVVPFGSLEWVEETGRHVVRSPLV  755



>ref|XP_003566210.2| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=754

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIR--TSSYNCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D   +DYI L+CA+ +T    +T+++  +S  +CS  SLDLNYPSFIA+F  +
Sbjct  600  LDPGLVYDAGPEDYIKLMCAMNYTAEQIKTVVKPPSSPVDCSGASLDLNYPSFIAYFDPS  659

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
                +    + F+R +TN+GD  ++YSAK+  +  + V+VVP +LVF  K +KQ Y + I
Sbjct  660  GAAGE----KTFNRVVTNVGDAPASYSAKVKGLSGLTVSVVPSRLVFGGKHEKQRYTVVI  715

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
                   D ++ GSLTWV++A KH VRSPIVA
Sbjct  716  RG-QMKDDVVLHGSLTWVDDARKHTVRSPIVA  746



>gb|ACA64704.1| subtilase [Nicotiana tabacum]
Length=781

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+   NCS+P  DLNYPSFIA +P +
Sbjct  619  LDPGLVYDATPQDYINLICSMNFTEEQFKTFARSSANYNNCSSPCADLNYPSFIALYPFS  678

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G +TY  K+    N  V+V P  LVF KK++KQSY L I
Sbjct  679  LEGNFTWLKQKFRRTLTNVGKGGTTYKVKIETPKNSTVSVSPKTLVFKKKNEKQSYTLTI  738

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                        GS+TWVE  G H VRSPIV
Sbjct  739  RYIGDENQSRNVGSITWVEENGNHSVRSPIV  769



>emb|CAA07060.1| SBT4C protein [Solanum lycopersicum]
Length=779

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 7/153 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS--YNCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QDYINLIC++ FT    +T  R+S+  +NCSNPS DLNYPSFIAF+  +
Sbjct  618  LDPGLVYDATPQDYINLICSLNFTEEQFKTFARSSANYHNCSNPSADLNYPSFIAFYSYS  677

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL--  314
               + P   Q+F RTLTN+G   +TY  K+    N  ++V P  LVF  K++KQSY L  
Sbjct  678  QAGNYPWLEQKFRRTLTNVGKDGATYEVKIESPKNSTISVSPQTLVFKNKNEKQSYTLTI  737

Query  313  RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            R       G     GS+TWVE  G H VRSP+V
Sbjct  738  RYRGDEKGGQ---DGSITWVEKNGNHSVRSPMV  767



>ref|XP_010320531.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=750

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 95/151 (63%), Gaps = 7/151 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFF--PAN  488
            L+PGLI D + QDYINL+C +KFT     TI R+S+Y C N S DLNYPSFIA +     
Sbjct  596  LNPGLIYDATPQDYINLLCTMKFTHKQILTITRSSTYTCQNASSDLNYPSFIALYTNETA  655

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
            ATLS     Q+F RT+TN+G+G + YS  +    N NV+V P +L F+ K +K SY L +
Sbjct  656  ATLS-----QKFVRTVTNVGNGPANYSINMIVPSNTNVSVYPSRLSFSSKYEKLSYTLTV  710

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            E        +VFGS+TWV+  G H V SPIV
Sbjct  711  EYSGNRTGEVVFGSITWVDVIGLHAVTSPIV  741



>emb|CAA07062.1| SBT4E protein [Solanum lycopersicum]
Length=777

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SY-NCSNPSLDLNYPSFIAFFPAN  488
            LDPGL+ D + QD+INLIC++ FT    +T  R+S SY NCSNPS DLNYPSFIA +P +
Sbjct  615  LDPGLVYDATPQDHINLICSMNFTEEQFKTFARSSASYDNCSNPSADLNYPSFIALYPFS  674

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               +     Q+F RTLTN+G G +TY  +     N  V+V P  LVF +K+DKQSY L I
Sbjct  675  LEENFTWLEQKFRRTLTNVGKGGATYKVQTETPKNSIVSVSPRTLVFKEKNDKQSYTLSI  734

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +          GS+TWVE  G H VRSPIV
Sbjct  735  RSIGDSDQSRNVGSITWVEENGNHSVRSPIV  765



>ref|XP_004156411.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=757

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 98/150 (65%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DP LI DV  QDY+N++CA+ +T N  + I R+ S NC NPSLDLNYPSFI    ++ +
Sbjct  602  IDPDLIYDVGIQDYVNVLCALNYTENQIRIITRSDSNNCENPSLDLNYPSFIMIVNSSDS  661

Query  481  LSDPNRVQ-EFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             +   ++  EF RTLT +G+  +TY AKLT +    V V P+KL F +K+ K S++L+I 
Sbjct  662  KTRKRKISGEFKRTLTKIGEHRATYEAKLTGMKGFKVRVKPNKLNFKRKNQKLSFELKI-  720

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            A S     +VFG L+W E  G H+++SPIV
Sbjct  721  AGSARESNIVFGYLSWAEVGGGHIIQSPIV  750



>ref|XP_004143027.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN62450.1| hypothetical protein Csa_2G354760 [Cucumis sativus]
Length=757

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 98/150 (65%), Gaps = 2/150 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DP LI DV  QDY+N++CA+ +T N  + I R+ S NC NPSLDLNYPSFI    ++ +
Sbjct  602  IDPDLIYDVGIQDYVNVLCALNYTENQIRIITRSDSNNCENPSLDLNYPSFIMIVNSSDS  661

Query  481  LSDPNRVQ-EFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
             +   ++  EF RTLT +G+  +TY AKLT +    V V P+KL F +K+ K S++L+I 
Sbjct  662  KTRKRKISGEFKRTLTKIGEHRATYEAKLTGMKGFKVRVKPNKLNFKRKNQKLSFELKI-  720

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            A S     +VFG L+W E  G H+++SPIV
Sbjct  721  AGSARESNIVFGYLSWAEVGGGHIIQSPIV  750



>gb|EAY98174.1| hypothetical protein OsI_20091 [Oryza sativa Indica Group]
Length=562

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 100/153 (65%), Gaps = 6/153 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRT--SSYNCSNPSLDLNYPSFIAFFPAN  488
            +DPGL+ D  + DY+ L+CA+ +T    +T+ ++  S+ +C+  +LDLNYPSFIAFF   
Sbjct  405  VDPGLVYDAGADDYVKLMCAMNYTAAQIKTVAQSPSSAVDCAGATLDLNYPSFIAFFDPG  464

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
            AT       + F R +TN+GD  ++YSAK+  +G + V+V P++LVF +K + Q Y + I
Sbjct  465  ATAP---AARTFTRAVTNVGDAPASYSAKVKGLGGLTVSVSPERLVFGRKHETQKYTVVI  521

Query  307  EAP-STMGDFLVFGSLTWVENAGKHVVRSPIVA  212
                    D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  522  RGQMKNKTDEVLHGSLTWVDDAGKYTVRSPIVA  554



>ref|XP_010320326.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=749

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 95/151 (63%), Gaps = 7/151 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFF--PAN  488
            L+PGLI D + QDYINL+CA+KFT     TI R+S+Y C N S DLNYPSFIA +     
Sbjct  596  LNPGLIYDATPQDYINLLCAMKFTHKQILTITRSSTYTCQNASSDLNYPSFIAPYTNETT  655

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
            ATLS     Q+F RT+TN+G+G + YS  +    N N++V P +L F+ K +K SY L I
Sbjct  656  ATLS-----QKFVRTVTNVGNGPANYSINMVVPSNTNISVYPSRLSFSSKYEKLSYTLTI  710

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            E        +VFGSLTWV+  G H V S IV
Sbjct  711  EYSGNKTGEVVFGSLTWVDVIGLHAVTSSIV  741



>ref|XP_007207210.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
 gb|EMJ08409.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
Length=739

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 93/149 (62%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D + QDY+NL+C+  FT      I R+ +Y+CSNPS DLNYPSFIA +  N  
Sbjct  588  LEPGLIYDATPQDYVNLLCSTNFTRKQILAITRSYAYDCSNPSCDLNYPSFIALY--NDH  645

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 +VQ+F RT+TN+GDG + Y A +       VTV P+ L+F +  +KQS+ + I+ 
Sbjct  646  HKTKTKVQKFQRTVTNVGDGAARYKAAVIAPKGSKVTVSPEILIFGETYEKQSFTVTIKY  705

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +     +  G+L W+E  GK+ VRSPIV
Sbjct  706  KAKKKGTVSSGALVWIEQNGKYTVRSPIV  734



>gb|KHN06359.1| Subtilisin-like protease [Glycine soja]
Length=201

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 89/149 (60%), Gaps = 28/149 (19%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV  QDY+NL+CA+ FT  +  TI R+SSYNCS  SLDLNYPSFIA F  N  
Sbjct  69   LDPGLVYDVGVQDYVNLLCALNFTQKNITTITRSSSYNCSRLSLDLNYPSFIALFTGNG-  127

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                                 S+ ++++T IG+    V+P KL+F +K +K SY+LRIE 
Sbjct  128  ---------------------SSINSRVTLIGSFRERVIPSKLLFKQKKEKLSYELRIEG  166

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            P   G    FG L+W +   KHVVRSPIV
Sbjct  167  PKIEG----FGYLSWTDV--KHVVRSPIV  189



>ref|XP_010028239.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=762

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 102/154 (66%), Gaps = 6/154 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPS----LDLNYPSFIAFFP  494
            LDPGL+ D+ ++DY+NL+CA+K++    + II  SS++C + S       NYPSFIA F 
Sbjct  603  LDPGLVYDLQAEDYLNLLCAMKYSQKKIK-IIAKSSHSCRDASNSSRSSFNYPSFIALF-  660

Query  493  ANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL  314
             +        V+EF R +TN+G+  S+YSA++  +    V V P +LVF ++++K+ YKL
Sbjct  661  GDGEAGSGAVVREFRREVTNVGEDQSSYSARVVGMEGWKVRVDPPRLVFRQRNEKKRYKL  720

Query  313  RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             +E P  + D LV GSL+WV++ GK++VRSPIVA
Sbjct  721  TVEGPRVLRDGLVHGSLSWVDDRGKYIVRSPIVA  754



>ref|XP_009608286.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=765

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 95/152 (63%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFP--A  491
            +DPGLI D + QDY+NL+C++  T    +TI R+S+ +NCSNPS D+NYPSFIA F    
Sbjct  609  VDPGLIYDATPQDYVNLLCSMNLTVEQFKTIARSSAKHNCSNPSNDINYPSFIALFSPYG  668

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N T  +    Q+F RT+TN+G G +TY  K+    N ++++ P  LVF KK+ KQ Y L 
Sbjct  669  NYTWLE----QKFKRTVTNVGVGAATYKVKVRAPENSSISISPQTLVFEKKNQKQDYTLT  724

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I       D    GS+TWVE  G H VRSPIV
Sbjct  725  IRYKGVAEDQAQSGSITWVEENGHHTVRSPIV  756



>emb|CDP17236.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 99/150 (66%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D ++QDYI+L+C +  T +   +I+R++ Y+C N S DLNYPSFIA +  N +
Sbjct  607  LDPGLIYDATAQDYISLLCTMNLTRSQIASIVRSTDYSCLNASSDLNYPSFIALY-NNGS  665

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
                N++  F RT+TN+GDG +TY A +T P G+V V V P  L F KK D+Q+Y L I 
Sbjct  666  TGVLNKI--FERTVTNVGDGPATYKAIVTAPRGSV-VEVNPQTLAFQKKYDRQTYSLTIR  722

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
              S     + FGS+TW +  GKHVVRSPIV
Sbjct  723  YTSDNSAKVSFGSITWSDFGGKHVVRSPIV  752



>emb|CDP01318.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 103/150 (69%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI + +++DYINL+C+  +T    + I R S+Y+CSN S D+NYPSFIA +  N T
Sbjct  617  LNPGLIYNATTEDYINLLCSANYTWKQIKIITR-SNYSCSNASSDMNYPSFIALY--NNT  673

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
              +  + Q F RT+TN+G+G +TY A++T P G+V VTV P+ LVF KK ++QSY L I+
Sbjct  674  TKNVLK-QRFQRTVTNVGNGAATYKAQVTAPKGSV-VTVYPEILVFGKKYEEQSYVLTIQ  731

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
              +     + FGS+ WVE  GKH+VRSPI 
Sbjct  732  YNANQNKTITFGSIVWVEVNGKHIVRSPIA  761



>ref|XP_004229661.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=769

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFF--PA  491
            LDPGLI D + QDY+NL+C++ FT    +TI R+S+ +NCSNPS D+NYPSFIAFF    
Sbjct  614  LDPGLIYDTTPQDYVNLLCSLNFTEEQFKTIARSSTNHNCSNPSSDINYPSFIAFFSPEG  673

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N T  +    Q+F RT+TN+G   + Y  K+    N  V+V P  LVF KK+ K +Y L 
Sbjct  674  NFTFLE----QKFMRTVTNVGSAAAKYRVKVKAPRNSKVSVSPQTLVFKKKNQKLNYSLT  729

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I         +  GS+TWVE  G H VRSPIV
Sbjct  730  IRYKDDAEQEVQSGSITWVEENGNHTVRSPIV  761



>ref|XP_008370912.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPG I D + Q+Y+NL+C+  FT N   +I R+ +Y+CS PS DLNYPSFIA +  +  
Sbjct  613  LDPGJIYDATPQEYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIALYXNHHK  672

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
                 RVQ F RT+TN+GDG + Y A +T P+G+  VTV P+ L+F  K +KQS+ + + 
Sbjct  673  TK--KRVQTFQRTVTNVGDGAARYRASVTAPMGS-QVTVSPEILIFAYKYEKQSFTVTLN  729

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
              +        G+L W+E  GK+ VRSPIV
Sbjct  730  FNAKKKGNASSGALVWIEQNGKYTVRSPIV  759



>ref|XP_006339058.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 96/151 (64%), Gaps = 5/151 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            +DPGLI D + QDY+NL+C++ FT     TI R+S+ +NCSNPS D+NYPSFIA F   +
Sbjct  609  VDPGLIYDATPQDYVNLLCSMNFTLEQFNTIARSSAKHNCSNPSDDINYPSFIALF---S  665

Query  484  TLSDPNRVQE-FHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
             +   +R+++ F RT+TN+G G + Y AK+    +  +++ P  LVF KK+ KQ Y L I
Sbjct  666  PIGKYSRLEKKFRRTVTNVGAGAAKYVAKVIAPKSSTISISPQTLVFEKKNQKQDYTLTI  725

Query  307  EAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                   D    GS+TWVE  G H VRSPIV
Sbjct  726  RYKGIADDQAQSGSITWVEENGHHTVRSPIV  756



>ref|XP_006345494.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=754

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 93/152 (61%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFF--PA  491
            LDPGLI D + QDY+NL+C++ FT    +TI R+S+ +NCSNPS D+NYPSFIAFF    
Sbjct  599  LDPGLIYDTTPQDYVNLLCSLNFTEEQFKTIARSSANHNCSNPSSDINYPSFIAFFSPEG  658

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N T  +    Q+F RT+TN+G   + Y  K+    N  V+V P  LVF KK+ K SY L 
Sbjct  659  NFTFLE----QKFRRTVTNVGSAAAKYRVKVKAPRNSKVSVSPQTLVFRKKNQKLSYSLT  714

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I         +  GS+TWVE    H VRSPIV
Sbjct  715  IRYKDDAQQEVQSGSITWVEENRNHTVRSPIV  746



>ref|XP_004249505.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=765

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 95/152 (63%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFP--A  491
            +DPGLI D + QDY+NL+C++ FT +  +TI R+S+ +NCSNPS D+NYPSFIA F    
Sbjct  609  VDPGLIYDATPQDYVNLLCSMNFTSDQFKTIARSSAKHNCSNPSDDINYPSFIALFNPIG  668

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N T  +    ++F RT+TN+G   + Y AK+    N  +++ P  LVF KK+ KQ Y L 
Sbjct  669  NYTWLE----KKFRRTVTNVGASAAKYVAKVIAPKNSTISISPQTLVFEKKNQKQDYTLT  724

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I       D    GS+TWVE  G H VRSPIV
Sbjct  725  IRYKGIADDQAQSGSITWVEENGHHTVRSPIV  756



>ref|XP_009342993.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 91/149 (61%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + Q+Y+NL+C+  FT N   +I R+ +Y+CS PS DLNYPSFIA   +N  
Sbjct  613  LDPGLIYDATPQEYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIAL--SNND  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 RVQ F RT+TN+GDG + Y A +       VTV P+ L+F  K +KQS+ + I  
Sbjct  671  HKTKTRVQTFQRTVTNVGDGAARYMASVIAPKGSQVTVSPEILIFAYKYEKQSFTVTINF  730

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +        G+L W+E  GK+ VRSPIV
Sbjct  731  NAKKKGNASSGALVWIEQNGKYTVRSPIV  759



>gb|KHN14785.1| Subtilisin-like protease [Glycine soja]
Length=683

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNC--SNPSLDLNYPSFIAFFPAN  488
            LDPGLI D + QDY+NL+CA+ +T N   TI R+ SYNC  + PS DLNYPSFI  + +N
Sbjct  529  LDPGLIYDATPQDYVNLLCALGYTHNQILTITRSKSYNCPANKPSSDLNYPSFIVLY-SN  587

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
             T S    V+EF RT+TN+GDG +TY  K+T P G+V V V P+ L F  K++KQSY + 
Sbjct  588  KTKS--ATVREFRRTVTNVGDGAATYKVKVTQPKGSV-VKVSPETLAFGYKNEKQSYSVI  644

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I+      + + FG + WV +     VRSPIV
Sbjct  645  IKYTRNKKENISFGDIVWVGDGDARTVRSPIV  676



>ref|XP_003638681.1| Subtilisin-like protease [Medicago truncatula]
Length=184

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 20/150 (13%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV +QDY+NL+  + FT  H  TI R++  +CS PSLD+N+P FIAFF  N  
Sbjct  46   LDPGLLYDVGAQDYVNLLYGLNFTQKHITTITRSTFNDCSKPSLDINHPFFIAFF--NGG  103

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S   R+QEFH+T+TN+G                +V+V+P+KLVF +K++K  +KLR E 
Sbjct  104  NSSWRRIQEFHKTVTNVG---------------FHVSVIPNKLVFHEKNEKLRFKLRNEV  148

Query  301  PS-TMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S T    L FG LTW++ +  HVVRSP+V
Sbjct  149  GSMTRLKKLDFGYLTWMDVS--HVVRSPVV  176



>ref|XP_009337959.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Pyrus 
x bretschneideri]
Length=798

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 91/149 (61%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + Q+Y+NL+C+  FT N   +I R+ +Y+CS PS DLNYPSFIA   +N  
Sbjct  647  LDPGLIYDATPQEYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIAL--SNND  704

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 RVQ F RT+TN+GDG + Y A +       VTV P+ L+F  K +KQS+ + I  
Sbjct  705  HKTKTRVQTFQRTVTNVGDGAARYMASVIAPKGSQVTVSPEILIFAYKYEKQSFTVTINF  764

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +        G+L W+E  GK+ VRSPIV
Sbjct  765  NAKKKGNASSGALVWIEQNGKYTVRSPIV  793



>gb|AAO62352.1| subtilase [Casuarina glauca]
Length=764

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 93/150 (62%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPA-NA  485
            L+PGL+ D + QDYINL+C++ F       IIRT SYNCSNPS DLNYPSFIAF    N 
Sbjct  613  LEPGLVYDATPQDYINLLCSMNFDRTQILAIIRTRSYNCSNPSSDLNYPSFIAFHNGKND  672

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
            T+     V++F RT+TN+GD ++ Y+A +       V V P  LVF +K +++S+ L ++
Sbjct  673  TV-----VKKFRRTVTNVGDAVAIYNASIAAPRGSRVVVYPQTLVFKEKYEQKSFTLTMK  727

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                      FG+L W    GKH+VRSPIV
Sbjct  728  FKRGPKMDTSFGALVWTHENGKHIVRSPIV  757



>ref|XP_009608285.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 92/152 (61%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFP--A  491
            +DPGLI D + QDY+NL+C++  T    +TI R+S+ +NCSNPS D+NYPSFIA F    
Sbjct  615  VDPGLIYDATPQDYVNLLCSMNLTVEQFKTIARSSAKHNCSNPSNDINYPSFIALFSPYG  674

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N T  +    Q+F RT+TN+G   +TY  K+    N  +++ P  LVF KK  KQ Y L 
Sbjct  675  NYTWLE----QKFKRTVTNVGAAAATYKVKVRAPKNSTISISPQTLVFEKKYQKQDYSLT  730

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I       D    GS+TWVE  G H VRSPIV
Sbjct  731  IRYKGVAEDQAQSGSITWVEENGHHTVRSPIV  762



>gb|AFW81831.1| putative subtilase family protein [Zea mays]
Length=774

 Score =   132 bits (332),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 13/158 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTII----RTSSY--NCSNPSLDLNYPSFIAF  500
            +DPGL+ D + +DY+ L+CA+ +T    +T++     +SSY  +C+  SLDLNYPSFIAF
Sbjct  614  VDPGLVYDAAPEDYVKLMCAMNYTAAQIRTVVAQSPSSSSYAVDCTGASLDLNYPSFIAF  673

Query  499  FPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSY  320
            F  N    +    + F RT+TN+GDG ++YS K+  +  + V V PDKL F  K++KQ Y
Sbjct  674  FDPNGGSVE----RTFTRTVTNVGDGPASYSVKVLGLSGLTVIVSPDKLAFGGKNEKQKY  729

Query  319  KLRIEAPST--MGDFLVFGSLTWVENAGKHVVRSPIVA  212
             L I    T   GD L  GSLTWV++AGK+ VRSPIVA
Sbjct  730  TLVIRGKMTNKSGDVL-HGSLTWVDDAGKYTVRSPIVA  766



>ref|NP_001145972.1| uncharacterized protein LOC100279499 precursor [Zea mays]
 gb|ACL52959.1| unknown [Zea mays]
Length=774

 Score =   132 bits (331),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 13/158 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTII----RTSSY--NCSNPSLDLNYPSFIAF  500
            +DPGL+ D + +DY+ L+CA+ +T    +T++     +SSY  +C+  SLDLNYPSFIAF
Sbjct  614  VDPGLVYDAAPEDYVKLMCAMNYTAAQIRTVVAQSPSSSSYAVDCTGASLDLNYPSFIAF  673

Query  499  FPANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSY  320
            F  N    +    + F RT+TN+GDG ++YS K+  +  + V V PDKL F  K++KQ Y
Sbjct  674  FDPNGGSVE----RTFTRTVTNVGDGPASYSVKVLGLSGLTVIVSPDKLAFGGKNEKQKY  729

Query  319  KLRIEAPST--MGDFLVFGSLTWVENAGKHVVRSPIVA  212
             L I    T   GD L  GSLTWV++AGK+ VRSPIVA
Sbjct  730  TLVIRGKMTNKSGDVL-HGSLTWVDDAGKYTVRSPIVA  766



>ref|XP_009769989.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=771

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 94/152 (62%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFP--A  491
            +DPGL+ D + QDY+NL+C++  T    +TI R+S+ +NCSNPS D+NYPSFIA F    
Sbjct  615  VDPGLVYDSTPQDYVNLLCSMNLTVAQFRTIARSSAKHNCSNPSNDINYPSFIALFSPYG  674

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N T  +    Q+F RT+TN+G G +TY  K+    N  +++ P  LVF KK+ KQ Y L 
Sbjct  675  NYTWLE----QKFKRTVTNVGVGAATYKVKVKAPKNSTISISPQTLVFEKKNQKQDYYLT  730

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I       D    GS+TWVE  G H VRSPIV
Sbjct  731  IRYKGIAEDQAQSGSITWVEENGHHTVRSPIV  762



>ref|XP_003535388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNC--SNPSLDLNYPSFIAFFPAN  488
            LDPGLI D + QDY+NL+CA+ +T N   TI R+ SYNC  + PS DLNYPSFI  + +N
Sbjct  615  LDPGLIYDATPQDYVNLLCALGYTHNQILTITRSKSYNCPANKPSSDLNYPSFIVLY-SN  673

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
             T S    V+EF RT+TN+GDG +TY  K+T P G+V V V P+ L F  K++KQSY + 
Sbjct  674  KTKS--ATVREFRRTVTNVGDGAATYKVKVTQPKGSV-VKVSPETLAFGYKNEKQSYSVI  730

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I+      + + FG + WV +     VRSPIV
Sbjct  731  IKYTRNKKENISFGDIVWVGDGDARTVRSPIV  762



>gb|KJB58523.1| hypothetical protein B456_009G213500 [Gossypium raimondii]
Length=759

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 92/149 (62%), Gaps = 11/149 (7%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + QDY+NL+C + FT     TI R+ SY+CSNPS DLNYPSFIA +     
Sbjct  599  LDPGLIYDATPQDYVNLMCTMNFTQKQIMTITRSKSYDCSNPSSDLNYPSFIALY-----  653

Query  481  LSDPN----RVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL  314
              DPN     V+ F+RT+TN+G+G +TY  ++    +  + V P+ LVF K  +KQ +++
Sbjct  654  --DPNVPKTSVKIFNRTVTNVGEGSATYKVEIVQPEDSIIAVSPETLVFGKTYEKQCFRV  711

Query  313  RIEAPSTMGDFLVFGSLTWVENAGKHVVR  227
             I+  S     + FG L W+E  GKH VR
Sbjct  712  SIKYRSNKTGKVSFGELVWIEANGKHKVR  740



>ref|XP_008218400.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=766

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 92/149 (62%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D + QDY+NL+C+  FT      I R+ +Y+CSNPS DLNYPSFI  +  N  
Sbjct  615  LEPGLIYDATPQDYVNLLCSTNFTRKQILAITRSHAYDCSNPSCDLNYPSFITLY--NDH  672

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 +VQ+F RT+TN+G+G + Y A +       VTV P+ L+F +  +KQS+ + I+ 
Sbjct  673  HKTKTKVQKFQRTVTNVGEGAARYKAAVIAPKGSKVTVSPEILIFGETYEKQSFTVTIKY  732

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +     +  G+L W+E  GK+ VRSPIV
Sbjct  733  KAKKKGTVSSGALVWIEQNGKYTVRSPIV  761



>ref|XP_008444560.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 97/152 (64%), Gaps = 6/152 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DP LI DV  QDY+N++CA+ +T N  + I R+ S NC NPSLDLNYPSFI    AN++
Sbjct  609  VDPDLIYDVGIQDYVNVLCALNYTENQIRIITRSDSNNCENPSLDLNYPSFIII--ANSS  666

Query  481  LSDPNR---VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
             S   +   + EF RTLT +G+  +TY AKL  +    V V P  L F +K+ K S++L+
Sbjct  667  DSKTGKRKILGEFKRTLTKIGENRATYEAKLRGMKGFKVRVKPRILEFKRKNQKLSFELK  726

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I A S     +VFG L+W E  G+H+V+SPIV
Sbjct  727  I-AGSAEESNVVFGYLSWAEVGGRHIVQSPIV  757



>ref|XP_004249504.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 91/150 (61%), Gaps = 3/150 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            +DPGLI D + QDY+NL+C++ FT    +TI R+S+ +NC NPS D+NYPSFIA +  N 
Sbjct  612  VDPGLIYDATPQDYVNLLCSMNFTAKQFKTIARSSAKHNCENPSDDINYPSFIALYVPNG  671

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
              +     Q+F RT+TN+G G + Y  K+    N  +++ P  LVF KK  KQ Y L I 
Sbjct  672  DYA--WLEQKFKRTVTNVGPGAAIYKVKVKAPINSTISISPQTLVFEKKHQKQDYTLTIR  729

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                  D    GS+TWVE  G H VRSPIV
Sbjct  730  YRGIEFDQAQSGSVTWVEKNGHHTVRSPIV  759



>ref|XP_006655358.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=761

 Score =   130 bits (327),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 68/153 (44%), Positives = 99/153 (65%), Gaps = 6/153 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS--YNCSNPSLDLNYPSFIAFFPAN  488
            +DPGL+ D   +DY+ L+CA+ +T    +T+ ++ S   +C+  SLDLNYPSFIAFF   
Sbjct  604  VDPGLVYDAGPEDYVRLMCAMNYTEAQIKTVAQSPSAAVDCTGASLDLNYPSFIAFFDPG  663

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
            AT      V+ F R +TN+GD  ++YSAK+  +G + VTV P++LVF  K + Q Y + I
Sbjct  664  ATAP---AVRTFTRVVTNVGDAPASYSAKVKGLGGLTVTVAPERLVFGGKHETQKYTVVI  720

Query  307  EAP-STMGDFLVFGSLTWVENAGKHVVRSPIVA  212
                    D ++ GSLTWV+++GK+ VRSPIVA
Sbjct  721  RGQMKKKTDEVLHGSLTWVDDSGKYTVRSPIVA  753



>gb|EYU45084.1| hypothetical protein MIMGU_mgv1a001942mg [Erythranthe guttata]
Length=736

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI +V+  DY+NL+C++ FT   T++I+R SSY+CS PS DLNYP+FIA +  N  
Sbjct  586  LDPGLIYNVTRHDYVNLVCSMNFTREQTKSILR-SSYDCSTPSSDLNYPAFIAIYKQNRE  644

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +   RV  F R +TN+ DG S+Y  +L       VTV P  LVF KK ++ SY+L +  
Sbjct  645  GTVMTRV--FKRRVTNVWDGPSSYRVELQLPKYTKVTVRPTTLVFNKKYEELSYQLTVSY  702

Query  301  PSTMGDFLVFGSLTWVENAG-KHVVRSPIV  215
                G     GS+TW E AG KH VRSPIV
Sbjct  703  SGGNGSLPAHGSITWTEEAGRKHSVRSPIV  732



>ref|XP_009338017.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 91/149 (61%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + Q+Y+NL+C+  FT N   +I R+ +Y+CS PS DLNYPSFIA   +N  
Sbjct  613  LDPGLIYDATPQEYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIAL--SNND  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 RVQ F R +TN+GDG + Y A +T      VTV P+ L+F  K +KQS+ + +  
Sbjct  671  HKTKTRVQTFQRAVTNVGDGAARYRASVTSPKGSQVTVSPEILIFAYKYEKQSFTVTLNY  730

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +        G+L W+E  GK+ VRSPIV
Sbjct  731  KAKKKGKASSGALVWIEQNGKYTVRSPIV  759



>emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa]
Length=761

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 90/152 (59%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSN-PSLDLNYPSFIAFFPANA  485
            LDPGL+ D + QDYINL+C++ +       I+R+ SY CSN PS DLNYPSFIAF  +  
Sbjct  606  LDPGLVYDATPQDYINLLCSMNYNKAQILAIVRSDSYTCSNDPSSDLNYPSFIAFHNSTC  665

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
              S    V  F RT+TN+GDG +TY A +T   +  V V P  L F  K +KQSY L I 
Sbjct  666  RRS----VNTFQRTVTNVGDGAATYKATVTAPKDSRVIVSPQTLAFGSKYEKQSYNLTII  721

Query  304  --APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 T    + FG+L W    GKH+VRSPIV
Sbjct  722  NFTRDTKRKDISFGALVWANENGKHMVRSPIV  753



>ref|XP_009343011.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 91/149 (61%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + Q+Y+NL+C+  FT N   +I R+ +Y+CS PS DLNYPSFIA   +N  
Sbjct  613  LDPGLIYDATPQEYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIAL--SNND  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 RVQ F R +TN+GDG + Y A +T      VTV P+ L+F  K +KQS+ + +  
Sbjct  671  HKTKTRVQTFQRAVTNVGDGAARYRASVTSPKGSQVTVSPEILIFAYKYEKQSFTVTLNY  730

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +        G+L W+E  GK+ VRSPIV
Sbjct  731  KAKKKGKASSGALVWIEQNGKYTVRSPIV  759



>gb|KHN43135.1| Subtilisin-like protease [Glycine soja]
Length=610

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 92/150 (61%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY-NCSNPSLDLNYPSFIAFFPANA  485
            LDPGLI D S QDY+NL+CA+  T      I R+ +Y NCS  S DLNYPSF+AF+   +
Sbjct  451  LDPGLIYDASPQDYVNLLCAMNLTQAQIMAITRSKAYSNCSRASYDLNYPSFVAFYADKS  510

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
               +     +F R +T +GDG + Y+A+++      ++V P++LVF  K +K+ + L  +
Sbjct  511  VKVE----TKFRRIVTYVGDGPAVYTARVSSYNGTAISVSPNRLVFKNKHEKRKFTLSFK  566

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            +       + FGSL WVE  G+H+VRSP+V
Sbjct  567  SQMDKDYDVAFGSLQWVEETGRHLVRSPVV  596



>ref|XP_009769987.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009769988.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
Length=765

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 93/152 (61%), Gaps = 7/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFP--A  491
            +DPGLI D + Q Y+NL+C++  T    +TI R+S+ +NCSNPS D+NYPSFIA F    
Sbjct  609  VDPGLIYDATPQHYVNLLCSMNLTVEQFKTIARSSAKHNCSNPSNDINYPSFIALFSPYG  668

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            N T  +    Q+F RT+TN+G G +TY  K+    N  +++ P  LVF KK+ KQ Y L 
Sbjct  669  NYTWLE----QKFKRTVTNVGAGAATYKVKVKAPENSTISLFPQTLVFEKKNQKQEYTLT  724

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            I     + D    G++TWVE  G H V SPIV
Sbjct  725  IRYKGVVEDQAQSGAITWVEENGHHTVSSPIV  756



>ref|XP_004496012.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=761

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPG I D + QDY+NL+C   +T     TI R+  YNC NPS DLNYPSFI  +     
Sbjct  609  LDPGFIYDATPQDYVNLLCDFGYTHKQILTITRSKVYNCDNPSSDLNYPSFIVLYGNKKR  668

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                  VQ+F R++TN+GDG ++Y  K+T      VTV+P+KL F  K++K SY + I+ 
Sbjct  669  ----TMVQKFLRSVTNVGDGAASYKVKVTKPKGCVVTVLPEKLTFNYKNEKLSYTVEIKY  724

Query  301  PSTMGDFLV-FGSLTWVENAGKHVVRSPIV  215
                 +  V FG + W+E  G   VRSPIV
Sbjct  725  KRNKKELNVSFGDIVWIEEGGARTVRSPIV  754



>ref|XP_007143987.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
 gb|ESW15981.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
Length=763

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (63%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCS-NPSLDLNYPSFIAFFPANA  485
            LDPG I D + +DY+NL+CA+ ++ N   TI R+ +Y CS NPS DLNYPSFI  + +N 
Sbjct  611  LDPGFIYDATPEDYVNLLCALGYSQNQILTITRSKTYKCSDNPSSDLNYPSFIVLY-SNK  669

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
            T S    V++F RT+TN+GDG +TY  K+       V V P+ L F  +++KQ+Y + I+
Sbjct  670  TRS---TVKKFRRTVTNVGDGAATYRVKVKQPKGAAVKVSPETLTFGYRNEKQNYSVTIK  726

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                  + + FG + WVE+ G   VRSPIV
Sbjct  727  YRRNKKESIPFGDIVWVEDGGARKVRSPIV  756



>ref|XP_008370910.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=651

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + Q+Y+NL+C+  FT N   +I R+ +Y+CS PS DLNYPSFIA +  N  
Sbjct  500  LDPGLIYDATPQEYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIALY--NNH  557

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 RVQ F RT+TN+GD  + Y A +T      VTV P+ L+F  K +KQS+ + +  
Sbjct  558  HKTKKRVQTFQRTVTNVGDXAARYRASVTAPKGSQVTVSPEILIFAYKYEKQSFTVTLNY  617

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +        G+L W+E  GK+  RSPIV
Sbjct  618  KAKKKGKASSGALVWIEQNGKYTXRSPIV  646



>ref|NP_001055646.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|AAT58881.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF17560.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|EEE63841.1| hypothetical protein OsJ_18665 [Oryza sativa Japonica Group]
Length=761

 Score =   128 bits (322),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 66/153 (43%), Positives = 100/153 (65%), Gaps = 6/153 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRT--SSYNCSNPSLDLNYPSFIAFFPAN  488
            +DPGL+ D  + DY+ L+CA+ +T    +T+ ++  S+ +C+  +LDLNYPSFIAFF   
Sbjct  604  VDPGLVYDAGADDYVKLMCAMNYTAAQIKTVAQSPSSAVDCAGATLDLNYPSFIAFFDPG  663

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
            AT       + F R +TN+GD  ++YSAK+  +G + V+V P++LVF +K + Q Y + I
Sbjct  664  ATAP---AARTFTRAVTNVGDAPASYSAKVKGLGGLTVSVSPERLVFGRKHETQKYTVVI  720

Query  307  EAP-STMGDFLVFGSLTWVENAGKHVVRSPIVA  212
                    D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  721  RGQMKNKTDEVLHGSLTWVDDAGKYTVRSPIVA  753



>dbj|BAJ88882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 99/151 (66%), Gaps = 9/151 (6%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            L+PGL+ D    DYI L+CA+ +T    +T+ ++S+  +C+  SLDLNYPSFIAFF    
Sbjct  597  LNPGLVYDAGPGDYIKLMCAMNYTTAQIKTVAQSSAPVDCAGASLDLNYPSFIAFF----  652

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
               D    + F RT+TN+GDG + Y+A +  +  + VTVVP++LVF  K++KQ Y + I+
Sbjct  653  ---DTTGERAFVRTVTNVGDGPAGYNATVEGLDGLKVTVVPNRLVFDGKNEKQRYTVMIQ  709

Query  304  A-PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 + D ++ GSLTW+++ GK+ VRSPIV
Sbjct  710  VRDDLLPDVVLHGSLTWMDDNGKYTVRSPIV  740



>dbj|BAJ87233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 99/151 (66%), Gaps = 9/151 (6%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            L+PGL+ D    DYI L+CA+ +T    +T+ ++S+  +C+  SLDLNYPSFIAFF    
Sbjct  597  LNPGLVYDAGPGDYIKLMCAMNYTTAQIKTVAQSSAPVDCAGASLDLNYPSFIAFF----  652

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
               D    + F RT+TN+GDG + Y+A +  +  + VTVVP++LVF  K++KQ Y + I+
Sbjct  653  ---DTTGERAFVRTVTNVGDGPAGYNATVEGLDGLKVTVVPNRLVFDGKNEKQRYTVMIQ  709

Query  304  A-PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 + D ++ GSLTW+++ GK+ VRSPIV
Sbjct  710  VRDDLLPDVVLHGSLTWMDDNGKYTVRSPIV  740



>ref|XP_006847107.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
 gb|ERN08688.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
Length=757

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 6/150 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D   +DY+NL+CA+ +T N  +TI R S+Y CS PSLDLNYP+F+AF   +  
Sbjct  599  MDPGLIYDAGPEDYVNLLCALNYTQNQIKTITRGSNYTCSKPSLDLNYPAFVAFCDNSDQ  658

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTP-IGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
            +S     Q F R LTN+GD +S Y+ + T  +    V VVP+ L+F ++ +K+ + + IE
Sbjct  659  VS-----QAFKRVLTNVGDRVSVYNVRTTTGLEGFTVKVVPETLIFERRYEKREFSVSIE  713

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
               T    ++ G + W     KHVVR+P+V
Sbjct  714  GKLTSDSPVIHGYVIWEAAYSKHVVRTPVV  743



>ref|XP_006345404.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=782

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 97/153 (63%), Gaps = 5/153 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIR--TSSYNCSNPSLDLNYPSFIAFFPAN  488
            LDPGLI D + QDY+NL+C++ FT +  +TI R  T+ +NCSN S DLNYPSF A +  +
Sbjct  618  LDPGLIYDATPQDYVNLLCSMNFTEDEFKTIARSATNHHNCSNASDDLNYPSFTALYEFD  677

Query  487  ATLSD-PNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
               ++ P  V++F RT+TN+G G + Y A +    N +++V P  L F KK +K+SY L 
Sbjct  678  RDGNNYPLLVKKFTRTVTNVGSGAARYKALVEVPKNTSISVSPQVLTFGKKYEKKSYTLT  737

Query  310  IEAPSTMGDFLVF--GSLTWVENAGKHVVRSPI  218
            I       +  VF  GS+TWVE  GKH VRSPI
Sbjct  738  IRYRGEGHESYVFNYGSITWVEQNGKHTVRSPI  770



>ref|XP_003553772.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=763

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 92/150 (61%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY-NCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D S QDY+NL+CA+  T      I R+ +Y NCS  S DLNYPSF+AF+   +
Sbjct  604  LDPGLVYDASPQDYVNLLCAMNLTQAQIMAITRSKAYSNCSRASYDLNYPSFVAFYADKS  663

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
               +     +F R +T +GDG + Y+A+++      ++V P++LVF  K +K+ + L  +
Sbjct  664  VKVE----TKFRRIVTYVGDGPAVYTARVSSYNGTAISVSPNRLVFKNKHEKRKFTLSFK  719

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            +       + FGSL WVE  G+H+VRSP+V
Sbjct  720  SQMDKDYDVAFGSLQWVEETGRHLVRSPVV  749



>ref|XP_008355893.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 89/149 (60%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGLI D + Q+Y+NL+C+  FT N   +I R+ +Y+CS PS DLNYPSFIA +  N  
Sbjct  613  LDPGLIYDATPQEYVNLLCSTNFTRNQILSITRSHAYDCSKPSSDLNYPSFIALY--NNH  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 R Q F RT+TN+GD  + Y A +T      VTV P+ L+F  K +KQS+ + +  
Sbjct  671  HKTKKRXQTFQRTVTNVGDXAARYRASVTAPXGSQVTVSPEILIFAYKYEKQSFTVTLNX  730

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +        G+L W+E  GK+  RSPIV
Sbjct  731  XAKKKGKASSGALVWIEQNGKYTXRSPIV  759



>ref|XP_011468374.1| PREDICTED: uncharacterized protein LOC101302380 [Fragaria vesca 
subsp. vesca]
Length=1517

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = -1

Query  661   LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
             L+PGLI D + QDY+NL+C+  FT      I R+ +Y+C NPS DLNYPSFIA +     
Sbjct  1362  LEPGLIYDATPQDYVNLLCSTNFTAKQILAITRSPAYDCFNPSSDLNYPSFIALYDRRHD  1421

Query  481   LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              +   +VQ+F RT+TN+G G +TY A +       VTV PD L F++K +KQSY L I  
Sbjct  1422  -TKKLKVQKFQRTVTNVGHGAATYKASVIAPQGSKVTVSPDTLFFSEKYEKQSYTLTISY  1480

Query  301   PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                    + FG + W     K++VRSPIV
Sbjct  1481  KGKKKGNVSFGEIVWAVVDLKYMVRSPIV  1509


 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 87/149 (58%), Gaps = 2/149 (1%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D + QDY+NL+C+  FT      I R+  Y+CS  S DLNYPSFIA +  +  
Sbjct  587  LEPGLIYDATIQDYVNLLCSTNFTRKQILAITRSHEYDCSKASSDLNYPSFIALYGQHH-  645

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             +   RVQ+F RT+TN+GDG + Y   +T      V V P+ L F    +KQSY + I+ 
Sbjct  646  -AKKLRVQKFQRTVTNVGDGAAKYKVFVTAPNGSTVIVSPEILNFANIYEKQSYTVTIKY  704

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                   + FG L WVE  GK+ VRSPIV
Sbjct  705  KGDKQKKVSFGELVWVEENGKYKVRSPIV  733



>ref|XP_002441162.1| hypothetical protein SORBIDRAFT_09g021490 [Sorghum bicolor]
 gb|EES19592.1| hypothetical protein SORBIDRAFT_09g021490 [Sorghum bicolor]
Length=744

 Score =   124 bits (312),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 72/162 (44%), Positives = 104/162 (64%), Gaps = 20/162 (12%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTII----RTSSY--NCSNPSLDLNYPSFIAF  500
            +DPGL+ D +  DY+ L+CA+ +T    +T++     +SSY  +C+  +LDLNYPSFIAF
Sbjct  583  VDPGLVYDAAPGDYVKLMCAMNYTAAQIRTVVTQSPSSSSYAVDCTGATLDLNYPSFIAF  642

Query  499  FPANATLSDPNR----VQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSD  332
            F       DPN      + F RT+TN+G G ++Y+AK+T +  + V V P+KL F  K++
Sbjct  643  F-------DPNGGAVVERTFTRTVTNVGGGPASYTAKVTGLSGLTVIVSPEKLAFGGKNE  695

Query  331  KQSYKL--RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            KQ Y L  R +  S  G+ L  G+LTWV++AGK+ VRSPIVA
Sbjct  696  KQKYTLVIRGKMTSKSGNVL-HGALTWVDDAGKYTVRSPIVA  736



>gb|EMT05720.1| Subtilisin-like protease [Aegilops tauschii]
Length=556

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 95/152 (63%), Gaps = 9/152 (6%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            LDPGL+ D    DYI L+CA+ FT    +T++++S   +C++ +LDLNYPSFIAFF  N 
Sbjct  402  LDPGLVYDAGPDDYIKLMCAMNFTAAQIKTVVQSSGPMDCASATLDLNYPSFIAFFDYNG  461

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYK--LR  311
                    + F RT+TN+GDG   Y+A +  +    V  VP++L+   K +KQ Y   +R
Sbjct  462  G------EKTFTRTVTNVGDGPVRYNATVEGLDGGKVRGVPNRLLLCGKHEKQRYTVVVR  515

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            +     + + +++GSLTWV++ GK+ VRSPIV
Sbjct  516  VGDSQIIPEVVLYGSLTWVDDTGKYTVRSPIV  547



>gb|EAZ14292.1| hypothetical protein OsJ_04216 [Oryza sativa Japonica Group]
Length=699

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = -1

Query  658  DPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSL-DLNYPSFIAFFPAN  488
            DPGL+ D    DY+ L+CA+ +  +  + + + S+Y  NCS  S  DLNYPSFIA+F   
Sbjct  539  DPGLVYDAVPGDYVELMCAMGYNLSDIRAVTQWSTYAVNCSGASSPDLNYPSFIAYFDRR  598

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP-IGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            +  +     + F R +TN+G G ++Y AK+   +G + V+V P +LVF KK + Q Y L 
Sbjct  599  SAAAAAAETKTFVRVVTNVGAGAASYRAKVKGNLGGLAVSVTPSRLVFGKKGETQKYTLV  658

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            +       D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  659  LRGKIKGADKVLHGSLTWVDDAGKYTVRSPIVA  691



>dbj|BAJ88973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   123 bits (309),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 98/151 (65%), Gaps = 9/151 (6%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            L PGL+ +    DYI L+CA+ +T    +T+ ++S+  +C   SLDLNYPSFIA+F    
Sbjct  607  LAPGLVYEAGPYDYIKLMCAMNYTTAQIKTVAQSSAPVDCVGASLDLNYPSFIAYF----  662

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
               D    + F RT+TN+GDG ++YSA +  +  + V+VVPD+LVF  K +KQ YK+ ++
Sbjct  663  ---DTAGEKTFARTVTNVGDGPASYSATVEGLDGLKVSVVPDRLVFGGKHEKQRYKVVVQ  719

Query  304  A-PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 M + ++ GSLTWV++ GK+ VRSP+V
Sbjct  720  VRDELMPEVVLHGSLTWVDDNGKYTVRSPVV  750



>dbj|BAJ90426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score =   123 bits (309),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 98/151 (65%), Gaps = 9/151 (6%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            L PGL+ +    DYI L+CA+ +T    +T+ ++S+  +C   SLDLNYPSFIA+F    
Sbjct  587  LAPGLVYEAGPYDYIKLMCAMNYTTAQIKTVAQSSAPVDCVGASLDLNYPSFIAYF----  642

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
               D    + F RT+TN+GDG ++YSA +  +  + V+VVPD+LVF  K +KQ YK+ ++
Sbjct  643  ---DTAGEKTFARTVTNVGDGPASYSATVEGLDGLKVSVVPDRLVFGGKHEKQRYKVVVQ  699

Query  304  A-PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
                 M + ++ GSLTWV++ GK+ VRSP+V
Sbjct  700  VRDELMPEVVLHGSLTWVDDNGKYTVRSPVV  730



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 88/148 (59%), Gaps = 3/148 (2%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            L+PGLI D S+QD +NL+C++ FT   T+TI R S++NCS P  DLNYPSFIA +    T
Sbjct  580  LNPGLIYDASTQDLVNLVCSMNFTREQTETITR-SNFNCSTPYPDLNYPSFIALYEFAQT  638

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                 R   F RTLTN+G G +TY  K+    N  V V P  LVF +K +K SY L I  
Sbjct  639  GRRLTR--SFKRTLTNVGKGGATYRVKVEAPSNATVRVRPKTLVFREKYEKLSYSLSIRY  696

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPI  218
             +        GS+TW +  GK+ VRSPI
Sbjct  697  LAGFFPPATPGSITWTDETGKYSVRSPI  724



>ref|XP_007135314.1| hypothetical protein PHAVU_010G118900g, partial [Phaseolus vulgaris]
 gb|ESW07308.1| hypothetical protein PHAVU_010G118900g, partial [Phaseolus vulgaris]
Length=152

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 84/123 (68%), Gaps = 9/123 (7%)
 Frame = -1

Query  574  TIIRTSSYN-CSNPSLDLNYPSFIAFFPANATLSDPNRVQEFHRTLTNLGDGISTYSAKL  398
            T+I  + YN CS PSLDLNYPSFIAFF +N++ +    VQEF RT+TN+G+G ++Y+A  
Sbjct  28   TVITGTYYNDCSRPSLDLNYPSFIAFFSSNSSRT----VQEFQRTVTNVGEGPASYAANF  83

Query  397  TPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEAPSTMGD--FLVFGSLTWVENAGKHVVRS  224
            T +    V+V P+ LVF +K +K SY LRIE P T  +   + FG LTW    GK+VVRS
Sbjct  84   TSLEGYRVSVTPELLVFKEKYEKLSYTLRIEGPRTKKEEKEVDFGHLTWTN--GKYVVRS  141

Query  223  PIV  215
            PIV
Sbjct  142  PIV  144



>gb|KCW54937.1| hypothetical protein EUGRSUZ_I00910, partial [Eucalyptus grandis]
Length=747

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 95/147 (65%), Gaps = 6/147 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPS----LDLNYPSFIAFFP  494
            LDPGL+ D+ ++DY+NL+CA+K++    + II  SS++C + S       NYPSFIA F 
Sbjct  603  LDPGLVYDLQAEDYLNLLCAMKYSQKKIK-IIAKSSHSCRDASNSSRSSFNYPSFIALF-  660

Query  493  ANATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL  314
             +        V+EF R +TN+G+  S+YSA++  +    V V P +LVF ++++K+ YKL
Sbjct  661  GDGEAGSGAVVREFRREVTNVGEDQSSYSARVVGMEGWKVRVDPPRLVFRQRNEKKRYKL  720

Query  313  RIEAPSTMGDFLVFGSLTWVENAGKHV  233
             +E P  + D LV GSL+WV++ GK++
Sbjct  721  TVEGPRVLRDGLVHGSLSWVDDRGKYI  747



>gb|EEC71868.1| hypothetical protein OsI_04579 [Oryza sativa Indica Group]
Length=557

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 94/153 (61%), Gaps = 5/153 (3%)
 Frame = -1

Query  658  DPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNP-SLDLNYPSFIAFFPAN  488
            DPGL+ D    DY+ L+CA+ +  +  + + + S+Y  NCS   S DLNYPSFIA+F   
Sbjct  398  DPGLVYDAVPGDYVELMCAMGYNLSDIRAVTQWSTYAVNCSGALSPDLNYPSFIAYFDRR  457

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTP-IGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            +  +     + F R +TN+G G ++Y AK+   +G + V+V P +LVF KK + Q Y L 
Sbjct  458  SAAA-AAETKTFVRVVTNVGAGAASYRAKVKGNLGGLAVSVTPSRLVFGKKGETQKYTLV  516

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            +       D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  517  LRGKIKGADKVLHGSLTWVDDAGKYTVRSPIVA  549



>ref|XP_004961962.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=762

 Score =   120 bits (302),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 73/155 (47%), Positives = 102/155 (66%), Gaps = 7/155 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS---YNCSNPSLDLNYPSFIAFFPA  491
            +DPGL+ D + +DY+ L+CA+ FT    +T+ +TSS    +C+  SLDLNYPSFIA F  
Sbjct  602  VDPGLVYDAAPEDYVKLMCAMNFTAEQIRTVAQTSSSYAVDCAGASLDLNYPSFIALFNP  661

Query  490  NATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL-  314
            + + +   R   F RT+TN+G   ++YSAK+  +  + V V PD+LVF  K++KQ Y L 
Sbjct  662  DGSGAG-ERTFTFTRTVTNVGGVPASYSAKVVGLKGLTVAVTPDRLVFNGKNEKQKYTLV  720

Query  313  -RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             R +  S  GD L  GSLTWV++AGK+ VRSPIVA
Sbjct  721  IRGQMNSNTGDVLQ-GSLTWVDDAGKYTVRSPIVA  754



>ref|NP_001044922.1| Os01g0868900 [Oryza sativa Japonica Group]
 dbj|BAB89803.1| putative subtilisin-like protease [Oryza sativa Japonica Group]
 dbj|BAF06836.1| Os01g0868900 [Oryza sativa Japonica Group]
Length=760

 Score =   118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 64/153 (42%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = -1

Query  658  DPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSY--NCSNPSL-DLNYPSFIAFFPAN  488
            DPGL+ D    DY+ L+CA+ +  +  + + + S+Y  NCS  S  DLNYPSFIA+F   
Sbjct  600  DPGLVYDAVPGDYVELMCAMGYNLSDIRAVTQWSTYAVNCSGASSPDLNYPSFIAYFDRR  659

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLT-PIGNVNVTVVPDKLVFTKKSDKQSYKLR  311
            +  +     + F R +TN+G G ++Y AK+   +G + V+V P +LVF KK + Q Y L 
Sbjct  660  SAAAAAAETKTFVRVVTNVGAGAASYRAKVKGNLGGLAVSVTPSRLVFGKKGETQKYTLV  719

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
            +       D ++ GSLTWV++AGK+ VRSPIVA
Sbjct  720  LRGKIKGADKVLHGSLTWVDDAGKYTVRSPIVA  752



>ref|XP_008776814.1| PREDICTED: cucumisin [Phoenix dactylifera]
Length=147

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ D S  DY+  +CA+K+     + I +  S++CS+ SLDLNYPSFIAFF  N T
Sbjct  25   LDPGLVCDASIDDYVRFLCAMKYISKQIKMITKIYSFDCSHASLDLNYPSFIAFFNRNKT  84

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL  314
            ++    V+EF R +T++   + +Y+AK+  +    + V+ +KLVF +K +K+S+ L
Sbjct  85   VASDKVVREFQRMVTDVAHAMVSYNAKVVAMKGFAIRVMQEKLVFHEKYEKKSFAL  140



>ref|XP_010446287.1| PREDICTED: subtilisin-like protease SDD1 [Camelina sativa]
Length=207

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 93/153 (61%), Gaps = 8/153 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYN--CSNPSLDLNYPSFIAFFPAN  488
            L+PGLI D S QD+IN +C           II  S+ +  C NPS  LNYPS IA+F   
Sbjct  53   LNPGLIYDTSPQDFINFLCHNAKQSRKLINIITRSNLSDACKNPSPYLNYPSIIAYF---  109

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               SD N  + F RTLTN+G+  ++YS ++  +  +NV V P +L+F +K++K SY +R+
Sbjct  110  --TSDQNGPKIFRRTLTNVGEAKTSYSVRVRGLKGLNVVVEPKRLMFREKNEKLSYSVRL  167

Query  307  EAPSTMGDFLVFGSLTWV-ENAGKHVVRSPIVA  212
            E+P  + + +V+GS++W  E+  K  VR  +VA
Sbjct  168  ESPRALQENVVYGSVSWFDEDETKSEVRCSVVA  200



>gb|EAY76626.1| hypothetical protein OsI_04578 [Oryza sativa Indica Group]
Length=551

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 84/146 (58%), Gaps = 4/146 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGL+ D   +D++ L+C+  FT      I R+ +YNCS  + D+NYPSFIA F AN T
Sbjct  405  MDPGLVYDAGPEDFVELLCSTNFTAAQIMAITRSKAYNCSFSTNDMNYPSFIAVFGANDT  464

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D      F RT+TN+G G +TY A      NV VTV P+ LVFT+     S+ + +  
Sbjct  465  SGD----MRFSRTVTNVGAGAATYRAFSVSPSNVEVTVSPETLVFTEVGQTASFLVDLNL  520

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRS  224
             +  G    FG++ W + +GK+ VR+
Sbjct  521  TAPTGGEPAFGAVIWADVSGKYEVRT  546



>ref|XP_004972264.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 89/150 (59%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSS-YNCSNPSLDLNYPSFIAFFPANA  485
            +DPGL+ D   +D++ L+CA  +T      I R+S+ YNCS+ S D+NYPSF+A F ANA
Sbjct  613  MDPGLVFDAGPEDFVALLCAANYTNAQIMAITRSSAAYNCSSASSDVNYPSFVAIFGANA  672

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
            T SD      F RT+TN+G G + Y A      NV+V+V P  L F+      S+++ I+
Sbjct  673  TSSD----MRFKRTVTNVGAGSTVYHASWVSPRNVDVSVSPATLEFSTVGQTASFEVDIK  728

Query  304  APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
              +  G    FG++ W + +GK+ VR+P V
Sbjct  729  LSAPTGGEPAFGAVVWADVSGKYRVRTPYV  758



>gb|KEH18652.1| subtilase family protein, putative [Medicago truncatula]
Length=253

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 88/150 (59%), Gaps = 29/150 (19%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            LDPGL+ DV +QDY+NL+  + FT  H  TI R++  +CS PSLD+N+P FIAFF     
Sbjct  124  LDPGLLYDVGAQDYVNLLYGLNFTQKHITTITRSTFNDCSKPSLDINHPFFIAFF-----  178

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                                 + Y A +TPI   +V+V+P+KLVF +K++K  +KLR E 
Sbjct  179  ---------------------NVYVANITPIKGFHVSVIPNKLVFHEKNEKLRFKLRNEV  217

Query  301  PS-TMGDFLVFGSLTWVENAGKHVVRSPIV  215
             S T    L FG LTW++ +  HVVRSP+V
Sbjct  218  GSMTRLKKLDFGYLTWMDVS--HVVRSPVV  245



>gb|KCW44172.1| hypothetical protein EUGRSUZ_L024071, partial [Eucalyptus grandis]
Length=360

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 87/150 (58%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D++ QDYI  +C++ +T      +IR   +NCS    DLNYPSFIA + +N T
Sbjct  213  MDPGLIYDLNLQDYIEFLCSLGYTDKQMSAVIRRGQWNCSRSDGDLNYPSFIAVY-SNKT  271

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S   +V+ F+R +TN+GD  S Y A +     + V V P  L FT   +KQS+ L IE 
Sbjct  272  GSP--KVKSFNRVVTNVGDDSSVYQAIVASPKEMTVIVQPSNLTFTHMYEKQSFHLTIEV  329

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
               +   + +G L WV+    HVV SPIVA
Sbjct  330  -DQLATGVTYGYLKWVDQH-NHVVSSPIVA  357



>gb|KDO36171.1| hypothetical protein CISIN_1g030998mg [Citrus sinensis]
Length=167

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 87/157 (55%), Gaps = 13/157 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGL+ D+  QDY+N +CA+ +T    + +  TS + C + +LDLNYPSFI     + T
Sbjct  1    MDPGLVYDIEIQDYLNYLCAMNYTSQQIRVVTGTSDFTCEHGNLDLNYPSFIIILNNSNT  60

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKL-TPIGNVNVTVVPDKLVFTKKSDKQSYKLRI-  308
             S       F R LTN+ D  STY+A +  P+G + VTV P  L F  K  K  + L + 
Sbjct  61   AS-----FTFKRVLTNVADTRSTYTAAVKAPVG-MTVTVEPATLSFAGKFSKAEFSLTVN  114

Query  307  ----EAPSTMGDFLV-FGSLTWVENAGKHVVRSPIVA  212
                 A S   +FL  FG LTW E   KH VRSPIVA
Sbjct  115  INLGNAFSPKSNFLGNFGYLTWYEVKRKHTVRSPIVA  151



>gb|EEE55729.1| hypothetical protein OsJ_04215 [Oryza sativa Japonica Group]
Length=715

 Score =   112 bits (281),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 59/149 (40%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGL+ D   +D++ L+C+  FT      I R+ +YNCS  + D+NYPSFIA F AN T
Sbjct  569  MDPGLVYDAGPEDFVELLCSTNFTAAQIMAITRSKAYNCSFSTNDMNYPSFIAVFGANDT  628

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D      F RT+TN+G G +TY A      NV VTV P+ LVFT+     S+ + +  
Sbjct  629  SGD----MRFSRTVTNVGAGAATYRAFSVSPSNVEVTVSPETLVFTEVGQTASFLVDLNL  684

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +  G    FG++ W + +GK+ VR+  V
Sbjct  685  TAPTGGEPAFGAVIWADVSGKYEVRTHYV  713



>dbj|BAD82002.1| putative subtilase [Oryza sativa Japonica Group]
Length=757

 Score =   112 bits (281),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 59/149 (40%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGL+ D   +D++ L+C+  FT      I R+ +YNCS  + D+NYPSFIA F AN T
Sbjct  611  MDPGLVYDAGPEDFVELLCSTNFTAAQIMAITRSKAYNCSFSTNDMNYPSFIAVFGANDT  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
              D      F RT+TN+G G +TY A      NV VTV P+ LVFT+     S+ + +  
Sbjct  671  SGD----MRFSRTVTNVGAGAATYRAFSVSPSNVEVTVSPETLVFTEVGQTASFLVDLNL  726

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
             +  G    FG++ W + +GK+ VR+  V
Sbjct  727  TAPTGGEPAFGAVIWADVSGKYEVRTHYV  755



>ref|XP_010068558.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=765

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 87/150 (58%), Gaps = 5/150 (3%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D++ QDYI  +C++ +T      +IR   +NCS    DLNYPSFIA + +N T
Sbjct  618  MDPGLIYDLNLQDYIEFLCSLGYTDKQMSAVIRRGQWNCSRSDGDLNYPSFIAVY-SNKT  676

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
             S   +V+ F+R +TN+GD  S Y A +     + V V P  L FT   +KQS+ L IE 
Sbjct  677  GSP--KVKSFNRVVTNVGDDSSVYQAIVASPKEMTVIVQPSNLTFTHMYEKQSFHLTIEV  734

Query  301  PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
               +   + +G L WV+    HVV SPIVA
Sbjct  735  -DKLATGVTYGYLKWVDQH-NHVVSSPIVA  762



>ref|XP_006847079.1| hypothetical protein AMTR_s00017p00212440 [Amborella trichopoda]
 gb|ERN08660.1| hypothetical protein AMTR_s00017p00212440 [Amborella trichopoda]
Length=762

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 92/159 (58%), Gaps = 19/159 (12%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D+S QDYI+ +C++ +T    + I R S+Y C+  + D+NYPSF+     N +
Sbjct  610  MDPGLIYDLSVQDYIDFVCSLNYTQEQVRIITRRSNYTCTTSNFDINYPSFMVILYNNVS  669

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKL-TPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE  305
                   Q F R LTN+ D  + Y A +  PIG +NVTV P  L F  K   Q++ LR+E
Sbjct  670  ------TQTFKRVLTNVQDSPAVYHAVVEAPIG-MNVTVEPQALSFGPKGSTQAFTLRVE  722

Query  304  A------PST--MGDFLVFGSLTWVENAGKHVVRSPIVA  212
                   P +  +G+   +G L+W++   KHVVRSPIV+
Sbjct  723  VDLGGMRPESNYIGN---YGHLSWIDKEQKHVVRSPIVS  758



>gb|KCW68720.1| hypothetical protein EUGRSUZ_F02324 [Eucalyptus grandis]
Length=391

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 86/154 (56%), Gaps = 13/154 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPG I D++ QDYI  +C++ +T      +IR   +NCS  + DLNYPSF+  F   + 
Sbjct  244  MDPGFIYDLNLQDYIEFLCSLGYTEKQMSAVIRRGQWNCSQSNGDLNYPSFVTIF---SN  300

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSY----KL  314
             +D  +V+ F R LTN+GD  S Y A +     + VT+ P  L FT K +KQ++    K+
Sbjct  301  KTDSTKVKSFKRVLTNVGDDSSVYQAIVECPKEMKVTLQPSNLTFTHKHEKQNFHLIMKV  360

Query  313  RIEAPSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
             + AP      + +G L WV+    HVV  PIVA
Sbjct  361  DMSAPR-----VTYGYLKWVDQR-NHVVSRPIVA  388



>ref|XP_006847081.1| hypothetical protein AMTR_s00017p00213940 [Amborella trichopoda]
 gb|ERN08662.1| hypothetical protein AMTR_s00017p00213940 [Amborella trichopoda]
Length=516

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 87/156 (56%), Gaps = 13/156 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            +DPGLI D+  QDYI+ +C++ +T    + I R S+Y C+  + D+NYPSF+     N +
Sbjct  364  MDPGLIYDIGVQDYIDFVCSLNYTQKQVRIITRRSNYTCTTSNFDINYPSFMVILYNNVS  423

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIEA  302
                   Q F R LTN+ D  + Y A +     +NVTV P  L F  K   Q++ LR++ 
Sbjct  424  ------SQTFKRVLTNVQDSPAVYHAMVEAQIGMNVTVEPQALSFGPKGSTQAFTLRVDV  477

Query  301  ------PSTMGDFLVFGSLTWVENAGKHVVRSPIVA  212
                  P++ G    +G L+W++   KHVVRSPIV+
Sbjct  478  DLGGMRPNS-GYIGNYGHLSWIDKEHKHVVRSPIVS  512



>ref|XP_010464539.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=738

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 8/153 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYN--CSNPSLDLNYPSFIAFFPAN  488
            L+PGLI D S QD+IN +C           II  S+ +  C NPS  LNYPS IA+F   
Sbjct  584  LNPGLIYDTSPQDFINFVCHNAKQSRKLINIITRSNLSDACKNPSPYLNYPSIIAYF---  640

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               SD N  + F RTLTN+G+   +YS ++  +  +NV V P +L+F++K++K SY +R+
Sbjct  641  --TSDQNGPKTFRRTLTNVGEAKRSYSVRVRGLKGLNVVVEPKRLMFSEKNEKLSYTVRL  698

Query  307  EAPSTMGDFLVFGSLTWV-ENAGKHVVRSPIVA  212
            E+P  + + +V+GS++W  E+  K  V   +VA
Sbjct  699  ESPRALQENVVYGSVSWFDEDEAKSEVSCSVVA  731



>ref|XP_007224572.1| hypothetical protein PRUPE_ppa1027224mg [Prunus persica]
 gb|EMJ25771.1| hypothetical protein PRUPE_ppa1027224mg [Prunus persica]
Length=760

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 84/153 (55%), Gaps = 13/153 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            ++PGLI D+  QDYI  +C + +T      +IR S ++C     +LNYPSFIA F  N T
Sbjct  613  MNPGLIYDMDVQDYIEFLCGLGYTAKQMSAVIRRSQWSCRQQPTELNYPSFIAIF--NGT  670

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE-  305
               P + + F R +TN+GDG S Y A L     + + V P  L FT K+ +Q + LR+E 
Sbjct  671  DGSP-KAKNFSRVVTNVGDGTSIYKAFLEVPSGMKIAVEPSSLTFTGKNQEQDFVLRVEI  729

Query  304  ---APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
               AP      + +G L W++    H+V SP+V
Sbjct  730  DNNAPK-----VTYGYLKWIDQQ-NHIVSSPVV  756



>ref|XP_010484555.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=737

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 93/153 (61%), Gaps = 8/153 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYN--CSNPSLDLNYPSFIAFFPAN  488
            L+PGLI D S QD+IN +C           II  S+ +  C NPS  LNYPS IA+F   
Sbjct  583  LNPGLIYDTSPQDFINFLCHNAKQSRKLINIITRSNLSDACKNPSPHLNYPSIIAYF---  639

Query  487  ATLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRI  308
               SD N  + F RTLTN+G+  ++YS ++  +  +NV + P +L+F++KS+K SY +R+
Sbjct  640  --TSDQNGPKIFRRTLTNVGEAKTSYSVRVRGLKGLNVVIEPKRLMFSEKSEKLSYTVRL  697

Query  307  EAPSTMGDFLVFGSLTWV-ENAGKHVVRSPIVA  212
            E+P  + + +++GS++W  E+  K  V   +VA
Sbjct  698  ESPIALEENVLYGSVSWFDEDEAKSEVSCSVVA  730



>ref|XP_008220348.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=781

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 84/153 (55%), Gaps = 13/153 (8%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTSSYNCSNPSLDLNYPSFIAFFPANAT  482
            ++PGL+ D+  QDYI  +C + +T      +IR S ++C     +LNYPSFIA F  N T
Sbjct  634  MNPGLVYDMDVQDYIEFLCGLGYTAKQMSAVIRRSQWSCRQQPTELNYPSFIAIF--NGT  691

Query  481  LSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKLRIE-  305
               P + + F R +TN+GDG S Y A L     + + V P  L FT K+ +Q + LR+E 
Sbjct  692  DGSP-KAKNFSRVVTNVGDGTSIYKAFLEVPSGMKIAVEPSSLTFTGKNQEQGFVLRVEI  750

Query  304  ---APSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
               AP      + +G L W++    H+V SP+V
Sbjct  751  DNNAPK-----VTYGYLKWIDQQ-NHIVSSPVV  777



>ref|XP_010547521.1| PREDICTED: subtilisin-like protease SDD1 [Tarenaya hassleriana]
Length=755

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNH-TQTIIRTSSYN-CSNPSLDLNYPSFIAFFPAN  488
            L+PGLI D + QD+IN +C V   P    + I R++  N C NPS DLNYP+ IA+F A 
Sbjct  593  LNPGLIYDSTPQDFINFLCHVAKNPMKLVKAITRSNLSNICRNPSPDLNYPAIIAYFTAY  652

Query  487  ATLSDPNRV--QEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYKL  314
               S  N+   + F RTLTN+G+    YS ++  +  +NV V P KLVF +K ++ SY +
Sbjct  653  QDNSGSNQTATKVFRRTLTNVGEAKRNYSVRVRGLEGLNVVVEPKKLVFNEKYERLSYTV  712

Query  313  RIEAPST-MGDFLVFGSLTWVEN-AGKHVVRSPIVA  212
            R+E+P   + + ++ G ++WV++  GK+ V  P++A
Sbjct  713  RLESPRMLLQENVIHGFVSWVDDEEGKYEVSCPVLA  748



>emb|CDM85158.1| unnamed protein product [Triticum aestivum]
Length=764

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 89/152 (59%), Gaps = 8/152 (5%)
 Frame = -1

Query  661  LDPGLIXDVSSQDYINLICAVKFTPNHTQTIIRTS-SYNCSNPSLDLNYPSFIAFFPANA  485
            +DPGL+ D   +D++ L+C+  +T      I R+S +YNCS  S D+NYPSF+A F  NA
Sbjct  616  MDPGLVYDAGPKDFVELLCSANYTNAQIAAITRSSTAYNCSFSSNDVNYPSFVASFGFNA  675

Query  484  TLSDPNRVQEFHRTLTNLGDGISTYSAKLTPIGNVNVTVVPDKLVFTKKSDKQSYK--LR  311
            T  +      F RT+T++G G +TY A      NV V V P  L F+    K S++  ++
Sbjct  676  TSGE----MRFSRTVTSVGSGPATYHASWVSPSNVAVAVTPATLEFSGAGQKISFEVDIK  731

Query  310  IEAPSTMGDFLVFGSLTWVENAGKHVVRSPIV  215
            + AP T G  + +G+L W + +GK+ VR+P V
Sbjct  732  LTAP-TPGGKVAYGALVWTDTSGKYRVRTPYV  762



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320