BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003C10

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631909.1|  PREDICTED: aspartic proteinase Asp1                275   1e-86   Nicotiana tomentosiformis
ref|XP_006346815.1|  PREDICTED: aspartic proteinase Asp1-like           274   2e-86   Solanum tuberosum [potatoes]
ref|XP_009766881.1|  PREDICTED: aspartic proteinase Asp1                271   4e-85   Nicotiana sylvestris
ref|XP_004240685.1|  PREDICTED: aspartic proteinase Asp1                271   5e-85   
dbj|BAD80835.1|  nucellin-like protein                                  254   1e-78   Daucus carota [carrots]
ref|XP_002867175.1|  hypothetical protein ARALYDRAFT_328390             251   2e-77   Arabidopsis lyrata subsp. lyrata
gb|KFK29973.1|  hypothetical protein AALP_AA7G201200                    251   2e-77   Arabis alpina [alpine rockcress]
ref|XP_011099684.1|  PREDICTED: aspartic proteinase Asp1                249   6e-77   Sesamum indicum [beniseed]
ref|NP_001190905.1|  aspartyl protease family protein                   249   6e-77   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43357.1|  putative nucellin                                      249   7e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KJB40494.1|  hypothetical protein B456_007G066800                    248   2e-76   Gossypium raimondii
gb|EYU20602.1|  hypothetical protein MIMGU_mgv1a007047mg                248   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_010025734.1|  PREDICTED: aspartic proteinase Asp1-like           248   2e-76   Eucalyptus grandis [rose gum]
ref|XP_006412352.1|  hypothetical protein EUTSA_v10025289mg             248   2e-76   Eutrema salsugineum [saltwater cress]
emb|CDP04854.1|  unnamed protein product                                248   2e-76   Coffea canephora [robusta coffee]
ref|XP_010527074.1|  PREDICTED: aspartic proteinase Asp1-like           248   3e-76   Tarenaya hassleriana [spider flower]
ref|XP_006282959.1|  hypothetical protein CARUB_v10007649mg             248   3e-76   Capsella rubella
ref|XP_009121783.1|  PREDICTED: aspartic proteinase Asp1                247   5e-76   Brassica rapa
ref|XP_010437756.1|  PREDICTED: aspartic proteinase Asp1-like           246   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010432554.1|  PREDICTED: aspartic proteinase Asp1-like           246   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_007048530.1|  Eukaryotic aspartyl protease family protein ...    245   2e-75   
ref|XP_002310541.2|  hypothetical protein POPTR_0007s04800g             245   3e-75   
emb|CDX68982.1|  BnaC01g04710D                                          245   4e-75   
ref|XP_010447234.1|  PREDICTED: aspartic proteinase Asp1-like           244   1e-74   Camelina sativa [gold-of-pleasure]
gb|KGN62238.1|  hypothetical protein Csa_2G338820                       242   2e-74   Cucumis sativus [cucumbers]
ref|XP_002522918.1|  nucellin, putative                                 243   2e-74   Ricinus communis
gb|ABK95151.1|  unknown                                                 242   3e-74   Populus trichocarpa [western balsam poplar]
ref|XP_002307058.2|  nucellin family protein                            242   3e-74   
emb|CDX75359.1|  BnaA01g03430D                                          243   3e-74   
ref|XP_006382886.1|  hypothetical protein POPTR_0005s07070g             242   3e-74   
ref|XP_004147327.1|  PREDICTED: aspartic proteinase Asp1-like           242   4e-74   
ref|XP_004163385.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    242   4e-74   
ref|XP_006380399.1|  nucellin family protein                            241   4e-74   
ref|XP_007211687.1|  hypothetical protein PRUPE_ppa005961mg             243   4e-74   Prunus persica
ref|XP_008227592.1|  PREDICTED: aspartic proteinase Asp1                242   5e-74   Prunus mume [ume]
ref|XP_008460824.1|  PREDICTED: aspartic proteinase Asp1 isoform X3     239   3e-73   Cucumis melo [Oriental melon]
emb|CAB38807.1|  nucellin-like protein                                  239   5e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KDP24798.1|  hypothetical protein JCGZ_25323                         239   1e-72   Jatropha curcas
ref|XP_008460823.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     239   1e-72   Cucumis melo [Oriental melon]
ref|XP_008460822.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     239   1e-72   Cucumis melo [Oriental melon]
ref|XP_011022861.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    237   5e-72   Populus euphratica
ref|XP_009350136.1|  PREDICTED: aspartic proteinase Asp1-like           237   6e-72   Pyrus x bretschneideri [bai li]
ref|XP_011031099.1|  PREDICTED: aspartic proteinase Asp1-like           237   6e-72   Populus euphratica
gb|EPS67652.1|  hypothetical protein M569_07122                         236   8e-72   Genlisea aurea
ref|XP_010111255.1|  Aspartic proteinase Asp1                           236   1e-71   Morus notabilis
ref|XP_002273988.1|  PREDICTED: aspartic proteinase Asp1                236   1e-71   Vitis vinifera
ref|XP_008361087.1|  PREDICTED: aspartic proteinase Asp1-like           235   2e-71   
ref|XP_010547875.1|  PREDICTED: aspartic proteinase Asp1                233   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_006432088.1|  hypothetical protein CICLE_v10001122mg             233   2e-70   
ref|XP_006464925.1|  PREDICTED: aspartic proteinase Asp1-like           233   2e-70   Citrus sinensis [apfelsine]
gb|KDO52221.1|  hypothetical protein CISIN_1g013774mg                   232   4e-70   Citrus sinensis [apfelsine]
emb|CAN73001.1|  hypothetical protein VITISV_037997                     231   7e-70   Vitis vinifera
ref|XP_009355861.1|  PREDICTED: aspartic proteinase Asp1-like           231   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_011022860.1|  PREDICTED: aspartic proteinase Asp1-like           231   2e-69   Populus euphratica
ref|XP_009355862.1|  PREDICTED: aspartic proteinase Asp1-like           230   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_010674354.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     229   3e-69   
ref|XP_010674353.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     229   9e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006432093.1|  hypothetical protein CICLE_v10001115mg             228   1e-68   
ref|XP_006464928.1|  PREDICTED: aspartic proteinase Asp1-like iso...    227   3e-68   
ref|XP_006432092.1|  hypothetical protein CICLE_v10001115mg             228   4e-68   
ref|XP_006464927.1|  PREDICTED: aspartic proteinase Asp1-like iso...    227   6e-68   
gb|AFK47184.1|  unknown                                                 214   2e-65   Lotus japonicus
ref|XP_007159874.1|  hypothetical protein PHAVU_002G275100g             220   2e-65   Phaseolus vulgaris [French bean]
ref|XP_003532363.2|  PREDICTED: aspartic proteinase Asp1-like           218   1e-64   Glycine max [soybeans]
gb|KHN20145.1|  Aspartic proteinase Asp1                                217   3e-64   Glycine soja [wild soybean]
gb|KCW62450.1|  hypothetical protein EUGRSUZ_H05085                     211   5e-64   Eucalyptus grandis [rose gum]
gb|AES72936.2|  eukaryotic aspartyl protease family protein             216   1e-63   Medicago truncatula
ref|XP_006596210.1|  PREDICTED: aspartic proteinase Asp1-like iso...    216   1e-63   Glycine max [soybeans]
ref|XP_010243511.1|  PREDICTED: aspartic proteinase Asp1                216   1e-63   Nelumbo nucifera [Indian lotus]
ref|XP_009393816.1|  PREDICTED: aspartic proteinase Asp1-like           215   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003630348.1|  Aspartic proteinase Asp1                           214   3e-63   Medicago truncatula
ref|XP_010027413.1|  PREDICTED: aspartic proteinase Asp1-like           214   4e-63   
ref|XP_009420564.1|  PREDICTED: aspartic proteinase Asp1-like           213   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006472808.1|  PREDICTED: aspartic proteinase Asp1-like iso...    213   7e-63   Citrus sinensis [apfelsine]
ref|XP_003524315.1|  PREDICTED: aspartic proteinase Asp1-like           213   1e-62   Glycine max [soybeans]
ref|XP_006472807.1|  PREDICTED: aspartic proteinase Asp1-like iso...    213   3e-62   Citrus sinensis [apfelsine]
ref|XP_006434233.1|  hypothetical protein CICLE_v10003265mg             211   7e-62   Citrus clementina [clementine]
ref|XP_009404862.1|  PREDICTED: aspartic proteinase Asp1-like           210   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011468243.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     208   4e-61   Fragaria vesca subsp. vesca
ref|XP_003602685.1|  Aspartic proteinase Asp1                           209   4e-61   
gb|KHN31194.1|  Aspartic proteinase Asp1                                206   4e-61   Glycine soja [wild soybean]
gb|AAG51657.1|AC010704_1  nucellin-like protein; 27671-25467            208   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503902.1|  PREDICTED: aspartic proteinase Asp1-like           209   5e-61   Cicer arietinum [garbanzo]
ref|XP_010025732.1|  PREDICTED: aspartic proteinase Asp1-like           208   6e-61   Eucalyptus grandis [rose gum]
ref|NP_177872.3|  aspartyl protease                                     208   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502990.1|  PREDICTED: aspartic proteinase Asp1-like           208   1e-60   Cicer arietinum [garbanzo]
ref|NP_850981.1|  aspartyl protease                                     208   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567922.2|  aspartyl protease family protein                      207   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463205.1|  PREDICTED: aspartic proteinase Asp1-like           201   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008219614.1|  PREDICTED: aspartic proteinase Asp1-like iso...    206   3e-60   Prunus mume [ume]
ref|XP_007223384.1|  hypothetical protein PRUPE_ppa005622mg             206   4e-60   Prunus persica
ref|XP_008219613.1|  PREDICTED: aspartic proteinase Asp1-like iso...    206   5e-60   Prunus mume [ume]
gb|KHN20610.1|  Aspartic proteinase Asp1                                206   7e-60   Glycine soja [wild soybean]
ref|XP_010025731.1|  PREDICTED: aspartic proteinase Asp1-like           206   7e-60   
ref|XP_011458802.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     205   7e-60   Fragaria vesca subsp. vesca
ref|XP_007137749.1|  hypothetical protein PHAVU_009G152700g             206   8e-60   Phaseolus vulgaris [French bean]
ref|XP_007223385.1|  hypothetical protein PRUPE_ppa005622mg             206   9e-60   Prunus persica
ref|XP_007203973.1|  hypothetical protein PRUPE_ppa025075mg             204   1e-59   
ref|XP_010095410.1|  Aspartic proteinase Asp1                           206   1e-59   
ref|XP_004290889.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     205   2e-59   Fragaria vesca subsp. vesca
ref|XP_003522473.1|  PREDICTED: aspartic proteinase Asp1-like           204   2e-59   Glycine max [soybeans]
ref|XP_002889144.1|  hypothetical protein ARALYDRAFT_476912             205   2e-59   
ref|XP_003528065.1|  PREDICTED: aspartic proteinase Asp1-like           204   3e-59   Glycine max [soybeans]
emb|CDX88370.1|  BnaC06g38140D                                          204   5e-59   
ref|XP_010532199.1|  PREDICTED: aspartic proteinase Asp1                202   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_010268980.1|  PREDICTED: aspartic proteinase Asp1-like           204   7e-59   Nelumbo nucifera [Indian lotus]
emb|CDX87518.1|  BnaA07g33550D                                          203   8e-59   
ref|XP_006393742.1|  hypothetical protein EUTSA_v10011529mg             202   8e-59   Eutrema salsugineum [saltwater cress]
emb|CDY41786.1|  BnaC02g13700D                                          202   2e-58   Brassica napus [oilseed rape]
ref|XP_004977228.1|  PREDICTED: aspartic proteinase Asp1-like iso...    201   2e-58   
ref|XP_010930728.1|  PREDICTED: aspartic proteinase Asp1-like           201   2e-58   Elaeis guineensis
ref|XP_010930726.1|  PREDICTED: aspartic proteinase Asp1-like           201   2e-58   
ref|XP_004142705.1|  PREDICTED: aspartic proteinase Asp1-like           201   2e-58   Cucumis sativus [cucumbers]
ref|XP_008466731.1|  PREDICTED: aspartic proteinase Asp1-like           201   3e-58   Cucumis melo [Oriental melon]
gb|KHN47012.1|  Aspartic proteinase Asp1                                199   8e-58   Glycine soja [wild soybean]
gb|EYU31770.1|  hypothetical protein MIMGU_mgv1a006482mg                199   9e-58   Erythranthe guttata [common monkey flower]
ref|XP_008444185.1|  PREDICTED: aspartic proteinase Asp1-like           199   9e-58   Cucumis melo [Oriental melon]
ref|XP_006663866.1|  PREDICTED: aspartic proteinase Asp1-like           198   9e-58   
ref|XP_010479040.1|  PREDICTED: aspartic proteinase Asp1                199   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008781591.1|  PREDICTED: aspartic proteinase Asp1-like           200   1e-57   Phoenix dactylifera
ref|XP_004977226.1|  PREDICTED: aspartic proteinase Asp1-like iso...    200   1e-57   Setaria italica
ref|XP_004498348.1|  PREDICTED: aspartic proteinase Asp1-like           200   1e-57   Cicer arietinum [garbanzo]
ref|XP_003523438.1|  PREDICTED: aspartic proteinase Asp1-like           199   2e-57   
ref|XP_004977227.1|  PREDICTED: aspartic proteinase Asp1-like iso...    199   2e-57   
gb|EYU31771.1|  hypothetical protein MIMGU_mgv1a006482mg                199   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_010063407.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     198   3e-57   Eucalyptus grandis [rose gum]
ref|XP_007019123.1|  Eukaryotic aspartyl protease family protein,...    199   4e-57   
ref|XP_010063406.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     198   7e-57   Eucalyptus grandis [rose gum]
ref|XP_010238658.1|  PREDICTED: aspartic proteinase Asp1-like           198   8e-57   Brachypodium distachyon [annual false brome]
emb|CDP10935.1|  unnamed protein product                                197   8e-57   Coffea canephora [robusta coffee]
ref|XP_010416691.1|  PREDICTED: aspartic proteinase Asp1-like           198   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004171754.1|  PREDICTED: aspartic proteinase Asp1-like           197   1e-56   
gb|EMS63812.1|  Aspartic proteinase Asp1                                197   1e-56   Triticum urartu
ref|XP_006302228.1|  hypothetical protein CARUB_v10020249mg             197   1e-56   Capsella rubella
ref|XP_010322933.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     196   2e-56   Solanum lycopersicum
ref|XP_004242040.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     196   2e-56   Solanum lycopersicum
ref|XP_011069472.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     195   4e-56   
ref|XP_003523437.1|  PREDICTED: aspartic proteinase Asp1-like           196   4e-56   
ref|XP_010428825.1|  PREDICTED: aspartic proteinase Asp1-like           196   4e-56   Camelina sativa [gold-of-pleasure]
gb|KJB29193.1|  hypothetical protein B456_005G089000                    191   4e-56   Gossypium raimondii
ref|XP_009123049.1|  PREDICTED: aspartic proteinase Asp1                195   5e-56   Brassica rapa
emb|CDY10133.1|  BnaC05g03760D                                          195   5e-56   Brassica napus [oilseed rape]
ref|XP_010471942.1|  PREDICTED: aspartic proteinase Asp1-like           196   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004149806.1|  PREDICTED: aspartic proteinase Asp1-like           195   6e-56   Cucumis sativus [cucumbers]
ref|XP_011069464.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     195   9e-56   Sesamum indicum [beniseed]
ref|XP_009106403.1|  PREDICTED: aspartic proteinase Asp1                195   9e-56   Brassica rapa
gb|KEH40514.1|  eukaryotic aspartyl protease family protein             194   9e-56   Medicago truncatula
ref|XP_011468246.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     194   1e-55   Fragaria vesca subsp. vesca
ref|XP_003526637.1|  PREDICTED: aspartic proteinase Asp1-like           194   1e-55   Glycine max [soybeans]
gb|KDP32842.1|  hypothetical protein JCGZ_12134                         195   2e-55   Jatropha curcas
ref|XP_007019119.1|  Eukaryotic aspartyl protease family protein ...    193   2e-55   Theobroma cacao [chocolate]
ref|XP_006390086.1|  hypothetical protein EUTSA_v10018497mg             195   2e-55   Eutrema salsugineum [saltwater cress]
emb|CDY14973.1|  BnaA10g08830D                                          193   2e-55   Brassica napus [oilseed rape]
gb|KEH40515.1|  eukaryotic aspartyl protease family protein             194   2e-55   Medicago truncatula
ref|XP_002888605.1|  hypothetical protein ARALYDRAFT_475850             193   3e-55   Arabidopsis lyrata subsp. lyrata
gb|KFK42141.1|  hypothetical protein AALP_AA2G216700                    194   3e-55   Arabis alpina [alpine rockcress]
ref|XP_009611015.1|  PREDICTED: aspartic proteinase Asp1                192   5e-55   Nicotiana tomentosiformis
gb|KJB29192.1|  hypothetical protein B456_005G089000                    190   5e-55   Gossypium raimondii
emb|CDY12535.1|  BnaC06g00610D                                          192   5e-55   Brassica napus [oilseed rape]
ref|XP_011003438.1|  PREDICTED: aspartic proteinase Asp1-like           192   6e-55   Populus euphratica
gb|EEC68949.1|  hypothetical protein OsI_37668                          192   8e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_010521265.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     192   9e-55   Tarenaya hassleriana [spider flower]
gb|ABA96612.2|  Eukaryotic aspartyl protease family protein, expr...    192   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002520345.1|  nucellin, putative                                 191   2e-54   
ref|NP_175079.1|  aspartyl protease family protein                      191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010521264.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     192   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_006365534.1|  PREDICTED: aspartic proteinase Asp1-like           191   2e-54   Solanum tuberosum [potatoes]
ref|NP_001066301.1|  Os12g0177500                                       191   2e-54   
ref|XP_006303534.1|  hypothetical protein CARUB_v10010968mg             190   3e-54   Capsella rubella
ref|XP_002306645.2|  hypothetical protein POPTR_0005s20210g             190   4e-54   
ref|XP_007137426.1|  hypothetical protein PHAVU_009G126200g             190   5e-54   Phaseolus vulgaris [French bean]
gb|KJB29189.1|  hypothetical protein B456_005G089000                    189   5e-54   Gossypium raimondii
ref|XP_004240544.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     189   6e-54   Solanum lycopersicum
ref|XP_004240543.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     189   8e-54   
gb|KJB29190.1|  hypothetical protein B456_005G089000                    189   8e-54   Gossypium raimondii
ref|XP_009596730.1|  PREDICTED: aspartic proteinase Asp1-like           190   1e-53   Nicotiana tomentosiformis
ref|XP_006355805.1|  PREDICTED: aspartic proteinase Asp1-like iso...    187   1e-53   Solanum tuberosum [potatoes]
ref|XP_009802241.1|  PREDICTED: aspartic proteinase Asp1                188   2e-53   Nicotiana sylvestris
ref|XP_009758779.1|  PREDICTED: aspartic proteinase Asp1-like           188   5e-53   Nicotiana sylvestris
gb|KHG10363.1|  Asparticase Asp1                                        187   6e-53   Gossypium arboreum [tree cotton]
gb|KDO52229.1|  hypothetical protein CISIN_1g015972mg                   186   6e-53   Citrus sinensis [apfelsine]
ref|XP_006355804.1|  PREDICTED: aspartic proteinase Asp1-like iso...    187   7e-53   Solanum tuberosum [potatoes]
ref|XP_004142630.1|  PREDICTED: aspartic proteinase Asp1-like           186   8e-53   Cucumis sativus [cucumbers]
gb|KDO52225.1|  hypothetical protein CISIN_1g015972mg                   186   1e-52   Citrus sinensis [apfelsine]
gb|AES87275.2|  eukaryotic aspartyl protease family protein             186   2e-52   Medicago truncatula
ref|NP_001152116.1|  aspartic proteinase Asp1 precursor                 185   4e-52   
ref|NP_001131929.1|  uncharacterized protein LOC100193320 precursor     185   4e-52   
gb|ACR34528.1|  unknown                                                 185   4e-52   Zea mays [maize]
ref|XP_011027496.1|  PREDICTED: aspartic proteinase Asp1-like iso...    185   4e-52   Populus euphratica
ref|XP_002441914.1|  hypothetical protein SORBIDRAFT_08g004800          184   8e-52   
ref|XP_002302227.1|  nucellin family protein                            184   1e-51   Populus trichocarpa [western balsam poplar]
gb|EMT17342.1|  Aspartic proteinase Asp1                                176   1e-51   
ref|XP_011027495.1|  PREDICTED: aspartic proteinase Asp1-like iso...    184   1e-51   Populus euphratica
ref|XP_006355850.1|  PREDICTED: aspartic proteinase Asp1-like           183   2e-51   
ref|XP_008661408.1|  PREDICTED: uncharacterized protein LOC100193...    184   2e-51   Zea mays [maize]
gb|KJB29183.1|  hypothetical protein B456_005G088900                    180   2e-51   Gossypium raimondii
ref|XP_010025733.1|  PREDICTED: aspartic proteinase Asp1-like           183   2e-51   Eucalyptus grandis [rose gum]
ref|XP_006386369.1|  hypothetical protein POPTR_0002s08190g             184   2e-51   Populus trichocarpa [western balsam poplar]
gb|KJB29184.1|  hypothetical protein B456_005G088900                    179   4e-51   Gossypium raimondii
ref|XP_004502513.1|  PREDICTED: aspartic proteinase Asp1-like           182   5e-51   Cicer arietinum [garbanzo]
gb|EPS72688.1|  hypothetical protein M569_02067                         180   2e-50   Genlisea aurea
ref|XP_004502512.1|  PREDICTED: aspartic proteinase Asp1-like           180   2e-50   Cicer arietinum [garbanzo]
ref|XP_003605080.1|  Aspartic proteinase Asp1                           180   3e-50   
gb|KEH20924.1|  eukaryotic aspartyl protease family protein             180   3e-50   Medicago truncatula
ref|XP_008444184.1|  PREDICTED: aspartic proteinase Asp1-like           180   3e-50   Cucumis melo [Oriental melon]
emb|CBI18999.3|  unnamed protein product                                179   3e-50   Vitis vinifera
ref|XP_010664194.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     179   6e-50   Vitis vinifera
gb|KDO80581.1|  hypothetical protein CISIN_1g014185mg                   174   7e-50   Citrus sinensis [apfelsine]
ref|XP_002285867.2|  PREDICTED: aspartic proteinase Asp1 isoform X1     179   8e-50   Vitis vinifera
gb|KJB29187.1|  hypothetical protein B456_005G088900                    179   1e-49   Gossypium raimondii
ref|XP_011074834.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     178   1e-49   
gb|KJB29182.1|  hypothetical protein B456_005G088900                    179   2e-49   Gossypium raimondii
gb|KJB29181.1|  hypothetical protein B456_005G088900                    179   2e-49   Gossypium raimondii
ref|XP_006472803.1|  PREDICTED: aspartic proteinase Asp1-like iso...    175   3e-48   Citrus sinensis [apfelsine]
gb|AAM76716.1|  nucellin-like aspartic protease                         172   4e-48   Zea mays [maize]
ref|XP_006472802.1|  PREDICTED: aspartic proteinase Asp1-like iso...    174   4e-48   Citrus sinensis [apfelsine]
gb|AAY23266.1|  Similar to nucellin-like aspartic protease              171   5e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KDO80580.1|  hypothetical protein CISIN_1g014185mg                   173   5e-48   Citrus sinensis [apfelsine]
gb|KDO80579.1|  hypothetical protein CISIN_1g014185mg                   174   9e-48   Citrus sinensis [apfelsine]
ref|XP_007019121.1|  Eukaryotic aspartyl protease family protein        174   1e-47   
ref|XP_010680865.1|  PREDICTED: aspartic proteinase Asp1-like           174   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008669793.1|  PREDICTED: aspartic proteinase Asp1                173   1e-47   
ref|XP_003605078.1|  Aspartic proteinase Asp1                           173   1e-47   
gb|ACG42043.1|  aspartic proteinase Asp1 precursor                      172   4e-47   Zea mays [maize]
ref|XP_008807681.1|  PREDICTED: aspartic proteinase Asp1-like           167   2e-45   Phoenix dactylifera
gb|KHG06665.1|  Asparticase Asp1                                        166   2e-45   Gossypium arboreum [tree cotton]
gb|EEC67807.1|  hypothetical protein OsI_35373                          167   2e-45   Oryza sativa Indica Group [Indian rice]
gb|EMT12274.1|  Aspartic proteinase Asp1                                167   2e-45   
ref|NP_001065913.1|  Os11g0183900                                       166   4e-45   
gb|EEE51772.1|  hypothetical protein OsJ_33215                          169   8e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EMS62785.1|  Aspartic proteinase Asp1                                165   8e-45   Triticum urartu
ref|XP_006662787.1|  PREDICTED: aspartic proteinase Asp1-like           165   1e-44   Oryza brachyantha
ref|XP_003577760.1|  PREDICTED: aspartic proteinase Asp1-like           165   2e-44   Brachypodium distachyon [annual false brome]
ref|XP_006856698.1|  hypothetical protein AMTR_s00054p00157640          164   2e-44   
gb|EMT29613.1|  Aspartic proteinase Asp1                                163   8e-44   
ref|XP_004978884.1|  PREDICTED: aspartic proteinase Asp1-like           162   2e-43   Setaria italica
dbj|BAJ99780.1|  predicted protein                                      160   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010912572.1|  PREDICTED: aspartic proteinase Asp1-like           158   4e-42   Elaeis guineensis
gb|KHG10362.1|  Asparticase Asp1                                        159   6e-42   Gossypium arboreum [tree cotton]
ref|XP_007161478.1|  hypothetical protein PHAVU_001G072500g             152   6e-40   Phaseolus vulgaris [French bean]
ref|XP_007019120.1|  Eukaryotic aspartyl protease family protein ...    153   7e-40   
gb|EMT05967.1|  Aspartic proteinase Asp1                                149   1e-39   
gb|ABR18371.1|  unknown                                                 152   2e-39   Picea sitchensis
ref|XP_010912540.1|  PREDICTED: aspartic proteinase Asp1-like           151   2e-39   
ref|XP_002511959.1|  protein with unknown function                      151   6e-39   Ricinus communis
ref|NP_001065918.1|  Os11g0184800                                       145   3e-37   
ref|XP_001783556.1|  predicted protein                                  145   4e-37   
ref|XP_011027498.1|  PREDICTED: aspartic proteinase Asp1-like iso...    144   6e-37   Populus euphratica
ref|XP_001766321.1|  predicted protein                                  144   6e-37   
ref|XP_011027497.1|  PREDICTED: aspartic proteinase Asp1-like iso...    144   7e-37   Populus euphratica
gb|EMS61227.1|  Aspartic proteinase Asp1                                143   7e-37   Triticum urartu
sp|A2ZC67.2|ASP1_ORYSI  RecName: Full=Aspartic proteinase Asp1; S...    142   4e-36   Oryza sativa Indica Group [Indian rice]
gb|AAK81698.1|  aspartyl proteinase                                     142   4e-36   Oryza sativa [red rice]
gb|EEC67810.1|  hypothetical protein OsI_35379                          142   6e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_006662788.1|  PREDICTED: aspartic proteinase Asp1-like           141   6e-36   Oryza brachyantha
gb|EMT27437.1|  Aspartic proteinase Asp1                                141   1e-35   
gb|KJB29188.1|  hypothetical protein B456_005G088900                    140   2e-35   Gossypium raimondii
gb|AAK81699.1|  aspartyl proteinase                                     139   4e-35   Oryza sativa [red rice]
ref|XP_001782061.1|  predicted protein                                  139   8e-35   
gb|EMS52520.1|  Aspartic proteinase Asp1                                138   1e-34   Triticum urartu
emb|CDY18730.1|  BnaC08g08860D                                          137   2e-34   Brassica napus [oilseed rape]
ref|XP_006485774.1|  PREDICTED: aspartic proteinase Asp1-like           138   3e-34   Citrus sinensis [apfelsine]
gb|KDP20103.1|  hypothetical protein JCGZ_05872                         137   6e-34   Jatropha curcas
gb|KDO41977.1|  hypothetical protein CISIN_1g008104mg                   137   7e-34   Citrus sinensis [apfelsine]
ref|XP_006440945.1|  hypothetical protein CICLE_v10019473mg             137   1e-33   Citrus clementina [clementine]
gb|EMT31650.1|  Aspartic proteinase Asp1                                135   1e-33   
gb|KHN32026.1|  Aspartic proteinase Asp1                                136   2e-33   Glycine soja [wild soybean]
ref|XP_011074835.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     134   2e-33   
ref|XP_011012697.1|  PREDICTED: aspartic proteinase Asp1                135   3e-33   Populus euphratica
ref|XP_006354730.1|  PREDICTED: aspartic proteinase Asp1-like           135   4e-33   Solanum tuberosum [potatoes]
ref|XP_009621932.1|  PREDICTED: aspartic proteinase Asp1                135   5e-33   Nicotiana tomentosiformis
gb|AJA74410.1|  aspartic protease                                       134   5e-33   Cicer arietinum [garbanzo]
ref|XP_007152781.1|  hypothetical protein PHAVU_004G159200g             134   5e-33   Phaseolus vulgaris [French bean]
gb|EEE52860.1|  hypothetical protein OsJ_35411                          133   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146528.1|  hypothetical protein                               131   6e-33   
gb|KEH27052.1|  eukaryotic aspartyl protease family protein             134   7e-33   Medicago truncatula
emb|CBI15437.3|  unnamed protein product                                133   9e-33   Vitis vinifera
dbj|BAJ98705.1|  predicted protein                                      134   9e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002452609.1|  hypothetical protein SORBIDRAFT_04g028990          134   1e-32   Sorghum bicolor [broomcorn]
ref|XP_010663584.1|  PREDICTED: aspartic proteinase Asp1                133   1e-32   
ref|XP_009776622.1|  PREDICTED: aspartic proteinase Asp1                133   2e-32   
gb|KHN20716.1|  Aspartic proteinase Asp1                                133   2e-32   
ref|XP_004241624.1|  PREDICTED: aspartic proteinase Asp1                133   2e-32   
ref|XP_006583400.1|  PREDICTED: aspartic proteinase Asp1-like           133   2e-32   
gb|KHG03472.1|  Asparticase Asp1                                        132   3e-32   
gb|KJB39307.1|  hypothetical protein B456_007G006200                    132   3e-32   
gb|EEC67809.1|  hypothetical protein OsI_35378                          130   3e-32   
ref|XP_006826817.1|  hypothetical protein AMTR_s00010p00056950          132   4e-32   
ref|XP_010094778.1|  Aspartic proteinase Asp1                           132   4e-32   
ref|XP_010036874.1|  PREDICTED: aspartic proteinase Asp1                132   5e-32   
ref|XP_008813298.1|  PREDICTED: aspartic proteinase Asp1                131   7e-32   
ref|XP_004512995.1|  PREDICTED: lysine-specific histone demethyla...    134   1e-31   
ref|NP_001146721.1|  uncharacterized protein LOC100280323               130   2e-31   
gb|ACN34727.1|  unknown                                                 130   2e-31   
ref|NP_001077691.1|  aspartyl protease                                  129   2e-31   
ref|XP_004980239.1|  PREDICTED: aspartic proteinase Asp1-like           129   2e-31   
ref|XP_011097005.1|  PREDICTED: aspartic proteinase Asp1                130   2e-31   
ref|XP_002449123.1|  hypothetical protein SORBIDRAFT_05g005430          129   2e-31   
ref|XP_010549131.1|  PREDICTED: aspartic proteinase Asp1                130   3e-31   
ref|XP_008658519.1|  PREDICTED: uncharacterized protein LOC100280...    129   4e-31   
ref|XP_007036500.1|  Eukaryotic aspartyl protease family protein,...    129   4e-31   
ref|NP_564539.1|  aspartyl protease                                     129   5e-31   
ref|XP_010908260.1|  PREDICTED: aspartic proteinase Asp1                129   5e-31   
ref|XP_010265186.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     129   6e-31   
ref|XP_009107742.1|  PREDICTED: aspartic proteinase Asp1-like           121   9e-31   
ref|XP_003563970.2|  PREDICTED: aspartic proteinase Asp1-like           128   9e-31   
gb|KJB39309.1|  hypothetical protein B456_007G006200                    128   1e-30   
ref|XP_006304522.1|  hypothetical protein CARUB_v10011364mg             128   1e-30   
gb|EYU33023.1|  hypothetical protein MIMGU_mgv1a009434mg                125   2e-30   
ref|XP_010479334.1|  PREDICTED: aspartic proteinase Asp1-like           127   3e-30   
ref|XP_009406648.1|  PREDICTED: aspartic proteinase Asp1                126   6e-30   
ref|XP_010461710.1|  PREDICTED: aspartic proteinase Asp1-like           125   9e-30   
ref|XP_002891474.1|  aspartyl protease family protein                   125   1e-29   
ref|XP_010500446.1|  PREDICTED: aspartic proteinase Asp1-like           125   1e-29   
emb|CDO98445.1|  unnamed protein product                                125   1e-29   
ref|XP_006656867.1|  PREDICTED: aspartic proteinase Asp1-like           123   2e-29   
ref|XP_004965200.1|  PREDICTED: aspartic proteinase Asp1-like           123   7e-29   
gb|KFK36042.1|  hypothetical protein AALP_AA4G070400                    122   9e-29   
ref|XP_003570503.1|  PREDICTED: aspartic proteinase Asp1-like           122   1e-28   
emb|CDY60079.1|  BnaA05g36440D                                          122   2e-28   
ref|XP_009144992.1|  PREDICTED: aspartic proteinase Asp1                122   2e-28   
dbj|BAK05301.1|  predicted protein                                      120   2e-28   
gb|EMT01144.1|  Aspartic proteinase Asp1                                120   2e-28   
gb|AAB96882.1|  nucellin                                                120   3e-28   
ref|XP_002449122.1|  hypothetical protein SORBIDRAFT_05g005410          119   6e-28   
ref|XP_010265185.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     120   7e-28   
gb|AAB97155.1|  EEA1                                                    119   1e-27   
ref|XP_004971953.1|  PREDICTED: aspartic proteinase Asp1-like           117   2e-27   
gb|EMT27436.1|  Aspartic proteinase Asp1                                117   5e-27   
emb|CDY04326.1|  BnaC05g25880D                                          116   2e-26   
ref|NP_001057353.1|  Os06g0268700                                       115   3e-26   
gb|EMS61228.1|  Aspartic proteinase Asp1                                114   3e-26   
gb|EAZ00454.1|  hypothetical protein OsI_22475                          115   3e-26   
ref|XP_006374352.1|  aspartyl protease family protein                   115   6e-26   
ref|XP_006393315.1|  hypothetical protein EUTSA_v10011346mg             115   6e-26   
gb|KEH32831.1|  eukaryotic aspartyl protease family protein             112   2e-25   
ref|XP_002893981.1|  hypothetical protein ARALYDRAFT_314121             110   5e-25   
dbj|BAJ86250.1|  predicted protein                                      112   8e-25   
gb|KJB39308.1|  hypothetical protein B456_007G006200                    110   1e-24   
gb|EMT29612.1|  Aspartic proteinase Asp1                                109   2e-24   
ref|NP_001048015.1|  Os02g0730700                                       110   3e-24   
gb|EEC73939.1|  hypothetical protein OsI_08807                          110   3e-24   
gb|AFW56223.1|  hypothetical protein ZEAMMB73_420944                    108   4e-24   
gb|KDO80582.1|  hypothetical protein CISIN_1g014185mg                   107   6e-24   
gb|EMT28382.1|  Aspartic proteinase Asp1                                107   1e-23   
emb|CDY43703.1|  BnaA08g05170D                                        99.8    4e-23   
ref|XP_002449121.1|  hypothetical protein SORBIDRAFT_05g005400          105   6e-23   
ref|XP_004137470.1|  PREDICTED: aspartic proteinase Asp1-like           106   8e-23   
ref|XP_008457584.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     105   2e-22   
gb|ACB69715.1|  putative nucellin-like aspartic protease                102   3e-22   
gb|EMT25131.1|  Aspartic proteinase Asp1                              99.8    4e-22   
ref|XP_007152782.1|  hypothetical protein PHAVU_004G159200g             104   5e-22   
ref|XP_006588295.1|  PREDICTED: lysine-specific histone demethyla...    104   1e-21   
ref|XP_004953813.1|  PREDICTED: aspartic proteinase Asp1-like           102   1e-21   
gb|KJB39310.1|  hypothetical protein B456_007G006200                  99.8    2e-20   
gb|KDO37005.1|  hypothetical protein CISIN_1g019849mg                 96.7    3e-20   
gb|ACR37122.1|  unknown                                               89.7    2e-19   
gb|KEH27053.1|  eukaryotic aspartyl protease family protein           87.4    3e-16   
gb|KDO41978.1|  hypothetical protein CISIN_1g008104mg                 87.0    3e-16   
ref|XP_008457519.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   86.7    6e-16   
gb|KCW48539.1|  hypothetical protein EUGRSUZ_K02213                   82.4    1e-14   
ref|XP_010265187.1|  PREDICTED: aspartic proteinase Asp1 isoform X3   78.6    3e-13   
gb|EMT28907.1|  Aspartic proteinase Asp1                              75.9    5e-13   
ref|XP_008811543.1|  PREDICTED: uncharacterized protein LOC103722...  72.8    2e-12   
ref|XP_007036501.1|  Eukaryotic aspartyl protease family protein,...  74.7    4e-12   
gb|KIZ07939.1|  hypothetical protein MNEG_0012                        72.8    6e-12   
ref|XP_003600929.1|  Aspartic proteinase Asp1                         70.5    6e-12   
ref|XP_007048531.1|  Aspartyl protease family protein isoform 2       72.8    1e-11   
ref|XP_010105474.1|  Aspartic proteinase-like protein 2               72.8    2e-11   
ref|XP_010549260.1|  PREDICTED: aspartic proteinase-like protein 2    70.9    1e-10   
ref|XP_010652753.1|  PREDICTED: aspartic proteinase nepenthesin-1...  70.1    2e-10   
ref|XP_010087280.1|  Aspartic proteinase-like protein 2               69.7    3e-10   
gb|KHN47013.1|  Aspartic proteinase Asp1                              65.9    4e-10   
gb|KDO52226.1|  hypothetical protein CISIN_1g015972mg                 67.8    5e-10   
ref|XP_010070617.1|  PREDICTED: aspartic proteinase CDR1-like         68.6    5e-10   
ref|XP_009772172.1|  PREDICTED: aspartic proteinase-like protein 2    68.2    8e-10   
gb|KHN41554.1|  Aspartic proteinase-like protein 2                    67.8    9e-10   
ref|XP_009603173.1|  PREDICTED: aspartic proteinase-like protein ...  67.8    1e-09   
ref|XP_006579920.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    1e-09   
ref|XP_009603172.1|  PREDICTED: aspartic proteinase-like protein ...  67.4    1e-09   
ref|XP_003550988.1|  PREDICTED: aspartic proteinase-like protein ...  67.4    1e-09   
gb|KEH31519.1|  eukaryotic aspartyl protease family protein           67.0    1e-09   
gb|KEH20923.1|  eukaryotic aspartyl protease family protein           64.7    1e-09   
gb|KHN44014.1|  Aspartic proteinase-like protein 2                    67.4    1e-09   
gb|KDP41653.1|  hypothetical protein JCGZ_16060                       67.0    2e-09   
ref|XP_010679567.1|  PREDICTED: aspartic proteinase nepenthesin-2...  67.0    2e-09   
gb|KHN36268.1|  Metal transporter Nramp3                              67.4    2e-09   
ref|XP_002306494.2|  hypothetical protein POPTR_0005s18810g           67.0    2e-09   
ref|XP_006590642.1|  PREDICTED: aspartic proteinase-like protein ...  67.0    2e-09   
gb|AES90651.2|  eukaryotic aspartyl protease family protein           67.0    2e-09   
ref|XP_003608454.1|  Aspartic proteinase nepenthesin-1                67.0    2e-09   
ref|XP_003516613.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    2e-09   
ref|XP_010327522.1|  PREDICTED: aspartic proteinase-like protein ...  66.6    2e-09   
ref|XP_006403297.1|  hypothetical protein EUTSA_v10003167mg           66.6    2e-09   
ref|XP_002510127.1|  Aspartic proteinase nepenthesin-1 precursor,...  66.6    2e-09   
ref|XP_004509090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    3e-09   
ref|XP_010271615.1|  PREDICTED: aspartic proteinase-like protein ...  66.2    3e-09   
ref|XP_004248841.1|  PREDICTED: aspartic proteinase-like protein ...  66.2    3e-09   
ref|XP_011016146.1|  PREDICTED: aspartic proteinase-like protein 2    66.2    3e-09   
ref|XP_011015887.1|  PREDICTED: aspartic proteinase-like protein 2    66.2    3e-09   
gb|EYU43423.1|  hypothetical protein MIMGU_mgv1a0027552mg             65.9    3e-09   
ref|XP_009627686.1|  PREDICTED: aspartic proteinase CDR1-like iso...  65.9    4e-09   
gb|EYU37054.1|  hypothetical protein MIMGU_mgv1a003205mg              65.9    4e-09   
ref|XP_009798809.1|  PREDICTED: aspartic proteinase-like protein 2    65.9    4e-09   
ref|XP_009627749.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    4e-09   
gb|KHG05353.1|  hypothetical protein F383_31391                       65.9    4e-09   
ref|XP_010442078.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    4e-09   
gb|KHG05352.1|  hypothetical protein F383_31391                       65.9    4e-09   
ref|XP_010442075.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    4e-09   
ref|XP_010494278.1|  PREDICTED: aspartic proteinase-like protein ...  65.9    5e-09   
ref|XP_009780676.1|  PREDICTED: aspartic proteinase-like protein ...  65.5    5e-09   
ref|XP_009593347.1|  PREDICTED: aspartic proteinase-like protein 2    65.9    5e-09   
ref|XP_010442076.1|  PREDICTED: aspartic proteinase-like protein ...  65.5    5e-09   
ref|XP_010494280.1|  PREDICTED: aspartic proteinase-like protein ...  65.5    5e-09   
ref|XP_010442077.1|  PREDICTED: aspartic proteinase-like protein ...  65.5    5e-09   
ref|XP_004244902.1|  PREDICTED: aspartic proteinase-like protein 2    65.5    5e-09   
ref|XP_010494279.1|  PREDICTED: aspartic proteinase-like protein ...  65.5    5e-09   
ref|XP_009780684.1|  PREDICTED: aspartic proteinase-like protein ...  65.5    5e-09   
dbj|BAK02500.1|  predicted protein                                    65.5    6e-09   
ref|XP_009780671.1|  PREDICTED: aspartic proteinase-like protein ...  65.5    6e-09   
ref|XP_006339969.1|  PREDICTED: aspartic proteinase-like protein ...  65.5    6e-09   
ref|NP_001168795.1|  uncharacterized protein LOC100382594 precursor   65.1    7e-09   
dbj|BAB08274.1|  unnamed protein product                              65.1    7e-09   
ref|XP_006339968.1|  PREDICTED: aspartic proteinase-like protein ...  65.1    7e-09   
ref|NP_199124.3|  aspartyl protease family protein                    65.1    7e-09   
ref|XP_009360296.1|  PREDICTED: aspartic proteinase CDR1-like         65.1    7e-09   
ref|XP_003562781.1|  PREDICTED: aspartic proteinase-like protein 2    64.7    9e-09   
gb|KFK31741.1|  hypothetical protein AALP_AA6G152800                  64.7    9e-09   
ref|XP_006281624.1|  hypothetical protein CARUB_v10027752mg           64.7    1e-08   
ref|XP_010277146.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    1e-08   
ref|XP_010277145.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    1e-08   
ref|XP_010481907.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    1e-08   
ref|XP_010481906.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    1e-08   
ref|XP_010481905.1|  PREDICTED: aspartic proteinase-like protein ...  64.7    1e-08   
emb|CDY57356.1|  BnaC08g48640D                                        64.7    1e-08   
ref|XP_006374851.1|  hypothetical protein POPTR_0014s02040g           64.7    1e-08   
ref|XP_004958189.1|  PREDICTED: aspartic proteinase-like protein ...  64.3    1e-08   
ref|XP_009101813.1|  PREDICTED: aspartic proteinase-like protein 2    64.3    2e-08   
ref|XP_009393844.1|  PREDICTED: aspartic proteinase nepenthesin-2...  63.9    2e-08   
emb|CDY22367.1|  BnaA06g36890D                                        63.9    2e-08   
gb|KJB14598.1|  hypothetical protein B456_002G132900                  63.9    2e-08   
gb|KJB14595.1|  hypothetical protein B456_002G132900                  63.9    2e-08   
gb|KJB14599.1|  hypothetical protein B456_002G132900                  63.9    2e-08   
ref|XP_006433595.1|  hypothetical protein CICLE_v10000565mg           63.9    2e-08   
ref|XP_006426021.1|  hypothetical protein CICLE_v10025144mg           63.9    2e-08   
gb|KJB14596.1|  hypothetical protein B456_002G132900                  63.9    2e-08   
gb|KJB40297.1|  hypothetical protein B456_007G056000                  63.5    2e-08   
gb|KDO81579.1|  hypothetical protein CISIN_1g010556mg                 63.5    2e-08   
ref|XP_006472263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  63.5    2e-08   
ref|XP_006433596.1|  hypothetical protein CICLE_v10000565mg           63.5    2e-08   
gb|KDO81580.1|  hypothetical protein CISIN_1g010556mg                 63.2    2e-08   
ref|XP_009115686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  63.5    2e-08   
emb|CDP15549.1|  unnamed protein product                              63.5    2e-08   
ref|XP_004511876.1|  PREDICTED: aspartic proteinase-like protein ...  63.5    3e-08   
ref|XP_004289182.1|  PREDICTED: aspartic proteinase CDR1              63.5    3e-08   
ref|XP_010939093.1|  PREDICTED: aspartic proteinase-like protein ...  63.5    3e-08   
ref|XP_010939091.1|  PREDICTED: aspartic proteinase-like protein ...  63.5    3e-08   
gb|KDO81574.1|  hypothetical protein CISIN_1g010556mg                 63.2    3e-08   
gb|KDO81575.1|  hypothetical protein CISIN_1g010556mg                 63.2    3e-08   
gb|KHG13615.1|  hypothetical protein F383_03676                       63.2    3e-08   
gb|KJB40298.1|  hypothetical protein B456_007G056000                  63.2    3e-08   
ref|XP_003611646.1|  Aspartic proteinase-like protein                 63.2    3e-08   
ref|XP_004141399.1|  PREDICTED: aspartic proteinase-like protein ...  63.2    3e-08   
ref|XP_011029041.1|  PREDICTED: aspartic proteinase-like protein 2    63.2    3e-08   
gb|AES94605.2|  eukaryotic aspartyl protease family protein           63.2    3e-08   
ref|XP_001690254.1|  pepsin-type aspartyl protease                    62.8    3e-08   
gb|KHG13614.1|  hypothetical protein F383_03676                       63.2    3e-08   
ref|XP_008811545.1|  PREDICTED: uncharacterized protein LOC103722...  60.1    3e-08   
ref|NP_001060161.1|  Os07g0592200                                     63.2    3e-08   
ref|XP_004164029.1|  PREDICTED: aspartic proteinase-like protein ...  63.2    4e-08   
ref|XP_002463116.1|  hypothetical protein SORBIDRAFT_02g038150        62.8    4e-08   
ref|XP_004292749.1|  PREDICTED: aspartic proteinase-like protein ...  62.8    4e-08   
gb|EEE67511.1|  hypothetical protein OsJ_24961                        62.8    4e-08   
gb|EEC82371.1|  hypothetical protein OsI_26705                        62.8    4e-08   
ref|XP_011458846.1|  PREDICTED: aspartic proteinase-like protein ...  62.8    4e-08   
ref|XP_006466523.1|  PREDICTED: aspartic proteinase-like protein ...  62.8    4e-08   
gb|KDO81578.1|  hypothetical protein CISIN_1g010556mg                 62.4    4e-08   
gb|KDO79034.1|  hypothetical protein CISIN_1g047816mg                 62.8    5e-08   
gb|KHG08697.1|  hypothetical protein F383_11875                       62.8    5e-08   
gb|KHG08698.1|  hypothetical protein F383_11875                       62.8    5e-08   
ref|XP_002865453.1|  predicted protein                                62.4    5e-08   
ref|XP_003611647.1|  Aspartic proteinase-like protein                 62.0    5e-08   
ref|XP_010426548.1|  PREDICTED: aspartic proteinase CDR1-like         62.4    6e-08   
ref|XP_010503675.1|  PREDICTED: aspartic proteinase CDR1-like         62.4    6e-08   
gb|KJB29191.1|  hypothetical protein B456_005G089000                  61.6    6e-08   
gb|KJB29195.1|  hypothetical protein B456_005G089000                  61.6    6e-08   
dbj|BAK03251.1|  predicted protein                                    62.0    7e-08   
ref|XP_002283258.1|  PREDICTED: aspartic proteinase CDR1              62.0    7e-08   
ref|XP_009354126.1|  PREDICTED: aspartic proteinase CDR1-like         62.0    7e-08   
ref|XP_006658761.1|  PREDICTED: aspartic proteinase-like protein ...  62.0    7e-08   
ref|XP_006404068.1|  hypothetical protein EUTSA_v10010198mg           62.0    7e-08   
ref|XP_010515370.1|  PREDICTED: aspartic proteinase CDR1-like iso...  61.6    1e-07   
ref|XP_010515369.1|  PREDICTED: aspartic proteinase CDR1-like iso...  61.6    1e-07   
ref|XP_007155866.1|  hypothetical protein PHAVU_003G238400g           61.6    1e-07   
ref|XP_001767804.1|  predicted protein                                61.2    1e-07   
ref|XP_006361871.1|  PREDICTED: aspartic proteinase-like protein ...  61.2    1e-07   
ref|XP_009395627.1|  PREDICTED: aspartic proteinase nepenthesin-1...  61.2    1e-07   
ref|XP_011091937.1|  PREDICTED: aspartic proteinase-like protein ...  61.2    1e-07   
ref|XP_008812819.1|  PREDICTED: aspartic proteinase nepenthesin-2...  61.2    1e-07   
ref|XP_011091936.1|  PREDICTED: aspartic proteinase-like protein ...  61.2    1e-07   



>ref|XP_009631909.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=431

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   D  KHYS G  EL FGGK+TG KN+ VVFDSGSS+SY+NSQ Y+ F+  + KEL 
Sbjct  251  TPMAHDRMKHYSAGSGELIFGGKATGFKNLFVVFDSGSSFSYLNSQTYQGFISLLKKELN  310

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLREA DD TLP CWKGRRPF++I+DVKKYFK+FALSF +GW+S+  FEI PESYLII
Sbjct  311  GKPLREAKDDYTLPLCWKGRRPFKTINDVKKYFKNFALSFPHGWKSKAHFEIPPESYLII  370

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  109
            SSKGSVCLGVLNGTEAGL N N+IGD+SMQD+MVIYDNEK AIGW+ ANCDRPP  N
Sbjct  371  SSKGSVCLGVLNGTEAGLQNVNLIGDISMQDKMVIYDNEKQAIGWSPANCDRPPKSN  427



>ref|XP_006346815.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=437

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   D  KHYS G  EL FGGK TG+KN+ VVFDSGSS+SY+N+  YE F+  + KEL 
Sbjct  257  TPMAHDRMKHYSAGSGELIFGGKGTGLKNLFVVFDSGSSFSYLNAHTYEGFISLLKKELN  316

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLRE  DD TLP CWKGRRPF++I+DVKKYFK FALSF NGW+S+  FEI PESYLII
Sbjct  317  GKPLRETKDDYTLPLCWKGRRPFKTINDVKKYFKQFALSFGNGWKSKAHFEIPPESYLII  376

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKGSVCLGVLNGTEAGL N N+IGD+SMQD+MVIYDNEK AIGWT ANCDRPP
Sbjct  377  SSKGSVCLGVLNGTEAGLQNVNLIGDISMQDKMVIYDNEKQAIGWTSANCDRPP  430



>ref|XP_009766881.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=433

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   D  KHYS G  EL FGGK+TG KN+ VVFDSGSS+SY+NSQ Y+ F+  + KEL 
Sbjct  253  TPMAHDRMKHYSAGSGELIFGGKATGFKNLFVVFDSGSSFSYLNSQTYQGFISLLKKELN  312

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA DD TLP CWKGRRPF++I+DVKKYFK+F LSF +GW+S+  FEI PESYLII
Sbjct  313  GKPLKEAKDDYTLPLCWKGRRPFKTINDVKKYFKNFVLSFPHGWKSKAHFEIPPESYLII  372

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            SSKGSVCLGVLNGTEAGL N N+IGD+SMQD+MVIYDNEK AIGW+ ANCDRPP  N + 
Sbjct  373  SSKGSVCLGVLNGTEAGLQNVNLIGDISMQDKMVIYDNEKQAIGWSPANCDRPPKSNNMI  432

Query  99   I  97
            +
Sbjct  433  M  433



>ref|XP_004240685.1| PREDICTED: aspartic proteinase Asp1 [Solanum lycopersicum]
Length=427

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   D  KHYS G  EL FGGK TG+KN+ VVFDSGSS+SY+N+  YE F+  + KEL 
Sbjct  247  TPMAHDRMKHYSAGSGELIFGGKGTGLKNLFVVFDSGSSFSYLNAHTYEGFISLLKKELN  306

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLRE  DD TLP CWKGRRPF++I+D KKYFK FALSF NGW+S+  FEI PESYLII
Sbjct  307  GKPLRETKDDYTLPLCWKGRRPFKTINDAKKYFKQFALSFGNGWKSKAHFEIPPESYLII  366

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKGSVCLGVLNGTEAGL N N+IGD+SMQD+MVIYDNEK AIGW  ANCDRPP
Sbjct  367  SSKGSVCLGVLNGTEAGLQNVNLIGDISMQDKMVIYDNEKQAIGWMSANCDRPP  420



>dbj|BAD80835.1| nucellin-like protein [Daucus carota]
Length=426

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY KHY+PG AEL   G+S+G+KN++VVFDSGSSY+Y N+Q Y+  L  + K+L 
Sbjct  246  TPMSRDYLKHYTPGFAELILNGRSSGLKNLLVVFDSGSSYTYFNTQTYQTLLSFIKKDLH  305

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA +D TLP CW+G++PF+SI D KKYFK  ALSF +GW++++ FEI  ESYLII
Sbjct  306  GKPLKEAVEDDTLPVCWRGKKPFKSIRDAKKYFKPLALSFGSGWKTKSQFEIQQESYLII  365

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKGSVCLG+LNGTE GL NYN+IGD+SMQ+++VIYDNEK  IGW  +NCDRPP
Sbjct  366  SSKGSVCLGILNGTEVGLQNYNIIGDISMQEKLVIYDNEKQVIGWQPSNCDRPP  419



>ref|XP_002867175.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43434.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  241  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  300

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  301  SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  360

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  361  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPADCDE  413



>gb|KFK29973.1| hypothetical protein AALP_AA7G201200 [Arabis alpina]
Length=422

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPG-PAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+ +KHYSP    EL FGGK+TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  238  TPMSRENSKHYSPAMGGELLFGGKTTGLKNLMTVFDSGSSYTYFNSKAYQAVTYMIKREL  297

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI DVKKYFK  ALSF  GWRS+TLF+I PE+YLI
Sbjct  298  SGKPLKEARDDHTLPLCWQGRRPFMSIEDVKKYFKPLALSFKTGWRSKTLFQIPPEAYLI  357

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW +A+CD 
Sbjct  358  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWIQADCDE  410



>ref|XP_011099684.1| PREDICTED: aspartic proteinase Asp1 [Sesamum indicum]
Length=422

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            T   RDYTKHY+ G AEL FGGKSTG KN+ V+FDSGSSY+Y +S  Y   L  + KELR
Sbjct  242  TSMARDYTKHYAAGSAELRFGGKSTGFKNLNVIFDSGSSYTYFSSHIYHTLLSLINKELR  301

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
               LREA DD TLPFCWKG++PF+S  DV+KYFK  +LSF NGWR++  FEI PE YLII
Sbjct  302  RTSLREATDDHTLPFCWKGKKPFKSTRDVRKYFKPLSLSFPNGWRAKAQFEIPPEGYLII  361

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  103
            SSKG+ CLG+LNGT+ GL N+N+IGD+SMQD+M+IYDNEK+ IGWT ANCD+ P  N V
Sbjct  362  SSKGNACLGILNGTDVGLSNFNMIGDISMQDKMLIYDNEKHVIGWTPANCDQRPTSNSV  420



>ref|NP_001190905.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAM64443.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE86234.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=425

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  241  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  300

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  301  SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  360

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW   +CD 
Sbjct  361  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPVDCDE  413



>dbj|BAC43357.1| putative nucellin [Arabidopsis thaliana]
Length=413

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  229  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  288

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  289  SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  348

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW   +CD 
Sbjct  349  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPVDCDE  401



>gb|KJB40494.1| hypothetical protein B456_007G066800 [Gossypium raimondii]
Length=426

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            T   +++TK+YSPG AEL FGGK+TG+KN+IV+FDSGSSY+Y+NSQ Y+A    + KEL 
Sbjct  244  TSMSQEFTKYYSPGSAELHFGGKATGIKNLIVIFDSGSSYTYLNSQAYQALTLLLKKELS  303

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFK-SFALSFANGWRSRTLFEISPESYLI  283
            G+ L+EA +D TLP CWKGR+PFRS+ D KKYFK S AL+FAN  R +T FE+ PE+YLI
Sbjct  304  GRSLKEAPEDQTLPLCWKGRKPFRSVHDAKKYFKTSLALAFANSGRRKTQFELHPEAYLI  363

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            IS+KG+VCLG+LNGT+ GL N NVIGD+SMQDRMV+YDNEK  IGW+ ANCD  P
Sbjct  364  ISNKGNVCLGILNGTQVGLQNLNVIGDISMQDRMVVYDNEKQVIGWSPANCDHLP  418



>gb|EYU20602.1| hypothetical protein MIMGU_mgv1a007047mg [Erythranthe guttata]
Length=422

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RD TKHY+ G AEL FGGKSTG KN+ V+FDSGSSY+Y NSQ Y   +  + KEL 
Sbjct  243  TPMSRDDTKHYTAGSAELRFGGKSTGFKNLNVIFDSGSSYTYFNSQIYHTLISLIKKELS  302

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GK L+EA DD TLPFCWKG++PF++  DV+KYFKS +LSF NGWR++  F+I PE YLII
Sbjct  303  GKSLKEASDDRTLPFCWKGKKPFKTTRDVRKYFKSLSLSFVNGWRTKAQFDIPPEGYLII  362

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKG+ CLG+LNGT+ GL N+N+IGD+SMQD++++YDNEK  IGWT ANCD+ P
Sbjct  363  SSKGNACLGILNGTDVGLSNFNMIGDISMQDKLLVYDNEKQVIGWTPANCDQIP  416



>ref|XP_010025734.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62453.1| hypothetical protein EUGRSUZ_H05088 [Eucalyptus grandis]
Length=436

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY+KHYSPG AEL + GK TG KNM +VFDSGSSY+Y +SQ Y+A    V KEL 
Sbjct  256  TPMSRDYSKHYSPGTAELLYAGKPTGQKNMFLVFDSGSSYTYFSSQAYQALSSDVKKELS  315

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
             KP  EA DDPTLP CW+G++PF++I DV KYFK FALSF +G R++T FE+ PESYLII
Sbjct  316  RKPFTEALDDPTLPLCWRGKKPFKNIRDVTKYFKPFALSFNSGGRTKTQFEVLPESYLII  375

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKG+VC+GVLNGT+AGL N NVIGD+SMQD+MVIYDNE+  +GW   +C RPP
Sbjct  376  SSKGNVCMGVLNGTQAGLQNMNVIGDISMQDKMVIYDNERQLLGWESKDCSRPP  429



>ref|XP_006412352.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
 dbj|BAJ34094.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53805.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
Length=424

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+ +KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  238  TPMARENSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  297

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  298  SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  357

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  358  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  410



>emb|CDP04854.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
             P  +D TK YS   AELTFGGK  G+KN+ V+FDSGSSYSY+NSQ Y A +  + K+L+
Sbjct  230  APMSQDSTKRYSVSSAELTFGGKGVGIKNLDVIFDSGSSYSYLNSQAYRAIISLIEKDLK  289

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA DD TLP CW+GR+PF+S+ DV+KYFK   LSF +G R RT FEI P++YLII
Sbjct  290  GKPLKEAKDDRTLPECWRGRKPFKSVHDVRKYFKPLGLSFHHGQRVRTQFEIPPDAYLII  349

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            SSKG+ CLG+LNGTE GL N N+IGD+SMQD+MVIYDNEK AIGW+ ANC RPP  N   
Sbjct  350  SSKGNACLGILNGTEIGLQNVNLIGDISMQDKMVIYDNEKGAIGWSPANCSRPPKSNTFI  409

Query  99   I  97
            +
Sbjct  410  M  410



>ref|XP_010527074.1| PREDICTED: aspartic proteinase Asp1-like [Tarenaya hassleriana]
Length=420

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+++KHYSPGP  EL FGGK+TG+KN++VVFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  236  TPMSREHSKHYSPGPGGELLFGGKTTGLKNLLVVFDSGSSYTYFNSKAYQAVTYLLRREL  295

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL EA DD TLP CW+GRR F SI +VKKYFK  + SF  GWRS++LFEI PE+YLI
Sbjct  296  SGKPLTEARDDHTLPLCWQGRRRFSSIGEVKKYFKPLSFSFKTGWRSKSLFEIPPEAYLI  355

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            IS KG+VCLG+LNGTE GL N N+IGDVSMQD+MVIYDNEK +IGW  ANC+
Sbjct  356  ISMKGNVCLGILNGTEIGLQNLNLIGDVSMQDQMVIYDNEKQSIGWMPANCN  407



>ref|XP_006282959.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
 gb|EOA15857.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
Length=425

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  241  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  300

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GK L+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  301  SGKALKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  360

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  361  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPADCDE  413



>ref|XP_009121783.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=427

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPG-PAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+ +KHYSP    EL FGG++TG+KN++ +FDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  241  TPMSRENSKHYSPAMGGELLFGGRTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYLLKREL  300

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  301  SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  360

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  361  ISRKGNVCLGILNGTEIGLQNMNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>ref|XP_010437756.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  241  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  300

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF +I +VKKYFK  ALSF   WRS++LFEI PE+YLI
Sbjct  301  SGKPLKEARDDHTLPLCWQGRRPFMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLI  360

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  361  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>ref|XP_010432554.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  241  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  300

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF +I +VKKYFK  ALSF   WRS++LFEI PE+YLI
Sbjct  301  SGKPLKEARDDHTLPLCWQGRRPFMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLI  360

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  361  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  413



>ref|XP_007048530.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92687.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=421

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            T   ++ TK+YSPG AEL FGGK+T VKN+IVVFDSGSSY+Y+NSQ Y+     + KEL 
Sbjct  241  TSMSQELTKYYSPGIAELQFGGKATSVKNLIVVFDSGSSYTYLNSQAYQTLTVLLKKELS  300

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            G+ L+EA +D TLP CWKGR+PF+++ DVKKYFK+ AL+FA+  R++T FE+ PE+YLII
Sbjct  301  GRSLKEAPEDQTLPLCWKGRKPFKNVRDVKKYFKTLALAFASSSRTKTQFELPPEAYLII  360

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            S+KG+VCLG+LNGT+ GL N NVIGD+SMQDRMVIYDNEK  IGW  ANCD+ P
Sbjct  361  SNKGNVCLGILNGTQVGLQNLNVIGDISMQDRMVIYDNEKQVIGWAPANCDQLP  414



>ref|XP_002310541.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
 gb|EEE90991.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
Length=430

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
             KHYSPG AELTF GK+TG KN+IV FDSG+SY+Y+NSQ Y+  +  + +EL  KPLREA
Sbjct  257  AKHYSPGFAELTFDGKTTGFKNLIVAFDSGASYTYLNSQVYQGLISLIKRELSTKPLREA  316

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD TLP CWKGR+PF+S+ DVKKYFK+FALSFAN  +S+T  E  PE+YLI+SSKG+ C
Sbjct  317  LDDQTLPICWKGRKPFKSVRDVKKYFKTFALSFANDGKSKTQLEFPPEAYLIVSSKGNAC  376

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            LGVLNGTE GL++ NVIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  377  LGVLNGTEVGLNDLNVIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPKSRSIII  430



>emb|CDX68982.1| BnaC01g04710D [Brassica napus]
Length=430

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPG-PAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+ +K+YSP    EL FGG++TG+KN++ +FDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  244  TPMSRENSKYYSPAMGGELLFGGRTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYVLKREL  303

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  304  SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  363

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  364  ISRKGNVCLGILNGTEIGLQNMNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  416



>ref|XP_010447234.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  241  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  300

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRP  +I +VKKYFK  ALSF   WRS++LFEI PE+YLI
Sbjct  301  SGKPLKEARDDHTLPLCWQGRRPLMNIEEVKKYFKPLALSFKTSWRSKSLFEIPPEAYLI  360

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  361  ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWFPADCDE  413



>gb|KGN62238.1| hypothetical protein Csa_2G338820 [Cucumis sativus]
Length=387

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY KHYSPG  EL F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL 
Sbjct  207  TPMSRDYPKHYSPGFGELIFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELA  266

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLREA DD TLP CW+GR+P +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+II
Sbjct  267  GKPLREAMDDDTLPLCWRGRKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMII  326

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  106
            SS G+VCLG+LNGT+ GL N N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  327  SSMGNVCLGILNGTDVGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  384



>ref|XP_002522918.1| nucellin, putative [Ricinus communis]
 gb|EEF39461.1| nucellin, putative [Ricinus communis]
Length=433

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RD+ KHYSPG AEL F GKSTG++N++VVFDSGSSY+Y+N+Q Y+  ++S+ +EL 
Sbjct  251  TPMSRDHLKHYSPGFAELIFDGKSTGIRNLLVVFDSGSSYTYLNAQAYQHLVFSLKRELS  310

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSF--ANGWRSRTLFEISPESYL  286
             KP+ EA DD TLP CWKG+RPF+SI DVKKYFK FAL F  ++G  S+T FE SPE+YL
Sbjct  311  RKPISEALDDQTLPLCWKGKRPFKSIRDVKKYFKPFALVFKTSSGRSSKTQFEFSPEAYL  370

Query  285  IISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            IISSKG+ CLG+LNGTE GL + NVIGDVSM DR+VIY+NEK  IGW  A+CDR P
Sbjct  371  IISSKGNACLGILNGTEVGLRDLNVIGDVSMLDRLVIYNNEKQMIGWAAASCDRLP  426



>gb|ABK95151.1| unknown [Populus trichocarpa]
Length=393

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
             KHYSPG AELTF GK+TG KN++  FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA
Sbjct  220  AKHYSPGLAELTFDGKTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREA  279

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD TLP CWKGR+PF+SI DVKKYFK+FALSF N  +S+T  E  PE+YLIISSKG+ C
Sbjct  280  LDDQTLPLCWKGRKPFKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNAC  339

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            LG+LNGTE GL++ NVIGD+SMQDR+VIYDNEK  IGW   NC+R P      I
Sbjct  340  LGILNGTEVGLNDLNVIGDISMQDRVVIYDNEKERIGWAPGNCNRLPKSKSFII  393



>ref|XP_002307058.2| nucellin family protein [Populus trichocarpa]
 gb|EEE94054.2| nucellin family protein [Populus trichocarpa]
Length=394

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
             KHYSPG AELTF GK+TG KN++  FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA
Sbjct  221  AKHYSPGLAELTFDGKTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREA  280

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD TLP CWKGR+PF+SI DVKKYFK+FALSF N  +S+T  E  PE+YLIISSKG+ C
Sbjct  281  LDDQTLPLCWKGRKPFKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNAC  340

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            LG+LNGTE GL++ NVIGD+SMQDR+VIYDNEK  IGW   NC+R P      I
Sbjct  341  LGILNGTEVGLNDLNVIGDISMQDRVVIYDNEKERIGWAPGNCNRLPKSKSFII  394



>emb|CDX75359.1| BnaA01g03430D [Brassica napus]
Length=429

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPG-PAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            T   R+ +KHYSP    EL FGG++TG+KN++ +FDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  243  TSMSRENSKHYSPAMGGELLFGGRTTGLKNLLTIFDSGSSYTYFNSKAYQAVTYLLKREL  302

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF +I +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  303  SGKPLKEARDDHTLPLCWQGRRPFMNIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  362

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW  A+CD 
Sbjct  363  ISRKGNVCLGILNGTEIGLQNMNLIGDISMQDQMIIYDNEKQSIGWIPADCDE  415



>ref|XP_006382886.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
 gb|ERP60683.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
Length=393

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
             KHYSPG AELTF GK+TG KN++  FDSG+SY+Y+NSQ Y+  +  + KEL GKPLREA
Sbjct  220  AKHYSPGLAELTFDGKTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELSGKPLREA  279

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD TLP CWKGR+PF+SI DVKKYFK+FALSF N  +S+T  E  PE+YLIISSKG+ C
Sbjct  280  LDDQTLPLCWKGRKPFKSIRDVKKYFKTFALSFTNERKSKTELEFPPEAYLIISSKGNAC  339

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            LG+LNGTE GL++ NVIGD+SMQDR+VIYDNEK  IGW   NC+R P      I
Sbjct  340  LGILNGTEVGLNDLNVIGDISMQDRVVIYDNEKERIGWAPGNCNRLPKSKSFII  393



>ref|XP_004147327.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=418

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY KHYSPG  EL F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL 
Sbjct  238  TPMSRDYPKHYSPGFGELIFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELA  297

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLREA DD TLP CW+GR+P +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+II
Sbjct  298  GKPLREAMDDDTLPLCWRGRKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMII  357

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  106
            SS G+VCLG+LNGT+ GL N N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  358  SSMGNVCLGILNGTDVGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  415



>ref|XP_004163385.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Cucumis sativus]
Length=418

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY KHYSPG  EL F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL 
Sbjct  238  TPMSRDYPKHYSPGFGELIFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELA  297

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLREA DD TLP CW+GR+P +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+II
Sbjct  298  GKPLREAMDDDTLPLCWRGRKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPTEGYMII  357

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  106
            SS G+VCLG+LNGT+ GL N N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  358  SSMGNVCLGILNGTDVGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  415



>ref|XP_006380399.1| nucellin family protein [Populus trichocarpa]
 gb|ERP58196.1| nucellin family protein [Populus trichocarpa]
Length=387

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
             KHYSPG AELTF GK+TG  N+IV FDSG+SY+Y+NSQ Y+  +  + +EL  KPLREA
Sbjct  214  AKHYSPGFAELTFDGKTTGFINLIVAFDSGASYTYLNSQAYQGLISLIKRELSTKPLREA  273

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD TLP CWKGR+PF+S+ DV KYFK+FALSFAN  +S+T  E  PE+YLI+SSKG+ C
Sbjct  274  LDDQTLPICWKGRKPFKSVHDVNKYFKTFALSFANDGKSKTQLEFPPEAYLIVSSKGNAC  333

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            LGVLNGTE GL++ NVIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  334  LGVLNGTEVGLNDLNVIGDISMQDRVVIYDNEKQLIGWAPRNCDRIPKSRSIII  387



>ref|XP_007211687.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
 gb|EMJ12886.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
Length=435

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY KHYSPG AEL  GGKSTG +N+++VFDSGSSY+Y+NSQ Y+     + +EL 
Sbjct  254  TPMSPDYAKHYSPGLAELIVGGKSTGFRNLVMVFDSGSSYTYLNSQAYQFLTSWLKRELT  313

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA DD TLP CWKGR+PFR+I DVK YFK  AL FA+G +  T FE+ PE+YLII
Sbjct  314  GKPLKEALDDRTLPLCWKGRKPFRNIRDVKTYFKPLALRFASGRKDTTQFELPPEAYLII  373

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKG+VCLG+LNG+E GL N N+IGD+SMQD+MVIYDNEK  IGW   NCD+ P
Sbjct  374  SSKGNVCLGILNGSEVGLQNSNIIGDISMQDKMVIYDNEKQMIGWGPGNCDKLP  427



>ref|XP_008227592.1| PREDICTED: aspartic proteinase Asp1 [Prunus mume]
Length=435

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY KHYSPG AEL  GGKSTG +N+++VFDSGSSY+Y+NSQ Y+     + +EL 
Sbjct  254  TPMSPDYIKHYSPGLAELIVGGKSTGFRNLVMVFDSGSSYTYLNSQAYQFLTSWLKRELT  313

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA DD TLP CWKGR+PFR+I DVK YFK  AL FA+G +  T FE+ PE+YLII
Sbjct  314  GKPLKEALDDKTLPLCWKGRKPFRNIRDVKTYFKPLALRFASGRKDTTQFELPPEAYLII  373

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKG+VCLG+LNG+E GL N N+IGD+SMQD+MVIYDNEK  IGW   NCD+ P
Sbjct  374  SSKGNVCLGILNGSEVGLQNSNIIGDISMQDKMVIYDNEKQMIGWGPGNCDQLP  427



>ref|XP_008460824.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Cucumis melo]
Length=391

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY KHYSPG  EL F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL 
Sbjct  211  TPMSRDYPKHYSPGFGELMFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELA  270

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLREA DD TLP CW+ R+P +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+II
Sbjct  271  GKPLREAMDDDTLPLCWRERKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMII  330

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  106
            SS G+VCLG+LNGT+ GL N N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  331  SSMGNVCLGILNGTDVGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  388



>emb|CAB38807.1| nucellin-like protein [Arabidopsis thaliana]
 emb|CAB80066.1| nucellin-like protein [Arabidopsis thaliana]
Length=420

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 139/190 (73%), Gaps = 18/190 (9%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  219  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  278

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  279  SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  338

Query  282  IS-----------------SKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNA  154
            IS                  KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +
Sbjct  339  ISVWFSHTMLKGRFIKMLQMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQS  398

Query  153  IGWTRANCDR  124
            IGW   +CD 
Sbjct  399  IGWMPVDCDE  408



>gb|KDP24798.1| hypothetical protein JCGZ_25323 [Jatropha curcas]
Length=424

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            T   RD++K+YSPG +EL F GKSTG++N++V FDSGSSY+Y+NSQ Y   LYS+   L 
Sbjct  246  TQMSRDHSKYYSPGFSELMFDGKSTGIQNLLVAFDSGSSYTYLNSQAYRGLLYSLRTALS  305

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL E  D  TLP CWKG++PF+S+ DVKKYFKSFAL FAN  R+RT FE  PE+YLII
Sbjct  306  GKPLSEVPDQ-TLPVCWKGKKPFKSLRDVKKYFKSFALGFANSGRARTHFEFPPEAYLII  364

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKG+ CLG+LNGT+ GL + NVIGD+SMQDRM+IY+NEK  IGW  ANC+R P
Sbjct  365  SSKGNACLGILNGTQIGLRDLNVIGDISMQDRMMIYNNEKQVIGWAPANCERLP  418



>ref|XP_008460823.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Cucumis melo]
Length=429

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY KHYSPG  EL F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL 
Sbjct  249  TPMSRDYPKHYSPGFGELMFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELA  308

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLREA DD TLP CW+ R+P +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+II
Sbjct  309  GKPLREAMDDDTLPLCWRERKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMII  368

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  106
            SS G+VCLG+LNGT+ GL N N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  369  SSMGNVCLGILNGTDVGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  426



>ref|XP_008460822.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Cucumis melo]
Length=433

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY KHYSPG  EL F G+STG++N+ VVFDSGSSY+Y N+Q Y+     + +EL 
Sbjct  253  TPMSRDYPKHYSPGFGELMFNGRSTGLRNLFVVFDSGSSYTYFNAQAYQVLTSLLNRELA  312

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPLREA DD TLP CW+ R+P +S+ DV+KYFK  ALSF++G RS+ +FEI  E Y+II
Sbjct  313  GKPLREAMDDDTLPLCWRERKPIKSLRDVRKYFKPLALSFSSGGRSKAVFEIPIEGYMII  372

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNV  106
            SS G+VCLG+LNGT+ GL N N+IGD+SMQD+MV+Y+NEK AIGW  ANCDR P   V
Sbjct  373  SSMGNVCLGILNGTDVGLENSNIIGDISMQDKMVVYNNEKQAIGWATANCDRVPKSQV  430



>ref|XP_011022861.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Populus euphratica]
Length=429

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
             KHYSPG AELTF GKSTG KN+IV FDSG+SY+Y+NSQ Y+  +  + +EL  K L EA
Sbjct  256  AKHYSPGFAELTFDGKSTGFKNLIVAFDSGASYTYLNSQAYQGVISLIKRELSTKSLSEA  315

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD TLP CWKGR+PF+S+ D+KKYFK+FALSF NG +S+T  E  PE+YLI+SSKG+ C
Sbjct  316  LDDRTLPICWKGRKPFKSVRDIKKYFKTFALSFMNGGKSKTQLEFPPEAYLIVSSKGNAC  375

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            LG+LNGTE  L++ NVIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  376  LGILNGTEVHLNDLNVIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPRSRSIII  429



>ref|XP_009350136.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY+KHYSPGPAEL   GKSTG  N+ +VFDSGSSY+Y++SQ Y+     + +EL 
Sbjct  248  TPMSLDYSKHYSPGPAELMVDGKSTGFGNLHMVFDSGSSYTYLSSQVYQFLTSWLKRELT  307

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA DD TLP CWKGR+PF+SI DVKKYFK  AL F +G +    +E+ PE+YLI+
Sbjct  308  GKPLKEAPDDGTLPLCWKGRKPFKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLIL  367

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            SSKG+VCLG+LNGTE GL + N+IGD+SMQD+MVIYDNEK  IGW   NCD  P P   F
Sbjct  368  SSKGNVCLGILNGTEVGLQDNNIIGDISMQDKMVIYDNEKQMIGWAPGNCDHLPKPRSSF  427



>ref|XP_011031099.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
 ref|XP_011016209.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=432

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   D  KHYSPG AEL+F GK+TG KN++  FDSG+SY+Y+NSQ Y+  +  + KEL 
Sbjct  250  TPMSPD-VKHYSPGLAELSFDGKTTGFKNLLTTFDSGASYTYLNSQAYQGLISLLKKELS  308

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA +D TLP CWKGR+PF+SI DVKKYFK+FALSF N  +S+T  E  PE+YLII
Sbjct  309  GKPLKEALNDRTLPLCWKGRKPFKSIRDVKKYFKTFALSFKNERKSKTELEFPPEAYLII  368

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            SSKG+ CLG+LNGTE GL++ NVIGD+SMQDR+VIYDNEK  IGW   NC+R P      
Sbjct  369  SSKGNACLGILNGTEVGLNDLNVIGDISMQDRVVIYDNEKERIGWAPGNCNRLPKSKSFI  428

Query  99   I  97
            I
Sbjct  429  I  429



>gb|EPS67652.1| hypothetical protein M569_07122 [Genlisea aurea]
Length=401

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   ++  HY+ G AEL FGG+STG KN+ VVFDSGSSY+Y  S  Y+A +  + K+L 
Sbjct  220  TPMSHEHNNHYAAGLAELRFGGRSTGFKNLNVVFDSGSSYTYFTSHIYQAVVSMITKDLN  279

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL    +D TLP CWKG++PFR+  DVKKYFK+ A +F NGWRS+  F+++PE YL++
Sbjct  280  GKPLTAEPEDQTLPMCWKGKKPFRTTRDVKKYFKTLAFAFPNGWRSKASFDVTPEGYLVV  339

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            SSKG+ CLG+LNGT  GL N+NVIGD+SMQD+MVIYDNEK  IGWT ANCD+
Sbjct  340  SSKGNACLGILNGTSVGLENFNVIGDISMQDKMVIYDNEKQMIGWTAANCDQ  391



>ref|XP_010111255.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXC30733.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=432

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY KHYSPG AEL F GK TG+KN++ VFDSGSSY+Y+ SQ Y+   + + +EL 
Sbjct  251  TPMSSDYLKHYSPGSAELRFDGKPTGLKNLLTVFDSGSSYTYLTSQAYQTLTFLIKRELP  310

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
             K LREA DD TLP CWKG+RPF+ +SDV+KYFK  AL F  G +++T +E+ PE+YLI+
Sbjct  311  RKVLREATDDQTLPLCWKGKRPFKRVSDVRKYFKPLALDFTTGGKTKT-YELPPEAYLIV  369

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKG+VCLG+LNG+E GL N N+IGD+SMQD+MVIYDNEK  IGW  ANCD+ P
Sbjct  370  SSKGNVCLGILNGSEIGLQNSNIIGDISMQDKMVIYDNEKQMIGWASANCDKLP  423



>ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera]
 emb|CBI21613.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RD   HYS G AEL  GGK+T  KN++V FDSGSSY+Y+NS  Y+A ++ V KEL 
Sbjct  246  TPMLRDQHTHYSSGYAELILGGKTTVFKNLLVTFDSGSSYTYLNSLAYQALVHLVRKELS  305

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
             KP+REA DD TLP CW+G+RPF+S+ DVKK+FK  ALSF  G R++T ++I  ESYLII
Sbjct  306  EKPVREALDDQTLPLCWRGKRPFKSVRDVKKFFKPLALSFPGGGRTKTQYDIPLESYLII  365

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            S KG+VCLG+LNGTEAGL ++N+IGD+SMQD+MV+YDNEKN IGW   NCDR P
Sbjct  366  SLKGNVCLGILNGTEAGLQDFNLIGDISMQDKMVVYDNEKNQIGWAPTNCDRLP  419



>ref|XP_008361087.1| PREDICTED: aspartic proteinase Asp1-like [Malus domestica]
Length=430

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 134/180 (74%), Gaps = 0/180 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY+KHYSPGPAEL   GKSTG+ N+ +VFDSGSSY+Y++SQ Y+     + +EL 
Sbjct  248  TPMSLDYSKHYSPGPAELMVDGKSTGIGNLRMVFDSGSSYTYLSSQVYQFLTSWLKRELT  307

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA DD TLP CWKGR+PF+SI DVKKYFK  AL F +G +    +E+ PE+YLI+
Sbjct  308  GKPLKEAPDDRTLPLCWKGRKPFKSIRDVKKYFKPLALRFNSGRKDTAQYELPPEAYLIL  367

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            SS G+VCLG+LNGTE GL  YN+IGD+SMQD+MVIYDNEK  IGW    CD  P P   F
Sbjct  368  SSMGNVCLGILNGTEVGLQXYNIIGDISMQDKMVIYDNEKQMIGWAPGKCDHLPKPRSSF  427



>ref|XP_010547875.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=425

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 135/166 (81%), Gaps = 1/166 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP   D++KHYSP P  EL FGGK+TG+KN++V FDSGSSY+Y NS+ Y A    + +EL
Sbjct  238  TPMSSDHSKHYSPAPGGELLFGGKTTGLKNLLVAFDSGSSYTYFNSKAYHAVTNLLKREL  297

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF ++ + KKYF+  ++SF  GWRS++L+EI PE+YLI
Sbjct  298  SGKPLKEARDDSTLPLCWQGRRPFLNVDEAKKYFRPLSVSFKTGWRSKSLYEIPPEAYLI  357

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGW  145
            IS++G+VCLG+LNGTE GL N N+IGD+SMQD+MVIYDNEK+AIGW
Sbjct  358  ISTEGNVCLGILNGTEIGLENVNLIGDISMQDQMVIYDNEKHAIGW  403



>ref|XP_006432088.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
 gb|ESR45328.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
Length=451

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGGK+TG+KN+ +VFDSGSSY+Y++   Y+     + +E+  K L+
Sbjct  277  DYTKYYSPGVAELLFGGKTTGLKNLPLVFDSGSSYTYLSHVAYQTLTSMMKREISAKSLK  336

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKG+RPF+++ DVKKYFK+ ALSF +G ++RTLFE++PE+YLIIS++G+
Sbjct  337  EAPEDRTLPLCWKGKRPFKNVRDVKKYFKALALSFTDG-KTRTLFELTPEAYLIISNRGN  395

Query  264  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            VCLG+LNG E GL + NVIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  396  VCLGILNGAEVGLQDLNVIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  444



>ref|XP_006464925.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=436

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGGK+TG+KN+ +VFDSGSSY+Y++   Y+     + +E+  K L+
Sbjct  262  DYTKYYSPGVAELLFGGKTTGLKNLPLVFDSGSSYTYLSHVAYQTLTSMMKREISAKSLK  321

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKG+RPF+++ DVKKYFK+ ALSF +G ++RTLFE++PE+YLIIS++G+
Sbjct  322  EAPEDRTLPLCWKGKRPFKNVRDVKKYFKALALSFTDG-KTRTLFELTPEAYLIISNRGN  380

Query  264  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            VCLG+LNG E GL + NVIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  381  VCLGILNGAEVGLQDLNVIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  429



>gb|KDO52221.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
 gb|KDO52222.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
Length=436

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGGK+TG+KN+ VVFDSGSSY+Y++   Y+     + +EL  K L+
Sbjct  262  DYTKYYSPGVAELFFGGKTTGLKNLPVVFDSGSSYTYLSHVAYQTLTSMMKRELSAKSLK  321

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKG+RPF+++ DVKKYFKS ALSF +G ++RTLFE++ E+YLIIS++G+
Sbjct  322  EAPEDRTLPLCWKGKRPFKNVRDVKKYFKSLALSFTDG-KTRTLFELTTEAYLIISNRGN  380

Query  264  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            VCLG+LNG E GL + NVIGD+SMQDR+VIYDNEK  IGW  ANCDR P
Sbjct  381  VCLGILNGAEVGLQDLNVIGDISMQDRVVIYDNEKQRIGWMPANCDRIP  429



>emb|CAN73001.1| hypothetical protein VITISV_037997 [Vitis vinifera]
Length=424

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RD   HYS G AEL  GGK+T  KN++V FDSGSSY+Y+NS  Y+A ++ V KEL 
Sbjct  246  TPMLRDQHTHYSSGYAELILGGKTTVFKNLLVTFDSGSSYTYLNSLAYQALVHLVRKELS  305

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
             KP+REA DD TLP CW+G+RPF+S+ DV+K+FK  ALSFA G R++T ++I  ESYLII
Sbjct  306  EKPVREALDDQTLPLCWRGKRPFKSVRDVRKFFKPLALSFAGGGRTKTQYDIPLESYLII  365

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            S  G+VCLG+LNGTEAGL ++N+IGD+SMQD+MV+YDNEKN IGW   NCDR P
Sbjct  366  S--GNVCLGILNGTEAGLQDFNLIGDISMQDKMVVYDNEKNQIGWAPTNCDRLP  417



>ref|XP_009355861.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY+KHYSPGPAEL   GKSTG  N+ +VFDSGSSY+Y++SQ Y+     + +EL 
Sbjct  248  TPMSLDYSKHYSPGPAELMVDGKSTGFGNLHMVFDSGSSYTYLSSQVYQFLTSWLKRELT  307

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
             KPL+EA DD TLP CWKGR+PF+SI DVKKYFK  AL F +G +    +E+ PE+YLI+
Sbjct  308  EKPLKEAPDDGTLPLCWKGRKPFKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLIL  367

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKG+VCLG+LNGTE GL + N+IGD+SMQD+MVIYDNEK  IGW   NCD  P
Sbjct  368  SSKGNVCLGILNGTEVGLQDNNIIGDISMQDKMVIYDNEKQMIGWAPGNCDHLP  421



>ref|XP_011022860.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=429

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
             K+YSPG AELTF GK+TG KN+I+ FDSG+SY+Y+NSQ Y+  +  +  EL  K L EA
Sbjct  256  AKYYSPGFAELTFDGKTTGFKNLIIAFDSGASYTYLNSQAYQGLISLIKGELSKKFLSEA  315

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD TLP CWKG +PF S+ DVKKYFK+FALSF NG +S+T  E  PE+YLIISSKG+ C
Sbjct  316  LDDHTLPICWKGWKPFESVRDVKKYFKTFALSFMNGGKSKTQLEFPPEAYLIISSKGNAC  375

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            LG+LNGTE GL++ NVIGD+SMQDR+VIYDNEK  IGW   NCDR P    + I
Sbjct  376  LGILNGTEVGLNDLNVIGDISMQDRVVIYDNEKQLIGWAPGNCDRLPRSRSIII  429



>ref|XP_009355862.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=428

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY+KHYSPGPAEL   GKSTG  N+ +VFDSGS+Y+Y++SQ Y+     + +EL 
Sbjct  246  TPMSLDYSKHYSPGPAELMVDGKSTGFGNLHMVFDSGSTYTYLSSQVYQFLTSWLKRELT  305

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
             KPL+EA DD TLP CWKGR+PF+SI DVKKYFK  AL F +G +    +E+ PE+YLI+
Sbjct  306  EKPLKEAPDDGTLPLCWKGRKPFKSIRDVKKYFKPLALRFGSGRKDTAQYELPPEAYLIL  365

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            SSKG+VCLG+LNGTE GL + N+IGD+SMQD+MVIYDNEK  IGW   NCD  P
Sbjct  366  SSKGNVCLGILNGTEVGLQDNNIIGDISMQDKMVIYDNEKQMIGWAPGNCDHLP  419



>ref|XP_010674354.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674355.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=393

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            YTKHYSPG AEL +G ++TGV+N++V+FDSGSSY+Y  S+ Y   +  + ++L    L++
Sbjct  219  YTKHYSPGFAELVYGRRTTGVENLLVIFDSGSSYTYFASEAYHTLVSLLTRDLHRTSLKD  278

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
            A DD TLP CWKGRRPF+SI DVKKYFK  ALSF +G R  + ++I PE+YLIIS KG+V
Sbjct  279  ATDDDTLPVCWKGRRPFKSIRDVKKYFKPLALSFGDGGRYASHYDIPPENYLIISMKGNV  338

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            CLG+LNGTE GL NYN+IGD+SMQD+M++YDNEK  IGW  ANC++ P    V +
Sbjct  339  CLGILNGTEVGLQNYNIIGDISMQDKMIVYDNEKTMIGWGSANCEKIPKGKAVAL  393



>ref|XP_010674353.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            YTKHYSPG AEL +G ++TGV+N++V+FDSGSSY+Y  S+ Y   +  + ++L    L++
Sbjct  263  YTKHYSPGFAELVYGRRTTGVENLLVIFDSGSSYTYFASEAYHTLVSLLTRDLHRTSLKD  322

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
            A DD TLP CWKGRRPF+SI DVKKYFK  ALSF +G R  + ++I PE+YLIIS KG+V
Sbjct  323  ATDDDTLPVCWKGRRPFKSIRDVKKYFKPLALSFGDGGRYASHYDIPPENYLIISMKGNV  382

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            CLG+LNGTE GL NYN+IGD+SMQD+M++YDNEK  IGW  ANC++ P    V +
Sbjct  383  CLGILNGTEVGLQNYNIIGDISMQDKMIVYDNEKTMIGWGSANCEKIPKGKAVAL  437



>ref|XP_006432093.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 ref|XP_006464929.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Citrus sinensis]
 gb|ESR45333.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=408

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+
Sbjct  234  DYTKYYSPGVAELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLK  293

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKGRRPF+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+
Sbjct  294  EAPEDETLPLCWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGN  352

Query  264  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            VCLG+LNG E GL + NVIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  353  VCLGILNGAEVGLQDLNVIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  401



>ref|XP_006464928.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=427

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+
Sbjct  253  DYTKYYSPGVAELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLK  312

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKGRRPF+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+
Sbjct  313  EAPEDETLPLCWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGN  371

Query  264  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            VCLG+LNG E GL + NVIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  372  VCLGILNGAEVGLQDLNVIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  420



>ref|XP_006432092.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 gb|ESR45332.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=453

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+
Sbjct  279  DYTKYYSPGVAELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLK  338

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKGRRPF+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+
Sbjct  339  EAPEDETLPLCWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGN  397

Query  264  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            VCLG+LNG E GL + NVIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  398  VCLGILNGAEVGLQDLNVIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  446



>ref|XP_006464927.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=459

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+
Sbjct  285  DYTKYYSPGVAELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLK  344

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKGRRPF+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+
Sbjct  345  EAPEDETLPLCWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGN  403

Query  264  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            VCLG+LNG E GL + NVIG +SMQDR+VI+DNEK  IGW   NCD+ P
Sbjct  404  VCLGILNGAEVGLQDLNVIGAISMQDRLVIFDNEKQMIGWMPTNCDQIP  452



>gb|AFK47184.1| unknown [Lotus japonicus]
Length=245

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 132/181 (73%), Gaps = 0/181 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP      KHY  G AEL FGGK TG+  ++ VFD+GSSY+Y NS  Y+A +  + KEL 
Sbjct  65   TPMSSRDLKHYVAGAAELIFGGKKTGIGGLLPVFDTGSSYTYFNSNAYQAVISWLKKELA  124

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+EA DD TLP CW G+RPFRS+ +V+KYFKS ALSF +  R+ T FEI PE+YLI+
Sbjct  125  GKPLKEAPDDQTLPLCWHGKRPFRSVYEVRKYFKSMALSFTSSGRTNTQFEIPPEAYLIV  184

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            S+ G+VCLG+L+G+E G+ + N+IGD+SM D+++++DNEK  IGW  A+C+R P    V 
Sbjct  185  SNMGNVCLGILDGSEVGMGDLNLIGDISMLDKVMVFDNEKRLIGWAPADCNRVPNSRHVS  244

Query  99   I  97
            I
Sbjct  245  I  245



>ref|XP_007159874.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
 gb|ESW31868.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
Length=431

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 131/173 (76%), Gaps = 0/173 (0%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL FGG+ TGV ++  VFD+GSSYSY NS+ Y+A L  + K+L GKPL+ A 
Sbjct  259  KHYSAGPAELVFGGRKTGVGSLTAVFDTGSSYSYFNSRAYQALLSWLKKDLTGKPLKAAP  318

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD TLP CW GRRPF+SI +V++YFK  AL+F NG R +  FEI+PE+YLIIS+ G+VCL
Sbjct  319  DDQTLPLCWHGRRPFKSIREVRRYFKPVALTFNNGGRVKAQFEIAPEAYLIISNLGNVCL  378

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            G+LNG+E GL   N+IGD+SMQD++++++NEKN IGW  A C R P    V I
Sbjct  379  GILNGSEIGLEELNLIGDISMQDKVMVFENEKNLIGWGPAECSRVPKSRDVSI  431



>ref|XP_003532363.2| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN16936.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 0/181 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP     +KHYS GPAEL FGG+ TGV ++  VFD+GSSY+Y NS  Y+A L  + KEL 
Sbjct  251  TPISSVDSKHYSAGPAELVFGGRKTGVGSLTAVFDTGSSYTYFNSHAYQALLSWLKKELS  310

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+ A DD TLP CW G+RPF S+ +V+KYFK  AL F NG R++  FEI PE+YLII
Sbjct  311  GKPLKVAPDDQTLPLCWHGKRPFTSLREVRKYFKPVALGFTNGGRTKAQFEILPEAYLII  370

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            S+ G+VCLG+LNG+E GL   N+IGD+SMQD++++++NEK  IGW  A+C R P    V 
Sbjct  371  SNLGNVCLGILNGSEVGLEELNLIGDISMQDKVMVFENEKQLIGWGPADCSRIPKSGDVS  430

Query  99   I  97
            I
Sbjct  431  I  431



>gb|KHN20145.1| Aspartic proteinase Asp1 [Glycine soja]
Length=452

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 129/172 (75%), Gaps = 4/172 (2%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P    KHYS GPAEL F GK+T VK + ++FDSGSSY+Y NSQ Y+A +  V ++L+GK 
Sbjct  251  PSSSEKHYSSGPAELVFNGKATAVKGLELIFDSGSSYTYFNSQAYQAVVDLVTQDLKGKQ  310

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISS  274
            L+ A DDP+LP CWKG + F+S+SDVKKYFK  ALSF    +++ L   + PE+YLII+ 
Sbjct  311  LKRATDDPSLPICWKGAKSFKSLSDVKKYFKPLALSFT---KTKILQMHLPPEAYLIITK  367

Query  273  KGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
             G+VCLG+L+GTE GL N N+IGD+S+QD+MVIYDNEK  IGW  +NCDR P
Sbjct  368  HGNVCLGILDGTEVGLENLNIIGDISLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>gb|KCW62450.1| hypothetical protein EUGRSUZ_H05085 [Eucalyptus grandis]
Length=238

 Score =   211 bits (536),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 129/180 (72%), Gaps = 6/180 (3%)
 Frame = -1

Query  639  TPCPRD--YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKE  466
            TP  RD    +HYSPG AEL F GK TG +N++++FDSGS+++Y +S+ Y+A    V +E
Sbjct  52   TPMSRDPYLIEHYSPGTAELLFAGKPTGQENLLLLFDSGSTFTYFSSKAYQALSSRVKEE  111

Query  465  LRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFA----NGWRSRTLFEISP  298
            LR K   EA DD TLP CWKG++PF++I DV KYFK FALSFA    +G R++  FE+ P
Sbjct  112  LRRKDFAEAVDDDTLPLCWKGQKPFKNIGDVTKYFKPFALSFALSFNSGGRAKNQFEVPP  171

Query  297  ESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ESY IIS KG+VC+GVLNGTE G  N NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  172  ESYFIISDKGNVCMGVLNGTEVGFQNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  231



>gb|AES72936.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=445

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPL  448
            RDY KHYS G AEL  GGK TG  N++ VFD+GSSY+Y NS  Y+A +  + KEL GKP+
Sbjct  270  RDY-KHYSAGAAELVLGGKRTGFGNLLAVFDAGSSYTYFNSNAYQALISWLTKELAGKPI  328

Query  447  REAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKG  268
            +EA +D TLP CW G+RPFRS+ +VKKYFK  ALSF    RS+  FEI PE+YLIIS+ G
Sbjct  329  KEAPEDQTLPLCWYGKRPFRSVYEVKKYFKPIALSFPGSRRSKAQFEIPPEAYLIISNMG  388

Query  267  SVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            +VCLG+L+G+E G+ + N+IGD+SM D+++++DNEK  IGWT A+C+R P    V I
Sbjct  389  NVCLGILDGSEVGVEDLNLIGDISMLDKVMVFDNEKQLIGWTAADCNRVPKSKDVSI  445



>ref|XP_006596210.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Glycine 
max]
Length=452

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 129/172 (75%), Gaps = 4/172 (2%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P    KHYS GPAEL F GK+T VK + ++FDSGSSY+Y NSQ Y+A +  V ++L+GK 
Sbjct  251  PSSSEKHYSSGPAELVFNGKATVVKGLELIFDSGSSYTYFNSQAYQAVVDLVTQDLKGKQ  310

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISS  274
            L+ A DDP+LP CWKG + F+S+SDVKKYFK  ALSF    +++ L   + PE+YLII+ 
Sbjct  311  LKRATDDPSLPICWKGAKSFKSLSDVKKYFKPLALSFT---KTKILQMHLPPEAYLIITK  367

Query  273  KGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
             G+VCLG+L+GTE GL N N+IGD+S+QD+MVIYDNEK  IGW  +NCDR P
Sbjct  368  HGNVCLGILDGTEVGLENLNIIGDISLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>ref|XP_010243511.1| PREDICTED: aspartic proteinase Asp1 [Nelumbo nucifera]
Length=460

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRD-YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+   K+YSPGPA+L FGG+ TGVK ++ VFDSGSSY+Y NS+ Y+ F+  V K+L
Sbjct  254  TPMSRNPLNKYYSPGPAQLIFGGQHTGVKGLMTVFDSGSSYTYFNSKFYQTFISLVRKDL  313

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CWKG +PF+SI DVK++FK   LSF+NG  +R   EI PESYLI
Sbjct  314  TGKPLKEARDDQTLPICWKGTKPFKSIRDVKEHFKPLTLSFSNGKNAR--LEILPESYLI  371

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ISS G+ CLG+LNGTE GL + N+IGD  ++D++VIYDNEK  IGW    C+R P
Sbjct  372  ISSHGNACLGILNGTEIGLQDINIIGDTLLRDKIVIYDNEKRQIGWIATYCNRLP  426



>ref|XP_009393816.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 125/165 (76%), Gaps = 2/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPGPA L +G +S GVK   VVFD+GS+Y+Y   QPY+AFL +V  +L   PL+E  D
Sbjct  248  YYSPGPANLQWGTRSLGVKQKEVVFDTGSTYTYFGFQPYQAFLSAVKSDLSKTPLKEVSD  307

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            DP+L  CW+G++PF+S++DVK+YFK+ ALSF N    RTL E+ PE+YLII+  G+ CLG
Sbjct  308  DPSLSVCWRGQKPFKSVNDVKQYFKTLALSFVNA--KRTLLEVPPENYLIITQHGNACLG  365

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +L+GTE GL N NVIGD+S+QD  V+YDNE+  IGW RA CDRPP
Sbjct  366  ILDGTEVGLGNLNVIGDISLQDLTVVYDNERQQIGWVRAACDRPP  410



>ref|XP_003630348.1| Aspartic proteinase Asp1 [Medicago truncatula]
 gb|AET04824.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=435

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 127/169 (75%), Gaps = 0/169 (0%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            D  KHYS GPAEL FGG+ TGV ++ ++FD+GSSY+Y NSQ Y+A +  + KEL  KP++
Sbjct  260  DSGKHYSAGPAELVFGGRKTGVGSLNIIFDTGSSYTYFNSQAYQAMISLLNKELHRKPIK  319

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
             A DD TLP CW G+RPFRSI++VKKYFK   LSF NG R +  FEI PE+YLIIS+ G+
Sbjct  320  AAPDDQTLPMCWHGKRPFRSINEVKKYFKPLTLSFTNGGRVKPQFEIPPEAYLIISNMGN  379

Query  264  VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            VCLG+LNG E GL   N+IGD+SM D+++++DNEK  IGW  A+C+  P
Sbjct  380  VCLGILNGPEVGLGELNLIGDISMLDKVMVFDNEKQLIGWGPADCNSVP  428



>ref|XP_010027413.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=435

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 129/178 (72%), Gaps = 5/178 (3%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RD  KHYSPG AEL F  K TG KN+++VFDSGS+Y+Y +S+ Y A   SV +ELR
Sbjct  252  TPMSRD-PKHYSPGTAELLFARKPTGQKNLLLVFDSGSTYTYFSSKAYRALSLSVDEELR  310

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFA----NGWRSRTLFEISPES  292
             K   EA DD TLP CWKGR+PF++I DV KYFK FALSFA    +G R++  FE+ PES
Sbjct  311  RKHFTEAVDDRTLPLCWKGRKPFKNIGDVTKYFKPFALSFALSFNSGGRAQNQFEVPPES  370

Query  291  YLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            YLIIS KG+VC+GVLNGTE G  N NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  371  YLIISDKGNVCMGVLNGTEVGFQNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  428



>ref|XP_009420564.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=433

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPGPA L +G +S GV  M VVFD+GS+++Y   QPY+AFL +V  +L  KPL+E  D
Sbjct  263  YYSPGPANLYWGTRSLGVNQMEVVFDTGSTFTYFGFQPYQAFLSAVKSDLSKKPLKEEFD  322

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            DPTLP CWKG + F+S+ DVKKYFK+ AL+F NG  +R L E+ PE+YLII+  G+ CLG
Sbjct  323  DPTLPVCWKGPKAFKSVKDVKKYFKTLALNFVNG--NRALLEVPPENYLIITKHGNACLG  380

Query  252  VLNGTEAGLH-NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  112
            +LNGTEAGL+ + N+IGD+SMQDRMV+YDNE+  IGW +  CDR P P
Sbjct  381  ILNGTEAGLNKDLNIIGDISMQDRMVVYDNERQHIGWVQIGCDRLPKP  428



>ref|XP_006472808.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=418

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRDYT-KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  RD   KHYS GPAEL FGGKSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L
Sbjct  244  TPMSRDLLEKHYSSGPAELLFGGKSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDL  303

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
            +GKPL +  ++  LP CWKG +PF+SI DVK YFK   LSF           I PE+YLI
Sbjct  304  KGKPLEDTAEEKALPVCWKGTKPFKSIQDVKDYFKPLLLSFTK--TKNVHLHIPPEAYLI  361

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ++  G+VCLG+LNGTE GL N+N++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  362  VTEHGNVCLGILNGTEVGLENFNLVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_003524315.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN17403.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 129/181 (71%), Gaps = 0/181 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP     +KHYS GPAEL FGG+ TGV ++  VFD+GSSY+Y NS  Y+A L  + KEL 
Sbjct  251  TPISSVDSKHYSAGPAELVFGGRKTGVGSLTAVFDTGSSYTYFNSHAYQALLSWLNKELS  310

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+ A DD TL  CW G+RPF S+ +V+KYFK  ALSF NG R +  FEI PE+YLII
Sbjct  311  GKPLKVAPDDQTLSLCWHGKRPFTSLREVRKYFKPVALSFTNGGRVKAQFEIPPEAYLII  370

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            S+ G+VCLG+LNG E GL   N++GD+SMQD++++++NEK  IGW  A+C R P    V 
Sbjct  371  SNLGNVCLGILNGFEVGLEELNLVGDISMQDKVMVFENEKQLIGWGPADCSRVPKSGDVS  430

Query  99   I  97
            I
Sbjct  431  I  431



>ref|XP_006472807.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=458

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRDYT-KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  RD   KHYS GPAEL FGGKSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L
Sbjct  244  TPMSRDLLEKHYSSGPAELLFGGKSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDL  303

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
            +GKPL +  ++  LP CWKG +PF+SI DVK YFK   LSF           I PE+YLI
Sbjct  304  KGKPLEDTAEEKALPVCWKGTKPFKSIQDVKDYFKPLLLSFTK--TKNVHLHIPPEAYLI  361

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ++  G+VCLG+LNGTE GL N+N++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  362  VTEHGNVCLGILNGTEVGLENFNLVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_006434233.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
 gb|ESR47473.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
Length=459

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRDYT-KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  RD   KHYS GPAEL FGGKSTG+K + ++FDSGSSY+Y NSQ Y+  L  + K+L
Sbjct  244  TPMSRDLLEKHYSSGPAELLFGGKSTGIKGLQIIFDSGSSYTYFNSQAYKTTLDLMRKDL  303

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
            +GKPL +  ++  LP CWKG +PF+SI DV+ YFK   LSF           I PE+YLI
Sbjct  304  KGKPLEDTAEEKALPVCWKGTKPFKSIQDVEDYFKPLLLSFTK--TKNVHLHIPPEAYLI  361

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ++  G+VCLG+LNGTE GL N+N++GD+S+QD++VIYDNEK  IGW  +NC+R P
Sbjct  362  VTEHGNVCLGILNGTEVGLENFNLVGDISLQDKIVIYDNEKQQIGWVSSNCNRLP  416



>ref|XP_009404862.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 124/168 (74%), Gaps = 2/168 (1%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +  +YSPGPA+L +G +S G K + VV D+GS+++Y  S PY+AFL +V  +L   PL E
Sbjct  265  FRNYYSPGPAKLYWGTQSLGAKQIEVVLDTGSTFTYFESHPYQAFLSAVKSDLSKTPLIE  324

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
              DD  LP CWKG++PF+S+SDVKKYFK+ AL F  G   R L E+SPE+YLII+  G+ 
Sbjct  325  EFDDSALPVCWKGQKPFKSVSDVKKYFKTLALDFVKG--KRALLELSPENYLIITKHGNA  382

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            CLG+LNG+EAGL N NVIGD+S+QD MV+YDNEK  IGW RA C+R P
Sbjct  383  CLGILNGSEAGLRNLNVIGDISLQDHMVVYDNEKQHIGWVRAACNRLP  430



>ref|XP_011468243.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY+KHYSPG AEL F GK+TG++N+ +VFDSGSSY+Y+NSQ Y      + +EL 
Sbjct  247  TPMSPDYSKHYSPGSAELIFDGKTTGMRNLHLVFDSGSSYTYLNSQAYHFLTLWLKRELN  306

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+E  DD TLP CWKGR+PF++I +VKKYFK  AL FA G +    FE+SPE+YLII
Sbjct  307  GKPLKETSDDRTLPLCWKGRKPFKNIREVKKYFKPIALRFAIGRKDAAQFELSPEAYLII  366

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMV  178
            SSKG+VCLG+L+GTE GL N N+IGD+SMQD+M+
Sbjct  367  SSKGNVCLGILDGTEVGLQNSNIIGDISMQDKMI  400



>ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatula]
Length=440

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 130/177 (73%), Gaps = 6/177 (3%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPL  448
            RDY KHYS G AEL  GGK TG  N++ VFD+GSSY+Y NS  Y+     + KEL GKP+
Sbjct  270  RDY-KHYSAGAAELVLGGKRTGFGNLLAVFDAGSSYTYFNSNAYQ-----LTKELAGKPI  323

Query  447  REAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKG  268
            +EA +D TLP CW G+RPFRS+ +VKKYFK  ALSF    RS+  FEI PE+YLIIS+ G
Sbjct  324  KEAPEDQTLPLCWYGKRPFRSVYEVKKYFKPIALSFPGSRRSKAQFEIPPEAYLIISNMG  383

Query  267  SVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            +VCLG+L+G+E G+ + N+IGD+SM D+++++DNEK  IGWT A+C+R P    V I
Sbjct  384  NVCLGILDGSEVGVEDLNLIGDISMLDKVMVFDNEKQLIGWTAADCNRVPKSKDVSI  440



>gb|KHN31194.1| Aspartic proteinase Asp1 [Glycine soja]
Length=317

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = -1

Query  627  RDYTKHYS-PGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            RDY KHYS  G AEL FGGK +GV N+  VFD+GSSY+Y NS  Y+  +  + KE  GKP
Sbjct  141  RDY-KHYSVAGAAELLFGGKKSGVGNLHAVFDTGSSYTYFNSYAYQVLISWLKKESGGKP  199

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK  271
            L+EA DD TLP CW+GRRPFRSI +V+KYFK   LSF +  RS+  FE+ PE+YLI+S+ 
Sbjct  200  LKEAHDDQTLPLCWRGRRPFRSIYEVRKYFKPIVLSFTSNGRSKAQFEMLPEAYLIVSNM  259

Query  270  GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            G+VCLG+LNG+E G+ + N+IGD+SM ++++++DN+K  IGW  A+CD+ P    V I
Sbjct  260  GNVCLGILNGSEVGMGDLNLIGDISMLNKVMVFDNDKQLIGWAPADCDQVPKSRDVSI  317



>gb|AAG51657.1|AC010704_1 nucellin-like protein; 27671-25467 [Arabidopsis thaliana]
Length=427

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL + 
Sbjct  253  SKNYMAGPAELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDT  312

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD +LP CWKG++P +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG VC
Sbjct  313  KDDKSLPVCWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVC  371

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            LG+LNGTE GL  YN+IGD+S Q  MVIYDNEK  IGW  ++CD+ P    +F
Sbjct  372  LGILNGTEIGLEGYNIIGDISFQGIMVIYDNEKQRIGWISSDCDKLPKSEPLF  424



>ref|XP_004503902.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=437

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL FGG+ +G  N+ ++FD+GSSY+Y NSQ Y+  +  + KEL  KP++ A 
Sbjct  265  KHYSAGPAELVFGGRKSGAGNLNIIFDTGSSYTYFNSQAYQVLISLLSKELNRKPIKAAP  324

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD TLP CW G++PF++I++VKKYFK  ALSF  G R +  FEI PE+YLIIS+ G+VCL
Sbjct  325  DDQTLPICWHGKKPFKNINEVKKYFKPLALSFTKGGRVKPQFEIPPEAYLIISNMGNVCL  384

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNG E GL   NVIGD+SM ++++++DNEK  IGW  A+C+R P
Sbjct  385  GILNGFEVGLGELNVIGDISMLEKVMVFDNEKQLIGWGAADCNRDP  430



>ref|XP_010025732.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=436

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 129/180 (72%), Gaps = 6/180 (3%)
 Frame = -1

Query  639  TPCPRD--YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKE  466
            TP  RD    +HYSPG AEL F GK TG +N++++FDSGS+++Y +S+ Y+A    V +E
Sbjct  250  TPMSRDPYLIEHYSPGTAELLFAGKPTGQENLLLLFDSGSTFTYFSSKAYQALSSRVKEE  309

Query  465  LRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFA----NGWRSRTLFEISP  298
            LR K   EA DD TLP CWKG++PF++I DV KYFK FALSFA    +G R++  FE+ P
Sbjct  310  LRRKDFAEAVDDDTLPLCWKGQKPFKNIGDVTKYFKPFALSFALSFNSGGRAKNQFEVPP  369

Query  297  ESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ESY IIS KG+VC+GVLNGTE G  N NVIGD SMQD+MVIYDN +  +GW   +C + P
Sbjct  370  ESYFIISDKGNVCMGVLNGTEVGFQNVNVIGDTSMQDKMVIYDNGRQLLGWESKDCSQLP  429



>ref|NP_177872.3| aspartyl protease [Arabidopsis thaliana]
 gb|AEE35983.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=432

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL + 
Sbjct  258  SKNYMAGPAELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDT  317

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD +LP CWKG++P +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG VC
Sbjct  318  KDDKSLPVCWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVC  376

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF  100
            LG+LNGTE GL  YN+IGD+S Q  MVIYDNEK  IGW  ++CD+ P    +F
Sbjct  377  LGILNGTEIGLEGYNIIGDISFQGIMVIYDNEKQRIGWISSDCDKLPKSEPLF  429



>ref|XP_004502990.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=434

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPL  448
            RDY KHYS G AEL FGGK TG  N+  VFD+GSSY+Y NS  Y+A +  + KEL GKP+
Sbjct  259  RDY-KHYSAGAAELIFGGKRTGFGNLFAVFDTGSSYTYFNSDAYQALVSWLKKELAGKPI  317

Query  447  REAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKG  268
            +EA +D TLP CW G+RPFRS+ +V+KYFK  A SF +  R +  FEI PE+YLIIS+ G
Sbjct  318  KEAPEDQTLPMCWYGKRPFRSVYEVRKYFKPIAFSFPSSGRMKAQFEIPPEAYLIISNMG  377

Query  267  SVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +VCLG+LNG+E G+ + N+IGD+SM D+++I+DN+K  IGW   +C+R P
Sbjct  378  NVCLGILNGSEVGMGDLNLIGDISMLDKVMIFDNDKQLIGWAPTDCNRVP  427



>ref|NP_850981.1| aspartyl protease [Arabidopsis thaliana]
 gb|AAL32740.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AAN65112.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE35984.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=466

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL + 
Sbjct  258  SKNYMAGPAELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDT  317

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD +LP CWKG++P +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG VC
Sbjct  318  KDDKSLPVCWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVC  376

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  109
            LG+LNGTE GL  YN+IGD+S Q  MVIYDNEK  IGW  ++CD+ P  N
Sbjct  377  LGILNGTEIGLEGYNIIGDISFQGIMVIYDNEKQRIGWISSDCDKLPNVN  426



>ref|NP_567922.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AEE86233.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=401

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct  238  TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL  297

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct  298  SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI  357

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIG  205
            IS KG+VCLG+LNGTE GL N N+IG
Sbjct  358  ISMKGNVCLGILNGTEIGLQNLNLIG  383



>ref|XP_010463205.1| PREDICTED: aspartic proteinase Asp1-like, partial [Camelina sativa]
Length=241

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HY+ G AEL F GK+ G+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+G PL++A +
Sbjct  76   HYTTGSAELLFNGKAAGLKGLKLIFDTGSSYTYFNSKTYQTLVKLIENDLKGTPLKDAKE  135

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TLP CWKG +PF+S+ DVK YFK+  ++F NG R  T  +I PESYLIIS+ G+VCLG
Sbjct  136  DKTLPVCWKGAKPFKSVLDVKTYFKTLTINFTNG-RKNTQLQIPPESYLIISNTGNVCLG  194

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + NVIGD+SMQ  M+IYDNEK  +GW  A+C++ P
Sbjct  195  LLNGSEVGLQDSNVIGDISMQGLMMIYDNEKQQLGWVTADCNKLP  239



>ref|XP_008219614.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Prunus mume]
Length=420

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRD-YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+    HYS GPAEL F GKSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L
Sbjct  246  TPMSRNSMVNHYSSGPAELVFNGKSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDL  305

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKP++E  +D +LP CWKGR+PF+S+ D K +FK  ALSF N        ++SPE YLI
Sbjct  306  DGKPIKETSEDKSLPICWKGRKPFKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLI  363

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +S  G+VCLG+LNG+E GL N N+IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  364  VSKHGNVCLGILNGSEVGLGNLNIIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_007223384.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
 gb|EMJ24583.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
Length=420

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRDYTK-HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+  + HYS GPAEL F GKSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L
Sbjct  246  TPMSRNSMENHYSSGPAELVFNGKSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDL  305

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKP++E  +D +LP CWKGR+PF+S+ D K +FK  ALSF N        ++SPE YLI
Sbjct  306  DGKPIKETNEDKSLPICWKGRKPFKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLI  363

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +S  G+VC G+LNG+E GL N N+IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  364  VSKHGNVCFGILNGSEVGLENLNIIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_008219613.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Prunus mume]
Length=451

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRD-YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+    HYS GPAEL F GKSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L
Sbjct  246  TPMSRNSMVNHYSSGPAELVFNGKSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDL  305

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKP++E  +D +LP CWKGR+PF+S+ D K +FK  ALSF N        ++SPE YLI
Sbjct  306  DGKPIKETSEDKSLPICWKGRKPFKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLI  363

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +S  G+VCLG+LNG+E GL N N+IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  364  VSKHGNVCLGILNGSEVGLGNLNIIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>gb|KHN20610.1| Aspartic proteinase Asp1 [Glycine soja]
Length=454

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = -1

Query  600  GPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTL  421
            GPAEL F GK+T VK + ++FDSGSSY+Y NSQ Y+A +  V K+L+GK L+ A DDP+L
Sbjct  261  GPAELVFNGKATAVKGLELIFDSGSSYTYFNSQAYQAVVDLVTKDLKGKQLKRATDDPSL  320

Query  420  PFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNG  241
            P CWKG + F S+SDVKKYFK  ALSF      +    + PESYLII+  G+VCLG+L+G
Sbjct  321  PICWKGAKSFESLSDVKKYFKPLALSFKKIMNLQ--MHLPPESYLIITKHGNVCLGILDG  378

Query  240  TEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            TE GL N N+IGD+++QD+MVIYDNEK  IGW  +NCDR P
Sbjct  379  TEVGLENLNIIGDITLQDKMVIYDNEKQQIGWVSSNCDRLP  419



>ref|XP_010025731.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62451.1| hypothetical protein EUGRSUZ_H05086 [Eucalyptus grandis]
Length=435

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 126/177 (71%), Gaps = 4/177 (2%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  RDY KHYSP  AEL F GK TG KN+++VFDS S+Y+Y +S+ Y A    V  EL 
Sbjct  253  TPMSRDYPKHYSPETAELLFAGKPTGQKNLLLVFDSASTYTYFSSEAYRALSLRVTNELE  312

Query  459  ---GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESY  289
               GKP  E   DP LP CWKGR+ F++I +V+KYFK FAL+F +G R++T FE+ PESY
Sbjct  313  KLSGKPFTEI-RDPELPLCWKGRQSFKNIREVRKYFKPFALTFNSGKRTKTQFEVPPESY  371

Query  288  LIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LIIS  G+VC+GVLNGT+  L + NVIGD+SMQD+MVIYDN  + +GW   +C + P
Sbjct  372  LIISKMGNVCMGVLNGTQEKLGDTNVIGDISMQDKMVIYDNANHCLGWASEDCSQLP  428



>ref|XP_011458802.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458803.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 124/165 (75%), Gaps = 2/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HYS GPAEL F GK TGVK++ +VFDSGSSY+Y NS+ YEA +  +  +L+GKPL++A D
Sbjct  251  HYSSGPAELVFNGKPTGVKSLNLVFDSGSSYTYFNSKAYEALVKLLRNDLKGKPLKDAPD  310

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D +LP CWKG +PF+S+ DV+ YFK  ALSF N        +ISPE+YLI+S  G+VCLG
Sbjct  311  DKSLPICWKGSKPFKSVRDVQNYFKPLALSFTNA--KNVQLQISPEAYLIVSHHGNVCLG  368

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + NVIGD+++ D+++IYDNE   IGW  ANC+R P
Sbjct  369  ILNGSEVGLGSMNVIGDITLLDKVLIYDNENQRIGWGPANCNRLP  413



>ref|XP_007137749.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
 gb|ESW09743.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
Length=438

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPL  448
            RDY  + + G AEL FGGK TGV N+  +FD+GSSY+Y NS  Y+  +  + KE  GKPL
Sbjct  262  RDYKHYSAAGAAELIFGGKRTGVGNLHAIFDTGSSYTYFNSNAYQTLISLLRKESGGKPL  321

Query  447  REAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKG  268
            +EA  D TLP CW G+RPF+SI +V+KYFK   LSF++  RS+  FEI PE YLIIS+ G
Sbjct  322  KEAHGDQTLPLCWHGKRPFKSIYEVRKYFKPITLSFSSNGRSKAQFEIPPEGYLIISNMG  381

Query  267  SVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            +VCLG+LNG+E G+ + N+IGD+SM ++++++DN+K  IGWT A+CDR P    V I
Sbjct  382  NVCLGILNGSEVGMGDLNLIGDISMLNKVMVFDNDKQLIGWTPADCDRVPKSRDVSI  438



>ref|XP_007223385.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
 gb|EMJ24584.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
Length=451

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRDYTK-HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R+  + HYS GPAEL F GKSTGVK + +VFDSGSSY+Y NSQ Y+A +  V  +L
Sbjct  246  TPMSRNSMENHYSSGPAELVFNGKSTGVKGLSLVFDSGSSYTYFNSQAYKAVVNLVRNDL  305

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKP++E  +D +LP CWKGR+PF+S+ D K +FK  ALSF N        ++SPE YLI
Sbjct  306  DGKPIKETNEDKSLPICWKGRKPFKSVGDAKNFFKPLALSFINA--KNVQLQLSPEDYLI  363

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +S  G+VC G+LNG+E GL N N+IGD+ + D+M+IYDNE   IGW  ANC+R P
Sbjct  364  VSKHGNVCFGILNGSEVGLENLNIIGDIMLLDKMLIYDNENQRIGWAPANCNRLP  418



>ref|XP_007203973.1| hypothetical protein PRUPE_ppa025075mg [Prunus persica]
 gb|EMJ05172.1| hypothetical protein PRUPE_ppa025075mg [Prunus persica]
Length=377

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P    K YS GPAEL F GK+T VK + ++FDSGSSY+Y NSQ Y+A +  V  +L+GKP
Sbjct  199  PNSMGKRYSCGPAELVFDGKATSVKGLNMIFDSGSSYTYFNSQAYQAIVTLVRNDLKGKP  258

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK  271
            L++A +D +LP CWKGR+PF+ + D K YFK  ALSF N    +   ++SPE+YLI++  
Sbjct  259  LKDATEDQSLPICWKGRKPFKFVRDAKNYFKPLALSFTNAKNVQP--QLSPETYLIVTKH  316

Query  270  GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            G+VCLG+LNGTE GL N N+IGD++++D+M+IYDNE   IGW   NC+  P    V I
Sbjct  317  GNVCLGILNGTEVGLGNLNIIGDITLRDKMLIYDNENRQIGWAPVNCNMLPKSRTVAI  374



>ref|XP_010095410.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXB60102.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=458

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 122/175 (70%), Gaps = 3/175 (2%)
 Frame = -1

Query  639  TPCPRDYT-KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            T   +DY  KHY  GPAEL FGGK  G+K + V+FDSGSSY+Y NS  YEA +  V K L
Sbjct  247  TAISQDYVDKHYGSGPAELYFGGKPAGIKGLEVIFDSGSSYTYFNSPAYEAVVNLVKKSL  306

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GKPL++  +D +LP CWKG + F+S+ D KK+F   ALSF N        ++ PE+YLI
Sbjct  307  NGKPLKDTAEDKSLPICWKGNKAFKSVQDAKKFFTPLALSFTN--FKHVQLQLLPEAYLI  364

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ++  GSVCLG+LNGT+ GL N N+IGDVS+Q++MVIYDNEK  IGW   NCDR P
Sbjct  365  VTKLGSVCLGILNGTQVGLENLNIIGDVSLQEKMVIYDNEKKQIGWGPVNCDRLP  419



>ref|XP_004290889.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 124/165 (75%), Gaps = 2/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HYS GPAEL F GK TGVK++ +VFDSGSSY+Y NS+ YEA +  +  +L+GKPL++A D
Sbjct  251  HYSSGPAELVFNGKPTGVKSLNLVFDSGSSYTYFNSKAYEALVKLLRNDLKGKPLKDAPD  310

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D +LP CWKG +PF+S+ DV+ YFK  ALSF N        +ISPE+YLI+S  G+VCLG
Sbjct  311  DKSLPICWKGSKPFKSVRDVQNYFKPLALSFTNA--KNVQLQISPEAYLIVSHHGNVCLG  368

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + NVIGD+++ D+++IYDNE   IGW  ANC+R P
Sbjct  369  ILNGSEVGLGSMNVIGDITLLDKVLIYDNENQRIGWGPANCNRLP  413



>ref|XP_003522473.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=440

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = -1

Query  627  RDYTKHYS-PGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            RDY KHYS  G AEL FGGK +GV N+  VFD+GSSY+Y NS  Y+  +  + KE  GKP
Sbjct  264  RDY-KHYSVAGAAELLFGGKKSGVGNLHAVFDTGSSYTYFNSYAYQVLISWLKKESGGKP  322

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK  271
            L+EA DD TLP CW+GRRPFRSI +V+KYFK   LSF +  RS+  FE+ PE+YLI+S+ 
Sbjct  323  LKEAHDDQTLPLCWRGRRPFRSIYEVRKYFKPIVLSFTSNGRSKAQFEMLPEAYLIVSNM  382

Query  270  GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            G+VCLG+LNG+E G+ + N+IGD+SM ++++++DN+K  IGW  A+CD+ P    V I
Sbjct  383  GNVCLGILNGSEVGMGDLNLIGDISMLNKVMVFDNDKQLIGWAPADCDQVPKSRDVSI  440



>ref|XP_002889144.1| hypothetical protein ARALYDRAFT_476912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65403.1| hypothetical protein ARALYDRAFT_476912 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL + 
Sbjct  259  SKNYMTGPAELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDT  318

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD +LP CWKG++P +S+ +VKKYFK+  L F    ++  LF++ PESYLII+ KG+VC
Sbjct  319  KDDKSLPVCWKGKKPLKSLDEVKKYFKTITLRFGY-QKNGQLFQVPPESYLIITEKGNVC  377

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  109
            LG+LNGTE GL +YN++GD+S Q  MVIYDNEK  IGW  ++CD+ P  N
Sbjct  378  LGILNGTEVGLDSYNIVGDISFQGIMVIYDNEKQRIGWISSDCDKIPNVN  427



>ref|XP_003528065.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN09648.1| Aspartic proteinase Asp1 [Glycine soja]
Length=438

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPL  448
            RDY  + + G AEL FGGK +G+ ++  VFD+GSSY+Y N   Y+A +  + KE  GKPL
Sbjct  262  RDYKHYSAAGAAELLFGGKKSGIGSLHAVFDTGSSYTYFNPYAYQALISWLGKESGGKPL  321

Query  447  REAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKG  268
            +EA DD TLP CW+GRRPFRSI +V+KYFK   LSF +  RS+  FE+ PE+YLIIS+ G
Sbjct  322  KEAHDDQTLPLCWRGRRPFRSIYEVRKYFKPIVLSFTSNGRSKAQFEMPPEAYLIISNMG  381

Query  267  SVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            +VCLG+LNG+E G+ + N+IGD+SM ++++++DN+K  IGWT A+CD+ P    V I
Sbjct  382  NVCLGILNGSEVGMGDLNLIGDISMLNKVMVFDNDKQLIGWTPADCDQVPKSRDVSI  438



>emb|CDX88370.1| BnaC06g38140D [Brassica napus]
Length=460

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAE+ F  K+TGVK +  VFDSGSSY+Y N++ Y+A L  V K+L+GK L+++
Sbjct  253  SKNYKTGPAEILFDDKATGVKGVSFVFDSGSSYTYFNAEAYQAVLELVRKDLKGKALKDS  312

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWK +R  +S+ DVKKYFK+ +L F    ++  +F+I PESYLII+ KG+VC
Sbjct  313  KEDKSLPVCWKDKRALKSVHDVKKYFKTISLRFGGSQKNGQVFQIPPESYLIITEKGNVC  372

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL NYN+IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  373  LGILNGTEIGLENYNIIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  419



>ref|XP_010532199.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=414

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 124/165 (75%), Gaps = 2/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HYS G AEL F GKSTG K + ++FDSGSSY+Y NS+ Y+  +  +  +L+GKPL++A +
Sbjct  249  HYSVGSAELLFNGKSTGEKGLDLIFDSGSSYTYFNSKTYQTIVNLITNDLKGKPLKDAKE  308

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TLP CWKG +PF+S+ D K +FK+  +SF+ GW  +T F+I PESYLI+++ G+VCLG
Sbjct  309  DRTLPICWKGAKPFKSVLDAKSFFKTLTISFS-GWIRKTQFQIQPESYLIVTT-GNVCLG  366

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL N NVIGD+ MQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  367  ILNGSEVGLQNANVIGDIFMQGTMVIYDNEKQQLGWVSADCDKHP  411



>ref|XP_010268980.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
 ref|XP_010268981.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
Length=457

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = -1

Query  639  TPCPRDYT-KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  +DY+ KHYSPGPAEL  GG STGV+ +  VFDSGSSY+Y+N++ Y A + S+  +L
Sbjct  254  TPMSKDYSSKHYSPGPAELLLGGHSTGVEGLKTVFDSGSSYTYLNNRAYHALISSMKGDL  313

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
              KPL+E  D+ TLP CWKG +PF+SISD+KKYFK   L F+NG     L EI PESYLI
Sbjct  314  ARKPLKEVPDE-TLPVCWKGPKPFKSISDIKKYFKPLVLRFSNG--KNALMEIQPESYLI  370

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            IS  G+ CLG+LNG E GL + N+IGD  ++D+M+IYDNEK  +GW   +C+R P
Sbjct  371  ISPYGNACLGILNGAEVGLRDSNLIGDTFLRDKMLIYDNEKQQLGWMPTDCNRIP  425



>emb|CDX87518.1| BnaA07g33550D [Brassica napus]
Length=461

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK +  VFDSGSSY+Y N++ Y+A L  V K+L+GK L+++
Sbjct  254  SKNYKTGPAELLFDEKATGVKGVNFVFDSGSSYTYFNAEAYQAVLELVRKDLKGKALKDS  313

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWK +R  +S+ DVKKYFK+ +L F    ++  +F+I PESYLII+ KG+VC
Sbjct  314  KEDKSLPVCWKDKRGLKSVHDVKKYFKTISLRFGGSQKNGQVFQIPPESYLIITEKGNVC  373

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL NYN+IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  374  LGILNGTEIGLENYNIIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  420



>ref|XP_006393742.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
 gb|ESQ31028.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
Length=411

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 122/168 (73%), Gaps = 1/168 (1%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +  HY+ GPAEL F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  EL+GKPL++
Sbjct  243  HENHYTTGPAELLFNGKPTGLKGLKIIFDTGSSYTYFNSKTYQTIVNLIGNELKGKPLKD  302

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
            A +D TLP CWKG +P +S+ +VK  FK+  ++F N  R  T  +I PESYLIIS  G+V
Sbjct  303  AKEDKTLPICWKGAKPLKSVLEVKNLFKTLTINFMNS-RRNTQLQIPPESYLIISKTGNV  361

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            CLG+LNG+E GL + NVIGD+SMQ  MVIYDNEK  IGW  A+CD+ P
Sbjct  362  CLGILNGSEIGLQDSNVIGDISMQGIMVIYDNEKQQIGWVSADCDKLP  409



>emb|CDY41786.1| BnaC02g13700D [Brassica napus]
Length=452

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK +  +FDSGSSY+Y N++ Y+  L  + K+L+GKPL++ 
Sbjct  253  SKNYKTGPAELLFNDKTTGVKGINFIFDSGSSYTYFNAEAYQTILDLIRKDLKGKPLKDT  312

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWK  +P +S+ DVKKYFK+  L F +  ++  LF+I PESYLII+ KG+VC
Sbjct  313  KEDKSLPVCWKDMKPLKSVHDVKKYFKTITLRFGS-QKNGQLFQIPPESYLIITEKGNVC  371

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL NYN+IGD+S Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  372  LGILNGTEIGLENYNIIGDISFQGIMVIYDNEKQRIGWIPSDCDKLP  418



>ref|XP_004977228.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Setaria 
italica]
Length=390

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +  +YSPG A L FGG+S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E
Sbjct  190  FRNYYSPGSASLYFGGRSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKE  248

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               DP+LP CWKG++PF+S+ DVKK FKS  LSFANG   + L EI PE+YLI++  G+ 
Sbjct  249  V-SDPSLPLCWKGKKPFKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNA  305

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  103
            CLG+LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  306  CLGILNGSEVGLKDLNILGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  358



>ref|XP_010930728.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 124/166 (75%), Gaps = 5/166 (3%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPGPA L  G +S G K ++VV DSGSSY+Y   QPY+ F++++ K+L  + L+E  D
Sbjct  261  YYSPGPASLVLGSQSLGSK-LLVVLDSGSSYTYFGFQPYKDFVFAIKKDL-SRQLKETFD  318

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D  LP CWKGR+PF+S+ DV KYFK   LSF NG ++R   EI PE YLI++ KG+ CLG
Sbjct  319  DSLLPLCWKGRKPFKSVLDVNKYFKPLVLSFGNGRKAR--MEIPPEKYLIVTKKGNACLG  376

Query  252  VLNGTEAGLH-NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNGTEAGLH + N+IGD+S+QD +VIYDNEK  IGW RANCDR P
Sbjct  377  ILNGTEAGLHRDLNLIGDISLQDLVVIYDNEKQQIGWGRANCDRVP  422



>ref|XP_010930726.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            + +YSPGPA L  G +S G K + VV DSGSSY+Y   QPY+ FL ++ ++L  +PL E 
Sbjct  263  SNYYSPGPASLVLGSQSLGSK-LPVVLDSGSSYTYFGFQPYQDFLSAIKRDLSRQPLTET  321

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD +LP CWKG +PF+S+ DV KYFK   LSF NG ++R   EI PE+YLI++ KG+ C
Sbjct  322  SDDKSLPLCWKGPKPFKSVLDVIKYFKPLILSFGNGRKAR--MEIPPENYLIVTKKGNAC  379

Query  258  LGVLNGTEAGLHN-YNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GLH   NVIGD+S+QD +VIYDNEK  IGW RANCDR P
Sbjct  380  LGILNGTEVGLHQELNVIGDISLQDLVVIYDNEKQQIGWGRANCDRLP  427



>ref|XP_004142705.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004161182.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN54551.1| hypothetical protein Csa_4G361850 [Cucumis sativus]
Length=410

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 123/164 (75%), Gaps = 3/164 (2%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAE+ FGG   G++ +I+ FDSGSSY+Y NSQ Y A L  +   L+G+PLR+A +D
Sbjct  248  YSAGPAEVYFGGNPVGIRGLILTFDSGSSYTYFNSQVYGAVLNLLRNGLKGQPLRDAPED  307

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
             TLP CWKG + F+S++DV+ +FK  ALSF N   S+  F+I PE+YLIIS+ G+VCLG+
Sbjct  308  KTLPICWKGSKAFKSVADVRNFFKPLALSFGN---SKVQFQIPPEAYLIISNLGNVCLGI  364

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG++ GL N N+IGD+SM D+M++YDNE+  IGW  ANC +PP
Sbjct  365  LNGSQVGLGNVNLIGDISMLDKMMVYDNERQQIGWAPANCSKPP  408



>ref|XP_008466731.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=437

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YS GPAE+ FGGK+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A +
Sbjct  247  YYSSGPAEVYFGGKATGIKDLTLVFDSGSSYTYFNSQAYNSILALVRNNLRGKPLEDAPE  306

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D +LP CWKG RPF+S+ DVKKYF   AL F    +++   +++PE+YLII+  G+VC G
Sbjct  307  DKSLPVCWKGPRPFKSLHDVKKYFNPLALRFTKTKKAQ--IQLAPEAYLIITKYGNVCFG  364

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            +LNGTE GL N N+IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  365  ILNGTEVGLGNLNIIGDISLKDKMVIYDNERRQIGWFPTNCNK  407



>gb|KHN47012.1| Aspartic proteinase Asp1 [Glycine soja]
Length=395

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY  GPA++ F GK+T VK + + FDSGSSY+Y NS  ++A +  +  +++GKPL  A 
Sbjct  230  KHYKTGPADMFFNGKATSVKGLELTFDSGSSYTYFNSLAHKALVDLITNDIKGKPLSRAT  289

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +DP+LP CWKG +PF+S+ DV   FK   LSF     S  LF++ PE+YLI++  G+VCL
Sbjct  290  EDPSLPICWKGPKPFKSLHDVTSNFKPLVLSFTKSKNS--LFQVPPEAYLIVTKHGNVCL  347

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+L+GTE GL N N+IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  348  GILDGTEIGLGNTNIIGDISLQDKLVIYDNEKQQIGWASANCDR  391



>gb|EYU31770.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=410

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +KHYS GPA+L FGG++T +K + +VFDSGS+Y+Y  S+ Y A +  +  +L GK L+EA
Sbjct  244  SKHYSLGPADLQFGGQATNIKGLPIVFDSGSTYTYFTSKAYNALVSLIKGDLNGKQLKEA  303

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWKG +PF+SI D   YFK  ALSF N       F+I PE YL+++ +G+VC
Sbjct  304  VEDKSLPVCWKGAKPFKSIRDATTYFKPLALSFTNA--KNVQFQIRPEYYLVVTGQGNVC  361

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNG + GL + NVIGD+SMQD++VIYDNEK  +GW  ANC+R P
Sbjct  362  LGILNGGDVGLEDINVIGDISMQDKLVIYDNEKQQVGWAPANCNRLP  408



>ref|XP_008444185.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=411

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 123/173 (71%), Gaps = 2/173 (1%)
 Frame = -1

Query  636  PCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRG  457
            P  R     YS GPAE+ FGG   G++ +I+ FDSGSSY+Y NSQ Y A L  +   L+G
Sbjct  239  PILRTPGGKYSAGPAEVYFGGNPVGIRGLILTFDSGSSYTYFNSQVYGAVLNLLRNGLKG  298

Query  456  KPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS  277
            +PLR+A +D TLP CWKG + F+S++D + +FK  ALSF N    +  F+I PE+YLIIS
Sbjct  299  QPLRDAPEDKTLPMCWKGSKAFKSVADARNFFKPLALSFGN--SKKVQFQIPPEAYLIIS  356

Query  276  SKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            + G+VCLG+LNG++ GL N N+IGD+SM D+M++YDNE+  IGW  ANC RPP
Sbjct  357  NLGNVCLGILNGSQVGLGNVNLIGDISMLDKMMVYDNERQQIGWAPANCSRPP  409



>ref|XP_006663866.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=360

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 124/165 (75%), Gaps = 4/165 (2%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HYSPG A L FGG+S GV+ M VVFDSGSS++Y  +QPY+A L + +K+   K L+E  D
Sbjct  193  HYSPGSASLYFGGRSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVAAIKDDLSKNLKEVPD  251

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
              +LP CWKG++PF+S+ DVKK FKS  LSF+NG   + L EI PE+YLI++  G+ CLG
Sbjct  252  H-SLPLCWKGKKPFKSVLDVKKEFKSVVLSFSNG--KKALMEIPPENYLIVTKYGNACLG  308

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  309  ILNGSEVGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  353



>ref|XP_010479040.1| PREDICTED: aspartic proteinase Asp1 [Camelina sativa]
Length=410

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HY+ G AE+ F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL++A +
Sbjct  245  HYTTGAAEILFNGKPTGLKGLKLIFDTGSSYTYFNSKTYQTIVKLIETDLKATPLKDAKE  304

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TLP CWKG +PF+S+ DVK YFK+  ++F NG R  T  +I PESYLIIS+ G+VCLG
Sbjct  305  DKTLPICWKGAKPFKSVLDVKTYFKTLTINFTNG-RKNTQLQIPPESYLIISNTGNVCLG  363

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + NVIGD+SMQ  MVIYDNEK  +GW  A+C++ P
Sbjct  364  LLNGSEVGLQDSNVIGDISMQGLMVIYDNEKQQLGWVTADCNKLP  408



>ref|XP_008781591.1| PREDICTED: aspartic proteinase Asp1-like [Phoenix dactylifera]
Length=461

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 4/168 (2%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            + +YSPGPA L  G +S G K + VV DSGSSY+Y   QPY  F+ ++ K+L  +PL++A
Sbjct  265  SNYYSPGPASLLLGTQSLGSK-LQVVLDSGSSYTYFGFQPYRDFISAIKKDLSRQPLKDA  323

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD +LP CWKG R FRS+ DVKKYFK   LSF NG ++    EI PE+YLI+S KG+ C
Sbjct  324  PDDKSLPLCWKGPRSFRSVLDVKKYFKPLVLSFGNGRKAT--MEIPPENYLIVSKKGNAC  381

Query  258  LGVLNGTEAGL-HNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTEAGL H+ NVIGD+S+QD +VIYDNE+  IGW +ANCDR P
Sbjct  382  LGILNGTEAGLPHDLNVIGDISLQDLVVIYDNERRQIGWGQANCDRVP  429



>ref|XP_004977226.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Setaria 
italica]
Length=451

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +  +YSPG A L FGG+S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E
Sbjct  251  FRNYYSPGSASLYFGGRSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKE  309

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               DP+LP CWKG++PF+S+ DVKK FKS  LSFANG   + L EI PE+YLI++  G+ 
Sbjct  310  V-SDPSLPLCWKGKKPFKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNA  366

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  103
            CLG+LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  367  CLGILNGSEVGLKDLNILGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  419



>ref|XP_004498348.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=444

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P    KHYS GPAEL F GK T VK + ++FDSGSSY+Y NSQ Y   L  V+ +L+GK 
Sbjct  245  PSSSEKHYSLGPAELLFNGKPTAVKGLELIFDSGSSYTYFNSQAYNVVLDLVINDLKGKQ  304

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK  271
            L+ A +D +LP CWKG + F+S+SDVK YFK  AL F     S  L  I PE YLI++  
Sbjct  305  LKRATEDASLPICWKGAKSFKSVSDVKNYFKPLALRFKKVKNSHML--IPPEGYLIVTKH  362

Query  270  GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+VCLG+L+GTE GL   N++GD+S+QD+MVIYDNE+  IGW  +NCDR P
Sbjct  363  GNVCLGILDGTEIGLGYLNILGDISLQDKMVIYDNERQQIGWISSNCDRIP  413



>ref|XP_003523438.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=407

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY  GPA++ F GK+T VK + + FDSGSSY+Y NS  ++A +  +  +++GKPL  A 
Sbjct  242  KHYKTGPADMFFNGKATSVKGLELTFDSGSSYTYFNSLAHKALVDLITNDIKGKPLSRAT  301

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +DP+LP CWKG +PF+S+ DV   FK   LSF     S  LF++ PE+YLI++  G+VCL
Sbjct  302  EDPSLPICWKGPKPFKSLHDVTSNFKPLVLSFTKSKNS--LFQVPPEAYLIVTKHGNVCL  359

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+L+GTE GL N N+IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  360  GILDGTEIGLGNTNIIGDISLQDKLVIYDNEKQRIGWASANCDR  403



>ref|XP_004977227.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Setaria 
italica]
Length=422

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 125/168 (74%), Gaps = 4/168 (2%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +  +YSPG A L FGG+S GV+ M VVFDSGSS++Y  +QPY+A L S +K    + L+E
Sbjct  251  FRNYYSPGSASLYFGGRSLGVRPMEVVFDSGSSFTYFAAQPYQA-LVSALKGGLSRTLKE  309

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               DP+LP CWKG++PF+S+ DVKK FKS  LSFANG   + L EI PE+YLI++  G+ 
Sbjct  310  V-SDPSLPLCWKGKKPFKSVLDVKKEFKSLVLSFANG--KKALMEIPPENYLIVTKYGNA  366

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            CLG+LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  367  CLGILNGSEVGLKDLNILGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>gb|EYU31771.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=442

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +KHYS GPA+L FGG++T +K + +VFDSGS+Y+Y  S+ Y A +  +  +L GK L+EA
Sbjct  244  SKHYSLGPADLQFGGQATNIKGLPIVFDSGSTYTYFTSKAYNALVSLIKGDLNGKQLKEA  303

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWKG +PF+SI D   YFK  ALSF N       F+I PE YL+++ +G+VC
Sbjct  304  VEDKSLPVCWKGAKPFKSIRDATTYFKPLALSFTNA--KNVQFQIRPEYYLVVTGQGNVC  361

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNG + GL + NVIGD+SMQD++VIYDNEK  +GW  ANC+R P
Sbjct  362  LGILNGGDVGLEDINVIGDISMQDKLVIYDNEKQQVGWAPANCNRLP  408



>ref|XP_010063407.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Eucalyptus grandis]
 ref|XP_010063408.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Eucalyptus grandis]
 gb|KCW70627.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
 gb|KCW70628.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=418

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY+ GPAEL +  K TGVK + VVFDSGSSY+Y+NS+ Y+A L  V  +L+GKPL++A 
Sbjct  254  KHYAAGPAELLYNDKPTGVKGLKVVFDSGSSYTYLNSKAYQAVLNQVRADLKGKPLKDAV  313

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +LP CWKG +PF+S+ +VK +FK   L+F  G       ++ PE+YLI++  G+ CL
Sbjct  314  EDKSLPICWKGAKPFKSVHEVKNHFKPLQLNFGKG---NAQLQLLPEAYLIVTKHGNACL  370

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNG E  L   N+IGD+SMQD+MV+YDNEK  IGW  A+CDR P
Sbjct  371  GILNGGEVRLGELNLIGDISMQDKMVVYDNEKKQIGWVTADCDRLP  416



>ref|XP_007019123.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY16348.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=463

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 121/170 (71%), Gaps = 5/170 (3%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            D  KHY   PAEL FGGK TG+K++ +VFDSGSSY+Y   + YEA L  V + L GKPL 
Sbjct  255  DVAKHYLSSPAELLFGGKPTGIKDLKIVFDSGSSYTYFCLRVYEAVLDLVRRGLTGKPLN  314

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKG  268
               D   LP CWKG +PF+++ DVK YF +  LSF N   +R +  ++ PE+YLI++  G
Sbjct  315  TVHDQ-ALPICWKGSKPFKTVHDVKHYFSTLTLSFTN---TRNIQLQLPPEAYLIVTEHG  370

Query  267  SVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            + CLG+LNGTEAGL ++N+IGD+S+QD+MV+YDNEK  IGW  ANCDR P
Sbjct  371  NACLGILNGTEAGLDDFNIIGDISLQDKMVVYDNEKQQIGWVSANCDRLP  420



>ref|XP_010063406.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Eucalyptus grandis]
 gb|KCW70626.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=438

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY+ GPAEL +  K TGVK + VVFDSGSSY+Y+NS+ Y+A L  V  +L+GKPL++A 
Sbjct  254  KHYAAGPAELLYNDKPTGVKGLKVVFDSGSSYTYLNSKAYQAVLNQVRADLKGKPLKDAV  313

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +LP CWKG +PF+S+ +VK +FK   L+F  G       ++ PE+YLI++  G+ CL
Sbjct  314  EDKSLPICWKGAKPFKSVHEVKNHFKPLQLNFGKG---NAQLQLLPEAYLIVTKHGNACL  370

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNG E  L   N+IGD+SMQD+MV+YDNEK  IGW  A+CDR P
Sbjct  371  GILNGGEVRLGELNLIGDISMQDKMVVYDNEKKQIGWVTADCDRLP  416



>ref|XP_010238658.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=451

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +  +YSPG A L FGG+S GV+ M VV DSGSS++Y  +QPY+A + ++  +L  K L+E
Sbjct  251  FKNYYSPGTASLYFGGRSLGVRPMEVVLDSGSSFTYFGAQPYQALVTALKSDLS-KTLKE  309

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               DP+LP CWKG++PF+S+ DVKK FKS  LSF+NG   + L EI PE+YLI++  G+ 
Sbjct  310  V-FDPSLPLCWKGKKPFKSVLDVKKEFKSLVLSFSNG--KKALMEIPPENYLIVTKFGNA  366

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  103
            CLG+LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  367  CLGILNGSEIGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIPNENTI  419



>emb|CDP10935.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRG-KPLREA  439
            KHYS GPA+L FGG+++GVK   +VFDSGS+Y+Y NSQ Y A +  + K++ G K L++A
Sbjct  253  KHYSVGPADLFFGGQASGVKGQSIVFDSGSTYNYFNSQAYNAVVSLLKKDINGRKQLQDA  312

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             DD +LP CWK  +PF+SI DVK YFK  AL F +       F++ PE+YLI++ +G+ C
Sbjct  313  VDDKSLPICWKAPKPFKSILDVKSYFKPLALVFTSA--KNVQFQLQPEAYLIVTKQGNAC  370

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE G+  +NVIGD+S+QD++VIYDNEK  IGW  ANC+R P
Sbjct  371  LGILNGTEVGIGKFNVIGDISLQDKLVIYDNEKQQIGWASANCNRLP  417



>ref|XP_010416691.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=457

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL++ 
Sbjct  253  SKNYMTGPAELLFNAKTTGVKGIDVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLKDT  312

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWKG++P +S+ +VKKYFK+  L F N  ++  LF++  ESYLII+ KG+VC
Sbjct  313  -EDKSLPVCWKGKKPMKSLDEVKKYFKTITLRFGN-QKNGQLFQVPSESYLIITEKGNVC  370

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL +YN+IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  371  LGILNGTEVGLDSYNIIGDIFFQGIMVIYDNEQHRIGWISTDCDKTP  417



>ref|XP_004171754.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=437

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 121/163 (74%), Gaps = 2/163 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YS GPAE+ FGGK+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A +
Sbjct  247  YYSSGPAEVYFGGKATGIKDLTLVFDSGSSYTYFNSQAYNSILALVKNNLRGKPLEDAPE  306

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D +LP CWKG RPF+S+ DVKKYF   AL F     ++   ++ PE+YLII+  G+VC G
Sbjct  307  DKSLPVCWKGTRPFKSLRDVKKYFNLLALRFTKTKNAQ--IQLPPENYLIITKYGNVCFG  364

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            +LNGTE GL + N+IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  365  ILNGTEVGLGDLNIIGDISLKDKMVIYDNERRRIGWFPTNCNK  407



>gb|EMS63812.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=441

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +  +YSPG A L FGG+S GV+ M VV DSGSS++Y +SQPY++ + ++  +L  K L+E
Sbjct  271  FRNYYSPGSASLYFGGRSLGVRPMEVVLDSGSSFTYFSSQPYQSLVTALKGDLS-KALKE  329

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               DP+LP CWKG++PF+S+ DVKK FKS  L+FANG   + L EI PE+YLI++  G+ 
Sbjct  330  V-SDPSLPLCWKGKKPFKSVLDVKKEFKSLVLNFANG--KKALMEIPPENYLIVTKYGNA  386

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            CLG+LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  387  CLGILNGSEIGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  434



>ref|XP_006302228.1| hypothetical protein CARUB_v10020249mg [Capsella rubella]
 gb|EOA35126.1| hypothetical protein CARUB_v10020249mg [Capsella rubella]
Length=465

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK + +VFDSGSSY+Y N++ Y+A L  + K+L GK L++ 
Sbjct  257  SKNYMTGPAELLFNDKTTGVKGINLVFDSGSSYTYFNAEAYQAILDLIRKDLNGKLLKDT  316

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWKG++  +SI +VKKYFK   L F N  ++  LFE+ PESYLII+ KG+VC
Sbjct  317  KEDKSLPVCWKGKKALKSIDEVKKYFKKITLRFGN-QKNGQLFEVPPESYLIITQKGNVC  375

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN  109
            LG+LNGTE GL +YN+IGD+  Q  +VIYDNEK  IGW   +CD+ P  N
Sbjct  376  LGILNGTEVGLDSYNIIGDIFFQGILVIYDNEKQRIGWIPTDCDKLPKVN  425



>ref|XP_010322933.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=424

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL F G++TG+K++ ++FDSGS+++Y +S+ Y+ FL S+ K +  K L +A 
Sbjct  225  KHYSLGPAELLFDGQATGIKSLPIIFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDAT  284

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD +LP CW G +PF+S++D   YFK F LSF      +  F++ PE+YLI++  G+VCL
Sbjct  285  DDKSLPVCWSGSKPFKSVNDATIYFKPFTLSFMKAKNVK--FQLLPEAYLIVTEHGNVCL  342

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNGTE GL N+N+IGD+S+ D+MVIYDNEK  IGW  ANC++ P
Sbjct  343  GILNGTEVGLENHNLIGDISLLDKMVIYDNEKKQIGWHPANCNKFP  388



>ref|XP_004242040.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=441

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL F G++TG+K++ ++FDSGS+++Y +S+ Y+ FL S+ K +  K L +A 
Sbjct  242  KHYSLGPAELLFDGQATGIKSLPIIFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDAT  301

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD +LP CW G +PF+S++D   YFK F LSF      +  F++ PE+YLI++  G+VCL
Sbjct  302  DDKSLPVCWSGSKPFKSVNDATIYFKPFTLSFMKAKNVK--FQLLPEAYLIVTEHGNVCL  359

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNGTE GL N+N+IGD+S+ D+MVIYDNEK  IGW  ANC++ P
Sbjct  360  GILNGTEVGLENHNLIGDISLLDKMVIYDNEKKQIGWHPANCNKFP  405



>ref|XP_011069472.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Sesamum indicum]
Length=408

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+YS GPA+L FGG++T VK + +VFDSGS+Y+Y +SQ Y+  +  +  +L GK L++A
Sbjct  242  SKYYSLGPADLQFGGQATNVKGLPIVFDSGSTYTYFSSQAYKGLVSLIKGDLNGKQLKDA  301

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWKG +PF+SI DV  YFK   L+F N        ++ PESYLI++  G+VC
Sbjct  302  VEDRSLPVCWKGAKPFKSIRDVVNYFKPLVLNFTNA--KNIHLQLRPESYLIVTEHGNVC  359

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+L+G E GL N NVIGD+S+QDR+VIYDNE+  IGW  ANCDR P
Sbjct  360  LGILDGGEVGLGNINVIGDISLQDRLVIYDNERQQIGWAPANCDRLP  406



>ref|XP_003523437.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN47011.1| Aspartic proteinase Asp1 [Glycine soja]
Length=421

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            +HY  GPA+L F  K+T VK + ++FDSGSSY+Y NSQ ++A +  +  +LRGKPL  A 
Sbjct  256  QHYKTGPADLFFDRKTTSVKGLELIFDSGSSYTYFNSQAHKALVNLIANDLRGKPLSRAT  315

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
             DP+LP CWKG +PF+S+ DV   FK   LSF     S    ++ PE+YLI++  G+VCL
Sbjct  316  GDPSLPICWKGPKPFKSLHDVTSNFKPLLLSFTKSKNSP--LQLPPEAYLIVTKHGNVCL  373

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+L+GTE GL N N+IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  374  GILDGTEIGLGNTNIIGDISLQDKLVIYDNEKQQIGWASANCDR  417



>ref|XP_010428825.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=463

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 124/167 (74%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK +  VFDSGSSY+Y N++ Y+A L  + K+L GKPL++ 
Sbjct  258  SKNYMTGPAELLFNAKTTGVKGINFVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLKDT  317

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWKG++P +S+ +VKKYFK+  L F N  ++  L ++ PESYLII+ KG+VC
Sbjct  318  -EDQSLPVCWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLLQVPPESYLIITEKGNVC  375

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL +YN+IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  376  LGILNGTEVGLDSYNIIGDIFFQGIMVIYDNEQHRIGWISTDCDKIP  422



>gb|KJB29193.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=266

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL FGGK TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +  
Sbjct  101  KHYSSGPAELLFGGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDV-  159

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
             D  LP CWKG +PF+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCL
Sbjct  160  KDKALPICWKGTKPFKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCL  217

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+LNG EAGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  218  GILNGAEAGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  261



>ref|XP_009123049.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=411

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HY+ GPAEL + GK TG+  + ++FDSGS+Y+Y N + Y+A +  +  +L+GKP+++  D
Sbjct  247  HYTTGPAELLYNGKPTGLNGLKLIFDSGSTYTYFNRKTYQAIVNLIGNDLKGKPVKDVKD  306

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TL  CWKG +P +S+ +VK  FK+  ++F NG R+ +  +I PESYLI+S  G+VCLG
Sbjct  307  DKTLAICWKGAKPLKSVLEVKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVCLG  365

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+EAGL + NVIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  366  ILNGSEAGLQDSNVIGDISMQGAMVIYDNEKQQLGWVSADCDKLP  410



>emb|CDY10133.1| BnaC05g03760D [Brassica napus]
Length=427

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            + HY+ GPAEL + GK TG+  + ++FDSGS+Y+Y NS+ Y+A +  +  +L+GKPL++ 
Sbjct  261  SNHYTTGPAELLYNGKPTGLSGLKLIFDSGSTYTYFNSKTYQAIVNLIGNDLKGKPLKDV  320

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D TL  CWKG  P +S+ + K  FK+  ++F NG R+ +  +I PESYLI+S  G+VC
Sbjct  321  KEDKTLAICWKGATPLKSVLEAKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVC  379

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNG+E GLH+ NVIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  380  LGILNGSEVGLHDSNVIGDISMQGTMVIYDNEKQQLGWVSADCDKLP  426



>ref|XP_010471942.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=463

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK +  VFDSGSSY+Y N++ Y+  L  + K+L GKPL++ 
Sbjct  259  SKNYMTGPAELLFNAKTTGVKGINFVFDSGSSYTYFNAEAYQTILDLIRKDLNGKPLKDT  318

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D  LP CWKG++P +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG++C
Sbjct  319  -EDKNLPVCWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGNIC  376

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL +YN+IGD+  Q  MVIYDNE++ IGW   +CD+ P
Sbjct  377  LGILNGTEVGLDSYNIIGDIFFQGIMVIYDNEQHRIGWISTDCDKIP  423



>ref|XP_004149806.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN47712.1| hypothetical protein Csa_6G383000 [Cucumis sativus]
Length=437

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YS GPAE+ F GK+TG+K++ +VFDSGSSY+Y NSQ Y + L  V   LRGKPL +A +
Sbjct  247  YYSSGPAEVYFSGKATGIKDLTLVFDSGSSYTYFNSQAYNSILALVKNNLRGKPLEDAPE  306

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D +LP CWKG RPF+S+ DVKKYF   AL F     ++   ++ PE+YLII+  G+VC G
Sbjct  307  DKSLPVCWKGTRPFKSLRDVKKYFNPLALRFTKTKNAQ--IQLPPENYLIITKYGNVCFG  364

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            +LNGTE GL + N+IGD+S++D+MVIYDNE+  IGW   NC++
Sbjct  365  ILNGTEVGLGDLNIIGDISLKDKMVIYDNERRRIGWFPTNCNK  407



>ref|XP_011069464.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=440

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+YS GPA+L FGG++T VK + +VFDSGS+Y+Y +SQ Y+  +  +  +L GK L++A
Sbjct  242  SKYYSLGPADLQFGGQATNVKGLPIVFDSGSTYTYFSSQAYKGLVSLIKGDLNGKQLKDA  301

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWKG +PF+SI DV  YFK   L+F N        ++ PESYLI++  G+VC
Sbjct  302  VEDRSLPVCWKGAKPFKSIRDVVNYFKPLVLNFTNA--KNIHLQLRPESYLIVTEHGNVC  359

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+L+G E GL N NVIGD+S+QDR+VIYDNE+  IGW  ANCDR P
Sbjct  360  LGILDGGEVGLGNINVIGDISLQDRLVIYDNERQQIGWAPANCDRLP  406



>ref|XP_009106403.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=457

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 121/167 (72%), Gaps = 4/167 (2%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK +  VFDSGSSY+Y N++ Y A L  V K+L+GK L++ 
Sbjct  254  SKNYKTGPAELLFDEKATGVKGVNFVFDSGSSYTYFNAEAYRAVLDLVRKDLKGKALKDT  313

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWK +R  +S+ DVKKYFK+ +L F    +    F+I PESYLII+ KG+VC
Sbjct  314  KEDKSLPVCWKDKRALKSVHDVKKYFKTISLRFGGSQK----FQIPPESYLIITEKGNVC  369

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL NYN+IGD+S Q  M+IYDNEK  IGW  ++CD+ P
Sbjct  370  LGILNGTEIGLENYNIIGDISFQGIMMIYDNEKQRIGWIPSDCDKLP  416



>gb|KEH40514.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=415

 Score =   194 bits (494),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P    KHYS G AEL F GK T +K + ++FDSGSSY+Y NS+ Y+  +  V  +L+G  
Sbjct  245  PSSSEKHYSLGQAELLFNGKPTTIKGLDLIFDSGSSYTYFNSKAYQTIVDQVTNDLKGNQ  304

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK  271
            L+ A +DP+LP CWKG + F+++SDVK YFK  AL F     S+ L  I PE YLI++  
Sbjct  305  LKRATEDPSLPICWKGSKSFKTVSDVKNYFKPLALRFKKVKNSQML--IPPEGYLIVTKH  362

Query  270  GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+VCLG+L+GTE GL + N+IGD+S+QD+MVIYDNE+  IGW   +CDR P
Sbjct  363  GNVCLGILDGTEVGLGDLNIIGDISLQDKMVIYDNERQQIGWISYDCDRIP  413



>ref|XP_011468246.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=400

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   DY+KHYSPG AEL F GK+TG++N+ +VFDSGSSY+Y+NSQ Y      + +EL 
Sbjct  247  TPMSPDYSKHYSPGSAELIFDGKTTGMRNLHLVFDSGSSYTYLNSQAYHFLTLWLKRELN  306

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            GKPL+E  DD TLP CWKGR+PF++I +VKKYFK  AL FA G +    FE+SPE+YLII
Sbjct  307  GKPLKETSDDRTLPLCWKGRKPFKNIREVKKYFKPIALRFAIGRKDAAQFELSPEAYLII  366

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGD  202
            SSKG+VCLG+L+GTE GL N N+IGD
Sbjct  367  SSKGNVCLGILDGTEVGLQNSNIIGD  392



>ref|XP_003526637.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN21715.1| Aspartic proteinase Asp1 [Glycine soja]
Length=421

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            T+HY  GPA+L F  K T VK + ++FDSGSSY+Y NS+ ++A +  V  +LRGKPL  A
Sbjct  255  TQHYKTGPADLFFDRKPTSVKGLQLIFDSGSSYTYFNSKAHKALVNLVTNDLRGKPLSRA  314

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CW+G +PF+S+ DV   FK   LSF     S  L ++ PE+YLI++  G+VC
Sbjct  315  TEDSSLPICWRGPKPFKSLHDVTSNFKPLLLSFTKSKNS--LLQLPPEAYLIVTKHGNVC  372

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            LG+L+GTE GL N N+IGD+S+QD++VIYDNEK  IGW  ANCDR
Sbjct  373  LGILDGTEIGLGNTNIIGDISLQDKLVIYDNEKQQIGWASANCDR  417



>gb|KDP32842.1| hypothetical protein JCGZ_12134 [Jatropha curcas]
Length=478

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 120/173 (69%), Gaps = 2/173 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY  GPAEL FGGK TGVK    +FDSGSSYSY N+Q Y+  L  + K+L GK L++A 
Sbjct  264  KHYISGPAELLFGGKPTGVKGQRFIFDSGSSYSYFNAQLYKNMLNLIRKDLSGKQLKDAP  323

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            ++  L  CWKG +PF+++SD K YFK  ALSF          ++ PE YLI+++ G+VCL
Sbjct  324  EEKALSICWKGIKPFKTVSDAKSYFKPLALSFTAA--KNVQLQLQPEDYLIVTNGGNVCL  381

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI  97
            G+LNG+E GL N NVIGD+  QD++VIYDN+K+ IGW  ANCDR P  +  FI
Sbjct  382  GILNGSEVGLGNLNVIGDIFFQDKLVIYDNDKHQIGWVPANCDRLPNVDRDFI  434



>ref|XP_007019119.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16344.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=408

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 124/168 (74%), Gaps = 3/168 (2%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            + KHYS GPAEL FGGK TGVK + V+FDSG++Y+Y++S+ Y+  L  + K+L GK LR+
Sbjct  243  FDKHYSSGPAELLFGGKPTGVKGLNVIFDSGATYTYLSSKVYQTVLNLIRKDLTGKQLRD  302

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
              D+  LP CWKG +PF+S+ DV+ YF +  LSFA    ++ +  + PE+YLI++ +G+V
Sbjct  303  VKDN-ALPICWKGAKPFKSVRDVRNYFNTLVLSFAGANNNKLV--LPPEAYLIVTERGNV  359

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            CLG+L+GTEAGL   NVIGD+S+QD++VIYDNE   IGW  A+C R P
Sbjct  360  CLGILSGTEAGLGITNVIGDISLQDKLVIYDNENQRIGWASADCTRKP  407



>ref|XP_006390086.1| hypothetical protein EUTSA_v10018497mg [Eutrema salsugineum]
 gb|ESQ27372.1| hypothetical protein EUTSA_v10018497mg [Eutrema salsugineum]
Length=468

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F  K+TGVK + +VFDSGSSY+Y N++ Y+A L  + K+++GK L +A
Sbjct  260  SKNYMTGPAELLFNDKTTGVKGINLVFDSGSSYTYFNAEAYKAILDLIRKDVKGKALMDA  319

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWK ++P +S+ DVKKYFK+  L F +  +S  LF + PESYLII+  G+VC
Sbjct  320  KEDKSLPVCWKDKKPLKSVHDVKKYFKTITLRFGS-QKSGQLFHVPPESYLIITENGNVC  378

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL NYN+IGD+  Q  MVIYDNEK  IGW  ++C++ P
Sbjct  379  LGILNGTEIGLENYNIIGDIFFQGIMVIYDNEKQRIGWIPSDCNKLP  425



>emb|CDY14973.1| BnaA10g08830D [Brassica napus]
Length=410

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HY+ GPAEL + GK+TG+  + ++FDSGS+Y+Y N + Y+A +  +   L+GKP+++  D
Sbjct  246  HYTTGPAELLYNGKATGLNGLKLIFDSGSTYTYFNRKTYQAIVNLIGNNLKGKPVKDVKD  305

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TL  CWKG +P +S+ +VK  FK+  ++F NG R+ +  +I PESYLI+S  G+VCLG
Sbjct  306  DKTLAICWKGAKPLKSVLEVKNLFKTLTINFKNG-RTNSQLQIPPESYLIVSKTGNVCLG  364

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + NVIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  365  ILNGSEVGLQDSNVIGDISMQGVMVIYDNEKQQLGWVSADCDKLP  409



>gb|KEH40515.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=441

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P    KHYS G AEL F GK T +K + ++FDSGSSY+Y NS+ Y+  +  V  +L+G  
Sbjct  245  PSSSEKHYSLGQAELLFNGKPTTIKGLDLIFDSGSSYTYFNSKAYQTIVDQVTNDLKGNQ  304

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK  271
            L+ A +DP+LP CWKG + F+++SDVK YFK  AL F     S+ L  I PE YLI++  
Sbjct  305  LKRATEDPSLPICWKGSKSFKTVSDVKNYFKPLALRFKKVKNSQML--IPPEGYLIVTKH  362

Query  270  GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+VCLG+L+GTE GL + N+IGD+S+QD+MVIYDNE+  IGW   +CDR P
Sbjct  363  GNVCLGILDGTEVGLGDLNIIGDISLQDKMVIYDNERQQIGWISYDCDRIP  413



>ref|XP_002888605.1| hypothetical protein ARALYDRAFT_475850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64864.1| hypothetical protein ARALYDRAFT_475850 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HY+ GPAEL F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL+ A +
Sbjct  245  HYTTGPAELLFNGKPTGLKGLKLIFDTGSSYTYFNSKTYQTIVNLIGNDLKVSPLKVAKE  304

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TLP CWKG +PF+S+ +VK +FK+  ++F N  R  T  +I PESYLIIS  G+ CLG
Sbjct  305  DKTLPICWKGAKPFKSVLEVKNFFKTITINFTNA-RRNTQLQIPPESYLIISKTGNACLG  363

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL N NVIGD+SMQ  ++IYDNEK  +GW  +NC++ P
Sbjct  364  LLNGSEVGLQNSNVIGDISMQGLLIIYDNEKQQLGWVSSNCNKLP  408



>gb|KFK42141.1| hypothetical protein AALP_AA2G216700 [Arabis alpina]
Length=461

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 123/167 (74%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+Y  GPAEL F GK+ GVK++ +VFDSGSSY+Y N++ Y+  L  + K+L GKPL + 
Sbjct  255  SKNYMTGPAELLFDGKTAGVKDINLVFDSGSSYTYFNAEAYQVILNLISKDLNGKPLVDK  314

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWK ++P +S+ DVKKYFK+  L F +  ++  LF++ PESYLII+ KG+VC
Sbjct  315  -EDKSLPVCWKDKKPLKSLDDVKKYFKTITLRFGS-QKNGQLFQVPPESYLIITEKGNVC  372

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNGTE GL  YN+IGD+  Q  MVIYDNEK  IGW  ++CD+ P
Sbjct  373  LGILNGTEIGLDGYNIIGDIFFQGIMVIYDNEKQRIGWIPSDCDKLP  419



>ref|XP_009611015.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
 ref|XP_009611017.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=417

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPA+L F G++TG+K + ++FDSGS+YSY NS  Y+  + S+ K++  K L EA 
Sbjct  254  KHYSLGPADLLFSGQATGIKGIPIIFDSGSTYSYFNSDAYKILVSSIKKDINTKQLTEAV  313

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD +LP CWKG + F+SI D K YFK   LSF          ++SPE+YL+ +  G++CL
Sbjct  314  DDKSLPVCWKGSKSFKSIHDAKSYFKPLTLSFTKA--KNVQLQLSPEAYLVRTEHGNICL  371

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+L+G+E GL NYN+IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  372  GILDGSEVGLGNYNIIGDISMVDKMVIYDNEKQQIGWVPANCNKLP  417



>gb|KJB29192.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
 gb|KJB29194.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=332

 Score =   190 bits (483),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL FGGK TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +  
Sbjct  167  KHYSSGPAELLFGGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDV-  225

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
             D  LP CWKG +PF+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCL
Sbjct  226  KDKALPICWKGTKPFKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCL  283

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+LNG EAGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  284  GILNGAEAGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  327



>emb|CDY12535.1| BnaC06g00610D [Brassica napus]
Length=393

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HY+ GPAEL +  K TG+  + ++FDSGSSY+Y NS+ Y+A +  +  +L+GKPL++  +
Sbjct  229  HYTTGPAELLYNRKPTGLNGLKLIFDSGSSYTYFNSKTYQAIVNLIGNDLKGKPLKDVKE  288

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TL  CWKG +P +S+ +VK  FK+  ++F NG R  +  +I PESYLI+S  G+VCLG
Sbjct  289  DKTLAICWKGAKPLKSVLEVKNLFKTLTINFKNG-RKNSQLQIPPESYLIVSKTGNVCLG  347

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + NVIGD+SMQ  MVIYDNEK  +GW  A+CD+ P
Sbjct  348  ILNGSEVGLQDSNVIGDISMQGTMVIYDNEKQQLGWVSADCDKLP  392



>ref|XP_011003438.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=425

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAEL FGGK TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L GKPL++A ++
Sbjct  262  YSSGPAELLFGGKPTGIKGLQLIFDSGSSYTYFNAQVYQSTLNLVRKDLAGKPLKDAPEE  321

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
              L  CWK  +P +SI D+K YFK   +SF N        +++PE YLII+  G+VCLG+
Sbjct  322  KELAVCWKTAKPIKSILDIKSYFKPLTISFMNA--KNVQLQLAPEDYLIITKDGNVCLGI  379

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG+E  L N+N IGD+ MQDR+VIYDNEK  IGW  ANCDR P
Sbjct  380  LNGSEQHLGNFNAIGDIFMQDRVVIYDNEKQQIGWFPANCDRLP  423



>gb|EEC68949.1| hypothetical protein OsI_37668 [Oryza sativa Indica Group]
Length=421

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 124/165 (75%), Gaps = 4/165 (2%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG A L FGG+  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E  D
Sbjct  254  YYSPGSANLYFGGRPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEVPD  312

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
              +LP CWKG++PF+S+ DVKK FK+  LSF+NG   + L EI PE+YLI++  G+ CLG
Sbjct  313  H-SLPLCWKGKKPFKSVLDVKKEFKTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLG  369

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  370  ILNGSEVGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>ref|XP_010521265.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Tarenaya hassleriana]
 ref|XP_010521266.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Tarenaya hassleriana]
Length=418

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 1/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            K+Y  GPAEL + GKS  VK + +VFDSGSSY+Y N + Y+A L  + K+L GKPL E  
Sbjct  252  KNYMVGPAELLYNGKSISVKGLNLVFDSGSSYTYFNKKAYQAILDLINKDLDGKPLTETK  311

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +L  CWKG +P +S+ DV KYFK+  L F  G  ++  F+I P SYLII+  G+VCL
Sbjct  312  EDKSLSVCWKGVKPVKSVLDVAKYFKTLTLQFGTGKNAQP-FQIPPVSYLIITKYGNVCL  370

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNGTE GLH YN+IGD   Q  MVIYDNEK+ +GW  ANCDR P
Sbjct  371  GILNGTEVGLHGYNIIGDNFFQGMMVIYDNEKHRVGWVPANCDRLP  416



>gb|ABA96612.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
Length=451

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 126/170 (74%), Gaps = 4/170 (2%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG A L FGG+  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E  D
Sbjct  254  YYSPGSANLYFGGRPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEVPD  312

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
              +LP CWKG++PF+S+ DVKK F++  LSF+NG   + L EI PE+YLI++  G+ CLG
Sbjct  313  H-SLPLCWKGKKPFKSVLDVKKEFRTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLG  369

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVV  103
            +LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P  N +
Sbjct  370  ILNGSEVGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIPNDNTI  419



>ref|XP_002520345.1| nucellin, putative [Ricinus communis]
 gb|EEF42131.1| nucellin, putative [Ricinus communis]
Length=424

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPL  448
            +   K+Y+ GPAEL +GGK TG K    +FDSGSSY+Y N+Q Y++ L  + KEL GKPL
Sbjct  255  KSLDKYYASGPAELLYGGKPTGTKAEEFIFDSGSSYTYFNAQVYQSTLNLIRKELSGKPL  314

Query  447  REAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKG  268
            R+A ++  L  CWKG + F+S+++VK YFK FALSF          +I PE YLI+++ G
Sbjct  315  RDAPEEKALAICWKGTKRFKSVNEVKSYFKPFALSFTKA--KSVQLQIPPEDYLIVTNDG  372

Query  267  SVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +VCLG+LNG+E GL N+NVIGD   QD++VIYD++K+ IGW  ANCDR P
Sbjct  373  NVCLGILNGSEVGLGNFNVIGDNLFQDKLVIYDSDKHQIGWIPANCDRLP  422



>ref|NP_175079.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50556.1|AC074228_11 nucellin, putative [Arabidopsis thaliana]
 gb|AEE32023.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=405

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HY+ GPA+L F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL+ A +
Sbjct  240  HYTTGPADLLFNGKPTGLKGLKLIFDTGSSYTYFNSKAYQTIINLIGNDLKVSPLKVAKE  299

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TLP CWKG +PF+S+ +VK +FK+  ++F NG R+  L+ ++PE YLI+S  G+VCLG
Sbjct  300  DKTLPICWKGAKPFKSVLEVKNFFKTITINFTNGRRNTQLY-LAPELYLIVSKTGNVCLG  358

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL N NVIGD+SMQ  M+IYDNEK  +GW  ++C++ P
Sbjct  359  LLNGSEVGLQNSNVIGDISMQGLMMIYDNEKQQLGWVSSDCNKLP  403



>ref|XP_010521264.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Tarenaya hassleriana]
Length=453

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 1/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            K+Y  GPAEL + GKS  VK + +VFDSGSSY+Y N + Y+A L  + K+L GKPL E  
Sbjct  252  KNYMVGPAELLYNGKSISVKGLNLVFDSGSSYTYFNKKAYQAILDLINKDLDGKPLTETK  311

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +L  CWKG +P +S+ DV KYFK+  L F  G  ++  F+I P SYLII+  G+VCL
Sbjct  312  EDKSLSVCWKGVKPVKSVLDVAKYFKTLTLQFGTGKNAQP-FQIPPVSYLIITKYGNVCL  370

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNGTE GLH YN+IGD   Q  MVIYDNEK+ +GW  ANCDR P
Sbjct  371  GILNGTEVGLHGYNIIGDNFFQGMMVIYDNEKHRVGWVPANCDRLP  416



>ref|XP_006365534.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=441

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 119/166 (72%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL F G++TGVK + +VFDSGS+++Y +S+ Y+ FL S+ K +  K L +A 
Sbjct  242  KHYSLGPAELLFDGQATGVKGLPIVFDSGSTFTYFSSKAYDIFLSSIKKNINAKQLTDAT  301

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +LP CW G +PF+S +D   YFK F LSF         F++ PE+YLI++  G+VCL
Sbjct  302  NDKSLPVCWSGSKPFKSANDATIYFKPFTLSFMKA--KNVEFQLLPEAYLILTEHGNVCL  359

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNGTE GL N+N+IGD+S+ D+MV+YDNEK  IGW  ANC + P
Sbjct  360  GILNGTEVGLGNHNLIGDISLLDKMVVYDNEKKQIGWLPANCKKLP  405



>ref|NP_001066301.1| Os12g0177500 [Oryza sativa Japonica Group]
 gb|ABA96613.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29320.1| Os12g0177500 [Oryza sativa Japonica Group]
 dbj|BAG89196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 124/165 (75%), Gaps = 4/165 (2%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG A L FGG+  GV+ M VVFDSGSS++Y ++QPY+A + ++  +L  K L+E  D
Sbjct  254  YYSPGSANLYFGGRPLGVRPMEVVFDSGSSFTYFSAQPYQALVDAIKGDLS-KNLKEVPD  312

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
              +LP CWKG++PF+S+ DVKK F++  LSF+NG   + L EI PE+YLI++  G+ CLG
Sbjct  313  H-SLPLCWKGKKPFKSVLDVKKEFRTVVLSFSNG--KKALMEIPPENYLIVTKYGNACLG  369

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + N++GD++MQD+MVIYDNE+  IGW RA CDR P
Sbjct  370  ILNGSEVGLKDLNIVGDITMQDQMVIYDNERGQIGWIRAPCDRIP  414



>ref|XP_006303534.1| hypothetical protein CARUB_v10010968mg [Capsella rubella]
 gb|EOA36432.1| hypothetical protein CARUB_v10010968mg [Capsella rubella]
Length=406

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 117/165 (71%), Gaps = 1/165 (1%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            HY+ GPAEL F  K TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +++  PL+ A D
Sbjct  241  HYTTGPAELLFNAKPTGLKGLKLIFDTGSSYTYFNSKTYQTVVKLIENDVKSTPLKVAKD  300

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D TLP CWKG +PF+S+ +VK  FK+  ++F NG R  T  +I PESYLI+S  G VCLG
Sbjct  301  DKTLPICWKGPKPFKSVLEVKNLFKTLTINFTNG-RKNTQLQIPPESYLIVSKTGHVCLG  359

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + NVIGD+SMQ  M+IYDNEK  +GW  ++C + P
Sbjct  360  LLNGSEVGLQDSNVIGDISMQGLMMIYDNEKQQLGWVASDCKKLP  404



>ref|XP_002306645.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
 gb|EEE93641.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
Length=424

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAEL FGGK TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L GKPL++A + 
Sbjct  262  YSSGPAELLFGGKPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLAGKPLKDAPEK  321

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
              L  CWK  +P +SI D+K YFK   +SF N    +   +++PE YLII+  G+VCLG+
Sbjct  322  -ELAVCWKTAKPIKSILDIKSYFKPLTISFMNAKNVQ--LQLAPEDYLIITKDGNVCLGI  378

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG+E  L N+NVIGD+ MQDR+VIYDNEK  IGW  ANCDR P
Sbjct  379  LNGSEQQLGNFNVIGDIFMQDRVVIYDNEKQQIGWFPANCDRLP  422



>ref|XP_007137426.1| hypothetical protein PHAVU_009G126200g [Phaseolus vulgaris]
 gb|ESW09420.1| hypothetical protein PHAVU_009G126200g [Phaseolus vulgaris]
Length=416

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            +HY  GPA+L F GK T VK + +VFDSGSSY+Y NS+ + A +  +  +++GK L  A 
Sbjct  251  QHYKTGPADLLFDGKPTSVKGLELVFDSGSSYTYFNSRAHRALVDLITNDIKGKSLTRAT  310

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
             DP+LP CWKG +PF+S+ DV + FK   LSF     S+   ++ PE+YLI++  G+VCL
Sbjct  311  ADPSLPICWKGPKPFKSLHDVTRNFKPLVLSFTKSKNSQ--LQVPPEAYLIVTKHGNVCL  368

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  121
            G+L+GTE G+ N N+IGD+S+QD++VIYDNEK  IGW  A CD P
Sbjct  369  GILDGTEVGMGNINIIGDISLQDKIVIYDNEKQQIGWASAKCDGP  413



>gb|KJB29189.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=407

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL FGGK TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +  
Sbjct  242  KHYSSGPAELLFGGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDVK  301

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            D   LP CWKG +PF+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCL
Sbjct  302  DK-ALPICWKGTKPFKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCL  358

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+LNG EAGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  359  GILNGAEAGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  402



>ref|XP_004240544.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=418

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPA+L FGG++TG+K++ ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A 
Sbjct  252  KHYSLGPADLLFGGQATGMKSLPIILDSGSTFTYFNSEAYKTLLSSIKKNIDAKQLTDAV  311

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +LP CWKG +PF+S+ D  +YFK   LSF          +++PE+YLI ++KG+VCL
Sbjct  312  NDKSLPVCWKGSKPFKSLKDATRYFKPLTLSFTKA--KNIQLQLTPEAYLIHTNKGNVCL  369

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  115
            G+LNG+E GL   N+IGD+SM D+MVIYDNEK  IGW  ANC++ P+
Sbjct  370  GILNGSEVGLGAVNIIGDISMLDKMVIYDNEKQQIGWVPANCNKLPS  416



>ref|XP_004240543.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=426

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPA+L FGG++TG+K++ ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A 
Sbjct  252  KHYSLGPADLLFGGQATGMKSLPIILDSGSTFTYFNSEAYKTLLSSIKKNIDAKQLTDAV  311

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +LP CWKG +PF+S+ D  +YFK   LSF          +++PE+YLI ++KG+VCL
Sbjct  312  NDKSLPVCWKGSKPFKSLKDATRYFKPLTLSFTKA--KNIQLQLTPEAYLIHTNKGNVCL  369

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  115
            G+LNG+E GL   N+IGD+SM D+MVIYDNEK  IGW  ANC++ P+
Sbjct  370  GILNGSEVGLGAVNIIGDISMLDKMVIYDNEKQQIGWVPANCNKLPS  416



>gb|KJB29190.1| hypothetical protein B456_005G089000 [Gossypium raimondii]
Length=428

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL FGGK TG+K + V+FD+GS+Y+Y+N + YE  L  + K+L GK L +  
Sbjct  263  KHYSSGPAELLFGGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKDLSGKQLHDVK  322

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            D   LP CWKG +PF+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCL
Sbjct  323  DK-ALPICWKGTKPFKSMRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCL  379

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+LNG EAGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  380  GILNGAEAGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  423



>ref|XP_009596730.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana tomentosiformis]
Length=455

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 117/166 (70%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL F G++TGVK   ++FDSGS++SY+NS+ Y+  + S+ K +  K L +A 
Sbjct  255  KHYSLGPAELFFDGQATGVKGFPLIFDSGSTFSYLNSEAYDILVSSIKKNINAKQLTDAV  314

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD +LP CW G + F++++D   YFK   LSF          ++ PE+YLI++  G+VCL
Sbjct  315  DDTSLPVCWNGSKSFKTVNDATSYFKPLTLSFMKA--KNVELQLQPEAYLILTEHGNVCL  372

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNGTE GL NYNVIGD+S+ D+MVIYDNEK  +GW  ANC+R P
Sbjct  373  GILNGTEVGLGNYNVIGDISLLDKMVIYDNEKQRVGWLPANCNRLP  418



>ref|XP_006355805.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006355806.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Solanum 
tuberosum]
Length=363

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPA+L FGG++TG+K + ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A 
Sbjct  197  KHYSLGPADLLFGGQATGIKGLPIILDSGSTFTYFNSKAYKTLLSSIKKNIDAKQLTDAV  256

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +LP CWKG +PF+S+ D   YFK   LSF      +   +++PE+YLI + KG+VCL
Sbjct  257  NDKSLPVCWKGSKPFKSLKDATMYFKPLTLSFTKAKNIQ--LQLTPEAYLIYTDKGNVCL  314

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNG+  GL + N+IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  315  GILNGSVVGLGDVNIIGDISMLDKMVIYDNEKQQIGWVPANCNKLP  360



>ref|XP_009802241.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802242.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802243.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802244.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=417

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPA+L F G++TG+K + ++FDSGS+YSY NS+ Y+  + S+ K++  K L +A 
Sbjct  254  KHYSLGPADLLFSGQATGIKGIPIIFDSGSTYSYFNSEAYKILVSSIKKDVNTKQLTDAV  313

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD +LP CWKG + F+SI D K +FK   LSF          ++ PE+YL+ +  G++CL
Sbjct  314  DDKSLPVCWKGSKSFKSIHDAKSFFKPLTLSFTKA--KNVQLQLPPEAYLVRTEHGNICL  371

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+L+GT+ G+ NYN+IGDVSM D+MVIYDNEK  IGW  ANC++ P
Sbjct  372  GILDGTDVGIGNYNIIGDVSMVDKMVIYDNEKQQIGWVPANCNKLP  417



>ref|XP_009758779.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana sylvestris]
Length=455

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KH+S GPAEL F G++TGVK   V+FDSGS++SY +S+ Y+  + S+ K +  K L +A 
Sbjct  255  KHFSLGPAELFFDGQATGVKGFPVIFDSGSTFSYFSSEAYDILVSSIKKNINAKQLTDAV  314

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD +LP CW G + F+S++D   YFK   LSF          ++ PE+YLI++  G+VCL
Sbjct  315  DDKSLPVCWNGSKSFKSVNDATSYFKPLTLSFMKA--KNVELQLQPEAYLILTEHGNVCL  372

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNGTE GL NYNVIGD+S+ D+MVIYDNEK  +GW  ANC+R P
Sbjct  373  GILNGTEVGLGNYNVIGDISLLDKMVIYDNEKQQVGWLPANCNRLP  418



>gb|KHG10363.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10554.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10792.1| Asparticase Asp1 [Gossypium arboreum]
Length=426

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL F GK TG+K + V+FD+GS+Y+Y+N + YE  L  + K L GK L +  
Sbjct  263  KHYSSGPAELLFSGKPTGIKGVNVIFDTGSTYTYLNLKVYETVLNLIRKNLSGKQLHDV-  321

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
             D  LP CWKG +PF+S+ D + YF +FALSF     S    ++ PE+YLI++ +G+VCL
Sbjct  322  KDKALPICWKGTKPFKSVRDARNYFSTFALSFTG--SSNVQLQLPPENYLIVTEQGNVCL  379

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+LNG EAGL   NVIGD+S+Q ++VIYDNE   IGW  A+C+R
Sbjct  380  GILNGAEAGLGTTNVIGDISLQGKLVIYDNENQMIGWANADCNR  423



>gb|KDO52229.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=380

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+
Sbjct  236  DYTKYYSPGVAELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLK  295

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKGRRPF+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+
Sbjct  296  EAPEDETLPLCWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGN  354

Query  264  VCLGVLNGTEAGLHNYNVIGDV  199
            VCLG+LNG E GL + NVIG +
Sbjct  355  VCLGILNGAEVGLQDLNVIGGI  376



>ref|XP_006355804.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Solanum 
tuberosum]
Length=418

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 117/166 (70%), Gaps = 2/166 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPA+L FGG++TG+K + ++ DSGS+++Y NS+ Y+  L S+ K +  K L +A 
Sbjct  252  KHYSLGPADLLFGGQATGIKGLPIILDSGSTFTYFNSKAYKTLLSSIKKNIDAKQLTDAV  311

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +LP CWKG +PF+S+ D   YFK   LSF          +++PE+YLI + KG+VCL
Sbjct  312  NDKSLPVCWKGSKPFKSLKDATMYFKPLTLSFTKA--KNIQLQLTPEAYLIYTDKGNVCL  369

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            G+LNG+  GL + N+IGD+SM D+MVIYDNEK  IGW  ANC++ P
Sbjct  370  GILNGSVVGLGDVNIIGDISMLDKMVIYDNEKQQIGWVPANCNKLP  415



>ref|XP_004142630.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004161165.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN54552.1| hypothetical protein Csa_4G361860 [Cucumis sativus]
Length=413

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 119/174 (68%), Gaps = 2/174 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP  R+    YS GPAE+ F G++ G+  + + FDSGSSY+Y NSQ Y A    +  +L+
Sbjct  236  TPILRNSEGKYSSGPAEVYFNGRAVGIGGLTLTFDSGSSYTYFNSQVYRAIEKLLKNDLK  295

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            G PL+ A DD TL  CWKG +PF S+ DV+ +FK  A+SF N       F+I PE+YLII
Sbjct  296  GNPLKLASDDKTLELCWKGPKPFESVVDVRNFFKPLAMSFKN--SKNVQFQIPPEAYLII  353

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            S  G+VCLG+L+G++ G+ N N+IGD+SM +++V+YDNE+  IGW  +NC+R P
Sbjct  354  SEFGNVCLGILDGSKEGMGNVNIIGDISMLNKIVVYDNERERIGWASSNCNRSP  407



>gb|KDO52225.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=397

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            DYTK+YSPG AEL FGG++TG+KN+ VVFDSGSSY+Y+N   Y+     + KEL  K L+
Sbjct  253  DYTKYYSPGVAELFFGGETTGLKNLPVVFDSGSSYTYLNRVTYQTLTSIMKKELSAKSLK  312

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
            EA +D TLP CWKGRRPF+++ DVKK F++ ALSF +G ++RTLFE++PE+YLIIS+KG+
Sbjct  313  EAPEDETLPLCWKGRRPFKNVHDVKKCFRTLALSFTDG-KTRTLFELTPEAYLIISNKGN  371

Query  264  VCLGVLNGTEAGLHNYNVIGDV  199
            VCLG+LNG E GL + NVIG +
Sbjct  372  VCLGILNGAEVGLQDLNVIGGI  393



>gb|AES87275.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=424

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 117/167 (70%), Gaps = 4/167 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GP +L F GK T  K + ++FDSGSSY+Y + + Y      V  +L+GKPLR   
Sbjct  260  KHYSTGPVDLFFNGKPTPAKGLQIIFDSGSSYTYFSPRVYTIVANMVNNDLKGKPLRRET  319

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVC  259
             DP+LP CWKG +PF+S+++V  YFK   LSF    +S+ L F++ P +YLII+  G+VC
Sbjct  320  KDPSLPICWKGVKPFKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVAYLIITKFGNVC  376

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNG EAGL N NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  377  LGILNGNEAGLGNRNVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  423



>ref|NP_001152116.1| aspartic proteinase Asp1 precursor [Zea mays]
 gb|ACG45850.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=432

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 124/175 (71%), Gaps = 5/175 (3%)
 Frame = -1

Query  639  TPCPRD-YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R  +  +YSPG A L FG +S GV+   VVFDSGSS++Y  ++PY+A L + +K+ 
Sbjct  251  TPMARSAFRNYYSPGSASLYFGDRSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDG  309

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
              + L E   D +LP CWKG+ PF+S+ DV+K FKS  L+FA+G   +TL EI PE+YLI
Sbjct  310  LSRTLEEE-PDTSLPLCWKGQEPFKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLI  366

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ++  G+ CLG+LNG+E GL + ++IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  367  VTENGNACLGILNGSEIGLKDLSIIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  421



>ref|NP_001131929.1| uncharacterized protein LOC100193320 precursor [Zea mays]
 gb|ACF80557.1| unknown [Zea mays]
Length=424

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 124/175 (71%), Gaps = 5/175 (3%)
 Frame = -1

Query  639  TPCPRD-YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R  +  +YSPG A L FG +S GV+   VVFDSGSS++Y  ++PY+A L + +K+ 
Sbjct  243  TPMARSAFRNYYSPGSASLYFGDRSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDG  301

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
              + L E   D +LP CWKG+ PF+S+ DV+K FKS  L+FA+G   +TL EI PE+YLI
Sbjct  302  LSRTLEEE-PDTSLPLCWKGQEPFKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLI  358

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ++  G+ CLG+LNG+E GL + ++IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  359  VTENGNACLGILNGSEIGLKDLSIIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  413



>gb|ACR34528.1| unknown [Zea mays]
 gb|AFW56222.1| aspartic proteinase Asp1 [Zea mays]
Length=433

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 124/175 (71%), Gaps = 5/175 (3%)
 Frame = -1

Query  639  TPCPRD-YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R  +  +YSPG A L FG +S GV+   VVFDSGSS++Y  ++PY+A L + +K+ 
Sbjct  252  TPMARSAFRNYYSPGSASLYFGDRSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDG  310

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
              + L E   D +LP CWKG+ PF+S+ DV+K FKS  L+FA+G   +TL EI PE+YLI
Sbjct  311  LSRTLEEE-PDTSLPLCWKGQEPFKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLI  367

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ++  G+ CLG+LNG+E GL + ++IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  368  VTENGNACLGILNGSEIGLKDLSIIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  422



>ref|XP_011027496.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Populus 
euphratica]
 ref|XP_011014192.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Populus 
euphratica]
Length=425

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAEL FGGK TG+K + ++FDSGSSY+Y ++Q Y++ L  V K+L GKPLR+A ++
Sbjct  262  YSSGPAELLFGGKPTGIKGLQLIFDSGSSYTYFSAQVYQSILNLVRKDLSGKPLRDAPEE  321

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
              L  CWK  +P +SI D+K +FK   ++F      +   +++PE YLII+  G+VCLG+
Sbjct  322  KALAVCWKTAKPIKSILDIKSFFKPLTINFIKAKNVQ--LQLAPEDYLIITKDGNVCLGI  379

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG E GL N NVIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  380  LNGGEQGLGNLNVIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  423



>ref|XP_002441914.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
 gb|EES15752.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
Length=429

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 121/165 (73%), Gaps = 4/165 (2%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG A L FG +S  VK   VVFDSGSS++Y  +QPY+A + ++  +L  + L+E   
Sbjct  261  YYSPGSASLYFGDQSLRVKLTEVVFDSGSSFTYFAAQPYQALVTALKGDLS-RTLKEV-S  318

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            DP+LP CWKG++PF+S+ DVKK FKS  L+F NG  ++   EI P++YLI++  G+ CLG
Sbjct  319  DPSLPLCWKGKKPFKSVLDVKKEFKSLVLNFGNG--NKAFMEIPPQNYLIVTKYGNACLG  376

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNG+E GL + +++GD++MQD+MVIYDNEK  IGW RA CDR P
Sbjct  377  ILNGSEVGLKDLSILGDITMQDQMVIYDNEKGQIGWIRAPCDRIP  421



>ref|XP_002302227.1| nucellin family protein [Populus trichocarpa]
 gb|EEE81500.1| nucellin family protein [Populus trichocarpa]
Length=422

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAEL FGGK TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L G PL++A ++
Sbjct  259  YSSGPAELLFGGKPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLSGMPLKDAPEE  318

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
              L  CWK  +P +SI D+K +FK   ++F      +   +++PE YLII+  G+VCLG+
Sbjct  319  KALAVCWKTAKPIKSILDIKSFFKPLTINFIKAKNVQ--LQLAPEDYLIITKDGNVCLGI  376

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG E GL N NVIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  377  LNGGEQGLGNLNVIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  420



>gb|EMT17342.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=148

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 110/145 (76%), Gaps = 4/145 (3%)
 Frame = -1

Query  552  MIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDV  373
            M VV DSGSS++Y ++QPY+A + ++  +L  K L+E  D P+LP CWKG++PF+S+ DV
Sbjct  1    MEVVLDSGSSFTYFSAQPYQALVTALKGDL-SKTLKEVSD-PSLPLCWKGKKPFKSVLDV  58

Query  372  KKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSM  193
            KK FKS  L+FANG   + L EI PE+YLI++  G+ CLG+LNG+E GL + N++GD++M
Sbjct  59   KKEFKSLVLNFANG--KKALMEIPPENYLIVTKYGNACLGILNGSEIGLKDLNIVGDITM  116

Query  192  QDRMVIYDNEKNAIGWTRANCDRPP  118
            QD+MVIYDNE+  IGW RA CDR P
Sbjct  117  QDQMVIYDNERGQIGWIRAPCDRIP  141



>ref|XP_011027495.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Populus 
euphratica]
 ref|XP_011014191.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Populus 
euphratica]
Length=463

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAEL FGGK TG+K + ++FDSGSSY+Y ++Q Y++ L  V K+L GKPLR+A ++
Sbjct  262  YSSGPAELLFGGKPTGIKGLQLIFDSGSSYTYFSAQVYQSILNLVRKDLSGKPLRDAPEE  321

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
              L  CWK  +P +SI D+K +FK   ++F          +++PE YLII+  G+VCLG+
Sbjct  322  KALAVCWKTAKPIKSILDIKSFFKPLTINFIKA--KNVQLQLAPEDYLIITKDGNVCLGI  379

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG E GL N NVIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  380  LNGGEQGLGNLNVIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  423



>ref|XP_006355850.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=400

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            K YS GPA++ FGG++TG+K + ++ DSG++++Y NS+ Y+  L  + K +  K L +A 
Sbjct  204  KEYSLGPADVLFGGQATGIKGIPIILDSGTTFTYFNSEAYKTLLSLIKKNIDTKQLTDAV  263

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD +LP CWKG +PF+S+ D   YFK   LSF      +   ++ PE+YLI++ KG VCL
Sbjct  264  DDKSLPVCWKGSKPFKSLKDATMYFKPLTLSFTKAKNIQ--LQLLPEAYLILTDKGHVCL  321

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  115
            G+LNG+EAG+ + N+IGD+SM D++VIYDNEK  IGW  ANC++ P+
Sbjct  322  GILNGSEAGIGDVNLIGDISMLDKLVIYDNEKQQIGWAPANCNKLPS  368



>ref|XP_008661408.1| PREDICTED: uncharacterized protein LOC100193320 isoform X1 [Zea 
mays]
Length=471

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 124/175 (71%), Gaps = 5/175 (3%)
 Frame = -1

Query  639  TPCPRD-YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            TP  R  +  +YSPG A L FG +S GV+   VVFDSGSS++Y  ++PY+A L + +K+ 
Sbjct  252  TPMARSAFRNYYSPGSASLYFGDRSLGVRLAKVVFDSGSSFTYFAAKPYQA-LVTALKDG  310

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
              + L E   D +LP CWKG+ PF+S+ DV+K FKS  L+FA+G   +TL EI PE+YLI
Sbjct  311  LSRTLEEE-PDTSLPLCWKGQEPFKSVLDVRKEFKSLVLNFASG--KKTLMEIPPENYLI  367

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            ++  G+ CLG+LNG+E GL + ++IGD++MQD MVIYDNEK  IGW RA CDR P
Sbjct  368  VTENGNACLGILNGSEIGLKDLSIIGDITMQDHMVIYDNEKGKIGWIRAPCDRAP  422



>gb|KJB29183.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
 gb|KJB29185.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=294

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 112/167 (67%), Gaps = 3/167 (2%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +KHY   PAE+ F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL + 
Sbjct  87   SKHYLSSPAEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DT  145

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
              D  LP CWKG +PF+S+ DVK YF +  L F +    +   E+ PE+YLI++  G+ C
Sbjct  146  VQDKALPICWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNAC  203

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
             G+LNGTEAGL + NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  204  FGILNGTEAGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  250



>ref|XP_010025733.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62452.1| hypothetical protein EUGRSUZ_H05087 [Eucalyptus grandis]
Length=434

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 116/168 (69%), Gaps = 2/168 (1%)
 Frame = -1

Query  618  TKHYSP-GPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +K YSP G AEL F GK TG KN+ ++FDSGS+Y+Y +S+ YEA    V  EL GKP  E
Sbjct  261  SKRYSPVGTAELFFAGKPTGQKNLKLLFDSGSTYTYFSSKAYEALSSRVKNELIGKPFTE  320

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               DP LP CWK R+ F+ I DV KYFK FAL+F  G  + + FE+ PESYLI S  G+V
Sbjct  321  I-RDPDLPLCWKCRKSFKDIRDVTKYFKPFALTFNRGESTESQFEVPPESYLIRSVMGNV  379

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            C+GVLNGT+AGL + N+IGD SM D+MVIYDN  + +GW   +C + P
Sbjct  380  CMGVLNGTQAGLKDRNLIGDTSMLDKMVIYDNANHFLGWASEDCSQLP  427



>ref|XP_006386369.1| hypothetical protein POPTR_0002s08190g [Populus trichocarpa]
 gb|ERP64166.1| hypothetical protein POPTR_0002s08190g [Populus trichocarpa]
Length=460

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAEL FGGK TG+K + ++FDSGSSY+Y N+Q Y++ L  V K+L G PL++A ++
Sbjct  259  YSSGPAELLFGGKPTGIKGLQLIFDSGSSYTYFNAQVYQSILNLVRKDLSGMPLKDAPEE  318

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
              L  CWK  +P +SI D+K +FK   ++F      +   +++PE YLII+  G+VCLG+
Sbjct  319  KALAVCWKTAKPIKSILDIKSFFKPLTINFIKAKNVQ--LQLAPEDYLIITKDGNVCLGI  376

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG E GL N NVIGD+ MQDR+V+YDNE+  IGW   NC+R P
Sbjct  377  LNGGEQGLGNLNVIGDIFMQDRVVVYDNERQQIGWFPTNCNRLP  420



>gb|KJB29184.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=305

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 111/167 (66%), Gaps = 3/167 (2%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +KHY   PAE+ F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL + 
Sbjct  98   SKHYLSSPAEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DT  156

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
              D  LP CWKG +PF+S+ DVK YF +  L F +        E+ PE+YLI++  G+ C
Sbjct  157  VQDKALPICWKGTKPFKSVHDVKNYFSTLTLKFKD--TQNIQLELQPEAYLIVTEDGNAC  214

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
             G+LNGTEAGL + NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  215  FGILNGTEAGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  261



>ref|XP_004502513.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 117/168 (70%), Gaps = 3/168 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            +HY+ GPA++ F G  T VKN+ ++FDSGSSY+Y N + Y A +  V  +++GK L +A 
Sbjct  253  QHYNTGPADILFNGMPTSVKNIQLIFDSGSSYTYFNPEVYNAVVTLVNNDVKGK-LSDAF  311

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DDP+LP CWKG  PF+S+SDV+ YFK   LSF+N   S   F + P +YLII+  G+VCL
Sbjct  312  DDPSLPLCWKGAEPFKSLSDVETYFKPLDLSFSNSMDSP--FHLPPSAYLIITEHGNVCL  369

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  112
            G+L G++  L + NVIGD+S+QD++VIYDNE   IGW   +C+  P P
Sbjct  370  GILEGSQVDLGDLNVIGDISLQDKVVIYDNENKQIGWASTDCNTHPHP  417



>gb|EPS72688.1| hypothetical protein M569_02067 [Genlisea aurea]
Length=404

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 117/167 (70%), Gaps = 2/167 (1%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            + HYS GPA++  GGK+T ++ + +VFDSGS+Y+Y +S+ Y + +  +   +  K L++A
Sbjct  238  STHYSVGPADILLGGKATTIRGLPIVFDSGSTYTYFSSRAYGSLVSLMKANIDSKQLKDA  297

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D TLP CWKG +PF+S++DV   FK   LSF         F++ P+SYLI++  G+VC
Sbjct  298  PEDRTLPVCWKGGKPFKSVNDVATLFKPLTLSFTK--VKNVQFQLPPQSYLIVTEHGNVC  355

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNG E GL N N+IGD+S+ D++V+YDNEK+ IGW  ANCDR P
Sbjct  356  LGILNGGEVGLGNINLIGDISLVDKLVVYDNEKHRIGWAAANCDRLP  402



>ref|XP_004502512.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 119/169 (70%), Gaps = 5/169 (3%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            +HY+ GPA++ F G  T VKN+ ++FDSGSSY+Y NS+ Y A +  V  +++GK L +A 
Sbjct  253  QHYNTGPADILFNGMPTSVKNIQLIFDSGSSYTYFNSEAYNAVVALVKNDVKGK-LSDAS  311

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVC  259
            DDP+LP CWKG  PF+S+SDV  YFK   LSF+   +S  L F + P +YLII+  G+VC
Sbjct  312  DDPSLPICWKGAEPFKSLSDVDTYFKPLDLSFS---KSNDLYFHLPPSAYLIITEHGNVC  368

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAP  112
            LG+L+G++  L + NVIGD+ +QD++VIYDNE   +GW  A+C+  P P
Sbjct  369  LGILDGSQVDLGDLNVIGDIFLQDKVVIYDNENKRVGWASADCNTHPHP  417



>ref|XP_003605080.1| Aspartic proteinase Asp1 [Medicago truncatula]
 gb|AES87277.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=425

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 116/167 (69%), Gaps = 5/167 (3%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY+ GP +L F GK T  K + ++FDSGSSY+Y +S  Y      V  +L+GKPL    
Sbjct  261  KHYNTGPVDLFFNGKPTPAKGLQIIFDSGSSYTYFSSPVYTIVANMVNNDLKGKPLSRV-  319

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVC  259
             DP+LP CWKG +PF+S+++V  YFK   LSF    +S+ L F++ P +YLII+  G+VC
Sbjct  320  KDPSLPICWKGVKPFKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVAYLIITKYGNVC  376

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNG EAGL N NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  377  LGILNGNEAGLGNRNVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  423



>gb|KEH20924.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=410

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -1

Query  624  DYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR  445
            D  KHYS GPAEL FGG+ TGV ++ ++FD+GSSY+Y NSQ Y+A +  + KEL  KP++
Sbjct  260  DSGKHYSAGPAELVFGGRKTGVGSLNIIFDTGSSYTYFNSQAYQAMISLLNKELHRKPIK  319

Query  444  EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS  265
             A DD TLP CW G+RPFRSI++VKKYFK   LSF NG R +  FEI PE+YLIIS+ G+
Sbjct  320  AAPDDQTLPMCWHGKRPFRSINEVKKYFKPLTLSFTNGGRVKPQFEIPPEAYLIISNMGN  379

Query  264  VCLGVLNGTEAGLHNYNVIG  205
            VCLG+LNG E GL   N+IG
Sbjct  380  VCLGILNGPEVGLGELNLIG  399



>ref|XP_008444184.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=414

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 117/174 (67%), Gaps = 2/174 (1%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR  460
            TP   +    YS GPAE+ F G++ G+ ++ + FDSGSSY+Y NSQ Y A    +  +L+
Sbjct  237  TPMLCNSEGKYSSGPAEVYFNGRAVGIGSLTLTFDSGSSYTYFNSQVYRAIEKLLKNDLK  296

Query  459  GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII  280
            G+PL+ A DD TL  CWKG + F S+ DV+ +FK  A+SF N       F+I PE+YLII
Sbjct  297  GQPLKLASDDKTLELCWKGPKAFESVIDVRNFFKPLAMSFKNS--KNVQFQIPPEAYLII  354

Query  279  SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            S  G+ CLG+L+GT+ GL N N+IGD+SM +++V+YDNE+  IGW   NC+R P
Sbjct  355  SKFGNACLGILDGTKEGLGNINLIGDISMLNKIVVYDNERKQIGWASENCNRLP  408



>emb|CBI18999.3| unnamed protein product [Vitis vinifera]
Length=390

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 119/164 (73%), Gaps = 4/164 (2%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            Y+ GPA+L F G+++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E  D+
Sbjct  229  YALGPADLLFNGQNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETADE  287

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
             +LP CW+G +PF+SI +VK YFK FALSF     ++   ++ PESYLIIS  G+ CLG+
Sbjct  288  -SLPVCWRGAKPFKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGI  344

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG+E GL + NVIGD++ QD+MVIYDNE+  IGW   +C++ P
Sbjct  345  LNGSEVGLGDSNVIGDIAFQDKMVIYDNERQQIGWVPKDCNKLP  388



>ref|XP_010664194.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Vitis vinifera]
Length=423

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 119/164 (73%), Gaps = 4/164 (2%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            Y+ GPA+L F G+++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E  D+
Sbjct  262  YALGPADLLFNGQNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETADE  320

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
             +LP CW+G +PF+SI +VK YFK FALSF     ++   ++ PESYLIIS  G+ CLG+
Sbjct  321  -SLPVCWRGAKPFKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGI  377

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LNG+E GL + NVIGD++ QD+MVIYDNE+  IGW   +C++ P
Sbjct  378  LNGSEVGLGDSNVIGDIAFQDKMVIYDNERQQIGWVPKDCNKLP  421



>gb|KDO80581.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=254

 Score =   174 bits (442),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY  GPAEL + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A 
Sbjct  86   KHYILGPAELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAP  145

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD TLP CW+G  PF+++  V +YFK  ALSF N  R+     + PE+YL+IS + +VCL
Sbjct  146  DDKTLPICWRG--PFKALGQVTEYFKPLALSFTN-RRNSVRLVVPPEAYLVISGRKNVCL  202

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            G+LNG+EA +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  203  GILNGSEAEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  245



>ref|XP_002285867.2| PREDICTED: aspartic proteinase Asp1 isoform X1 [Vitis vinifera]
Length=453

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 125/177 (71%), Gaps = 7/177 (4%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            Y+ GPA+L F G+++GVK + +VFDSGSSY+Y N+Q Y+  L  V K L GK L+E  D+
Sbjct  262  YALGPADLLFNGQNSGVKGLRLVFDSGSSYTYFNAQAYKTTLSLVRKYLNGK-LKETADE  320

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
             +LP CW+G +PF+SI +VK YFK FALSF     ++   ++ PESYLIIS  G+ CLG+
Sbjct  321  -SLPVCWRGAKPFKSIFEVKNYFKPFALSFTKAKSAQ--LQLPPESYLIISKHGNACLGI  377

Query  249  LNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVFI*TNLGF  79
            LNG+E GL + NVIGD++ QD+MVIYDNE+  IGW   +C++ P  +  +   N+GF
Sbjct  378  LNGSEVGLGDSNVIGDIAFQDKMVIYDNERQQIGWVPKDCNKLPKVDRDY---NIGF  431



>gb|KJB29187.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=418

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 112/167 (67%), Gaps = 3/167 (2%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +KHY   PAE+ F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL + 
Sbjct  255  SKHYLSSPAEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DT  313

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
              D  LP CWKG +PF+S+ DVK YF +  L F +    +   E+ PE+YLI++  G+ C
Sbjct  314  VQDKALPICWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNAC  371

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
             G+LNGTEAGL + NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  372  FGILNGTEAGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>ref|XP_011074834.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=403

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 113/167 (68%), Gaps = 5/167 (3%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +K+YS G A+L  GG++  +K + +VFDSGS+YSY +SQ Y   +  +   L G  L++A
Sbjct  239  SKYYSLGSADLWLGGQAANIKGLQIVFDSGSTYSYFSSQAYNYLVSLMRDNLNGNQLKDA  298

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
             +D +LP CWKG  PF+SI D   YFK   LSF N       F++ PE+YLI++  G+VC
Sbjct  299  VEDRSLPICWKGAEPFKSIRDAVGYFKPLVLSFKN-----VEFQVQPEAYLIVTVHGNVC  353

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+L+G E GL N NVIGD+SMQD+MVIYDNE+  IGW  +NC+  P
Sbjct  354  LGILDGGEVGLGNLNVIGDISMQDKMVIYDNERQQIGWAPSNCNSHP  400



>gb|KJB29182.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=460

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 112/167 (67%), Gaps = 3/167 (2%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +KHY   PAE+ F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL + 
Sbjct  255  SKHYLSSPAEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DT  313

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
              D  LP CWKG +PF+S+ DVK YF +  L F +    +   E+ PE+YLI++  G+ C
Sbjct  314  VQDKALPICWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNAC  371

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
             G+LNGTEAGL + NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  372  FGILNGTEAGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>gb|KJB29181.1| hypothetical protein B456_005G088900 [Gossypium raimondii]
Length=462

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 112/167 (67%), Gaps = 3/167 (2%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +KHY   PAE+ F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V K L  KPL + 
Sbjct  255  SKHYLSSPAEVFFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLTLVRKGLTKKPL-DT  313

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC  259
              D  LP CWKG +PF+S+ DVK YF +  L F +    +   E+ PE+YLI++  G+ C
Sbjct  314  VQDKALPICWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTEDGNAC  371

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
             G+LNGTEAGL + NVIGD+S+  +MV+YDNEK  IGW  A+C+R P
Sbjct  372  FGILNGTEAGLGDLNVIGDISLIGKMVVYDNEKQRIGWISADCNRLP  418



>ref|XP_006472803.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=429

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY  GPAEL + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A 
Sbjct  261  KHYILGPAELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAP  320

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD TLP CW+G  PF+++  V +YFK  ALSF N  R+    ++ PE+YL+IS + +VCL
Sbjct  321  DDKTLPICWRG--PFKALGQVTEYFKPLALSFTN-RRNSVRLDVPPEAYLVISGRKNVCL  377

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            G+LNG+EA +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  378  GILNGSEAEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  420



>gb|AAM76716.1| nucellin-like aspartic protease [Zea mays]
Length=357

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 11/171 (6%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRG---  457
            R    +YSPG   L F  +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   
Sbjct  185  RTSGNYYSPGSGTLYFDRRSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLS  240

Query  456  KPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS  277
            K L++   DPTLP CWKG++ F+S+ DVK  FKS  LSFA+        EI PE+YLI++
Sbjct  241  KSLKQV-SDPTLPLCWKGQKAFKSVFDVKNEFKSMFLSFASA--KNAAMEIPPENYLIVT  297

Query  276  SKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
              G+VCLG+L+GT A L ++NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  298  KNGNVCLGILDGTAAKL-SFNVIGDITMQDQMVIYDNEKSQLGWARGACTR  347



>ref|XP_006472802.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=431

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY  GPAEL + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A 
Sbjct  263  KHYILGPAELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAP  322

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD TLP CW+G  PF+++  V +YFK  ALSF N  R+    ++ PE+YL+IS + +VCL
Sbjct  323  DDKTLPICWRG--PFKALGQVTEYFKPLALSFTNR-RNSVRLDVPPEAYLVISGRKNVCL  379

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            G+LNG+EA +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  380  GILNGSEAEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  422



>gb|AAY23266.1| Similar to nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 gb|ABA91763.1| Aspartic proteinase Asp1 precursor, putative [Oryza sativa Japonica 
Group]
Length=307

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 119/188 (63%), Gaps = 13/188 (7%)
 Frame = -1

Query  651  CHLDTPCPRDYTK-----HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAF  487
            C +    P  Y +     +YSPG A L F   S G+  M VVFDSGS+Y+Y  +QPY+A 
Sbjct  124  CPIAISTPSSYNEPMLMNYYSPGSATLYFDRHSLGMNPMDVVFDSGSTYTYFTAQPYQAT  183

Query  486  LYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFE  307
            +Y++   L    L +   DP+LP CWKG++ F S+ DVKK FKS  L+F N      + E
Sbjct  184  VYAIKGGLSSTSLEQV-SDPSLPLCWKGQKAFESVFDVKKEFKSLQLNFGN----NAVME  238

Query  306  ISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            I PE+YLI++  G+VCLG+L+G      N+N+IGD++MQD+MVIYDNE+  +GW R +C 
Sbjct  239  IPPENYLIVTEYGNVCLGILHGCRL---NFNIIGDITMQDQMVIYDNEREQLGWIRGSCG  295

Query  126  RPPAPNVV  103
            R P  +V+
Sbjct  296  RSPTKSVM  303



>gb|KDO80580.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=378

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY  GPAEL + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A 
Sbjct  210  KHYILGPAELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAP  269

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD TLP CW+G  PF+++  V +YFK  ALSF N  R+     + PE+YL+IS + +VCL
Sbjct  270  DDKTLPICWRG--PFKALGQVTEYFKPLALSFTNR-RNSVRLVVPPEAYLVISGRKNVCL  326

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            G+LNG+EA +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  327  GILNGSEAEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  369



>gb|KDO80579.1| hypothetical protein CISIN_1g014185mg [Citrus sinensis]
Length=429

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHY  GPAEL + GKS G+K++ ++FDSG+SY+Y  S+ Y+  +  ++++L G PL+ A 
Sbjct  261  KHYILGPAELLYSGKSCGLKDLTLIFDSGASYAYFTSRVYQEIVSLIMRDLIGTPLKLAP  320

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            DD TLP CW+G  PF+++  V +YFK  ALSF N  R+     + PE+YL+IS + +VCL
Sbjct  321  DDKTLPICWRG--PFKALGQVTEYFKPLALSFTN-RRNSVRLVVPPEAYLVISGRKNVCL  377

Query  255  GVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            G+LNG+EA +   N+IG++ MQD+MVIYDNEK  IGW   +C+
Sbjct  378  GILNGSEAEVGENNIIGEIFMQDKMVIYDNEKQRIGWKPEDCN  420



>ref|XP_007019121.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY16346.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=470

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 116/165 (70%), Gaps = 3/165 (2%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YS GPAEL FGG+ TG K + V+FD+G++Y+Y++S+ Y+  L  + K+L GK LR+   
Sbjct  308  YYSSGPAELLFGGEPTGAKGLYVIFDTGATYTYLSSEVYQTLLNLIRKDLAGKQLRDV-K  366

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D  LP CWKG +PF+S+ DV+ YF +  LSF     ++ +  + PE+Y+I++ +G+VCLG
Sbjct  367  DYALPICWKGAKPFKSVRDVRNYFNTLVLSFTGANNNKLV--LPPEAYIIVTERGNVCLG  424

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +LNGTE GL   NVIG +S+QD++VIYDNE   IGW  A+  R P
Sbjct  425  ILNGTEVGLGITNVIGAISLQDKLVIYDNENQRIGWASADGTRKP  469



>ref|XP_010680865.1| PREDICTED: aspartic proteinase Asp1-like [Beta vulgaris subsp. 
vulgaris]
Length=437

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 115/168 (68%), Gaps = 3/168 (2%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YS GPAEL F  ++     +  V D+GS+Y+Y +SQ YEA L  + K +  K L+   +
Sbjct  249  YYSIGPAELVFNERNVVKGGLSFVLDTGSTYTYFSSQVYEAALSMINKNIDSKQLKTVPE  308

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFA---NGWRSRTLFEISPESYLIISSKGSV  262
            D TLP CWKG +PF+S++DVKK FK  AL F+   +  R  T+ E+ PE+YLII+  G+V
Sbjct  309  DKTLPVCWKGSKPFKSMNDVKKLFKPLALRFSVKSSFLRKNTVMEMGPETYLIINKSGNV  368

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            CLG+L+G EAGL N N++GD+S+ ++++ YDN K+ IGW  ANCDR P
Sbjct  369  CLGILDGAEAGLENLNILGDISLLNKVITYDNVKDQIGWATANCDRLP  416



>ref|XP_008669793.1| PREDICTED: aspartic proteinase Asp1 [Zea mays]
 gb|ACL53484.1| unknown [Zea mays]
 gb|ACL54629.1| unknown [Zea mays]
 tpg|DAA38945.1| TPA: nucellin-like aspartic protease [Zea mays]
Length=415

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 11/171 (6%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRG---  457
            R    +YSPG   L F  +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   
Sbjct  243  RTSGNYYSPGSGTLYFDRRSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLS  298

Query  456  KPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS  277
            K L++   DPTLP CWKG++ F+S+ DVK  FKS  LSFA+        EI PE+YLI++
Sbjct  299  KSLKQV-SDPTLPLCWKGQKAFKSVFDVKNEFKSMFLSFASA--KNAAMEIPPENYLIVT  355

Query  276  SKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
              G+VCLG+L+GT A L ++NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  356  KNGNVCLGILDGTAAKL-SFNVIGDITMQDQMVIYDNEKSQLGWARGACTR  405



>ref|XP_003605078.1| Aspartic proteinase Asp1 [Medicago truncatula]
Length=418

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 112/167 (67%), Gaps = 10/167 (6%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GP +L F GK T  K + ++FDSGSSY+Y + + Y      V  +L+GKPLR   
Sbjct  260  KHYSTGPVDLFFNGKPTPAKGLQIIFDSGSSYTYFSPRVYTIVANMVNNDLKGKPLRRET  319

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTL-FEISPESYLIISSKGSVC  259
             DP+LP CWKG +PF+S+++V  YFK   LSF    +S+ L F++ P  +      G+VC
Sbjct  320  KDPSLPICWKGVKPFKSLNEVNNYFKPLTLSFT---KSKNLQFQLPPVKF------GNVC  370

Query  258  LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            LG+LNG EAGL N NV+GD+S+QD++V+YDNEK  IGW  ANC + P
Sbjct  371  LGILNGNEAGLGNRNVVGDISLQDKVVVYDNEKQQIGWASANCKQIP  417



>gb|ACG42043.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=415

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 11/171 (6%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRG---  457
            R    +YSPG   L F  +S GVK M VVFDSGS+Y+Y  +QPY+A    VV  L+G   
Sbjct  243  RTSGNYYSPGSGTLYFDRRSLGVKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLS  298

Query  456  KPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS  277
            K L++   DPTLP CWKG++ F+S+ DVK  FKS  LSF++        EI PE+YLI++
Sbjct  299  KSLKQV-SDPTLPLCWKGQKAFKSVFDVKNEFKSMFLSFSSA--KNAAMEIPPENYLIVT  355

Query  276  SKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
              G+VCLG+L+GT A L ++NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct  356  KNGNVCLGILDGTAAKL-SFNVIGDITMQDQMVIYDNEKSQLGWARGACTR  405



>ref|XP_008807681.1| PREDICTED: aspartic proteinase Asp1-like [Phoenix dactylifera]
Length=420

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 111/170 (65%), Gaps = 5/170 (3%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P   + HYSPGPA L +G +  G  N++V+ DSG++Y+Y   QPY  F+ ++   +  +P
Sbjct  245  PMTRSFHYSPGPASLFWGNQPLG-SNLMVLLDSGTTYTYFGLQPYNNFISTLNGHVSKQP  303

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK  271
            L  A DD  LP+CW+G RPF SI+D + YFK   L FA+G  S    +I P +YLIIS  
Sbjct  304  LTRAYDDHWLPYCWRGPRPFSSIADAQGYFKQLELRFADGAAS---MKIPPANYLIISEH  360

Query  270  GSVCLGVLNGTEAGLH-NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
             + CLG+LNGTE GL  N N+IGD+SM D +VIYDN+K  IGW  A+C R
Sbjct  361  HNACLGILNGTEEGLQSNINLIGDISMLDLLVIYDNDKQRIGWASADCSR  410



>gb|KHG06665.1| Asparticase Asp1 [Gossypium arboreum]
Length=383

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 106/171 (62%), Gaps = 44/171 (26%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPL  448
            +++TK+YSPG AEL FGGK+TG+KN+IV+FDSGSSY+Y+NSQ Y+A    + KEL G+ L
Sbjct  248  QEFTKYYSPGSAELHFGGKATGIKNLIVIFDSGSSYTYLNSQAYQALTLLLKKELSGRSL  307

Query  447  REAGDDPTLPFCWKGRRPFRSISDVKKYFK-SFALSFANGWRSRTLFEISPESYLIISSK  271
            +EA +D TLP CWKGR+PFRS+ D KKYFK S AL+FAN                     
Sbjct  308  KEAPEDQTLPLCWKGRKPFRSVHDAKKYFKTSLALAFAN---------------------  346

Query  270  GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
                                  ++SMQDRMV+YDNEK  IGW+ ANCD  P
Sbjct  347  ----------------------NISMQDRMVVYDNEKQVIGWSPANCDHLP  375



>gb|EEC67807.1| hypothetical protein OsI_35373 [Oryza sativa Indica Group]
Length=418

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 115/165 (70%), Gaps = 7/165 (4%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG A L F  +S   K M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   
Sbjct  253  YYSPGSATLYFDRRSLSTKPMEVVFDSGSTYTYFSAQPYQATI-SAIKGSLSKSLKQV-S  310

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            DP+LP CWKG++ F+S+SDVKK FKS    F        + EI PE+YLI++  G+VCLG
Sbjct  311  DPSLPLCWKGQKAFKSVSDVKKDFKSLQFIFGK----NAVMEIPPENYLIVTKNGNVCLG  366

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +L+G+ A L ++++IGD++MQD+MVIYDNEK  +GW R +C R P
Sbjct  367  ILDGSAAKL-SFSIIGDITMQDQMVIYDNEKAQLGWIRGSCSRSP  410



>gb|EMT12274.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=430

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 117/167 (70%), Gaps = 14/167 (8%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSV--------VKE  466
            Y  +YSPGP  L F  +S GVK M VVFDSGS+Y+Y  +QPY+A + +V        ++ 
Sbjct  269  YGNYYSPGPGTLYFDKRSLGVKPMEVVFDSGSTYTYFAAQPYQATVSAVYLNHTTFQLQA  328

Query  465  LRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYL  286
               K L++   DP+LP CWKG++ F+S+SDVKK F S  LSFA      T+ EI+PE+YL
Sbjct  329  GLSKSLKQVS-DPSLPLCWKGQKVFKSVSDVKKDFMSLFLSFAK----NTVMEIAPENYL  383

Query  285  IISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGW  145
            I++  G+VCLG+L+G+ A L N+N+IGD++MQD++V+YDNEK  IGW
Sbjct  384  IVTKNGNVCLGILDGSAAKL-NFNIIGDITMQDQLVVYDNEKGRIGW  429



>ref|NP_001065913.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|AAY23257.1| nucellin-like aspartic protease [Oryza sativa Japonica Group]
 gb|ABA91814.1| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27758.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|EEE51770.1| hypothetical protein OsJ_33210 [Oryza sativa Japonica Group]
Length=418

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 115/165 (70%), Gaps = 7/165 (4%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG A L F  +S   K M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   
Sbjct  253  YYSPGSATLYFDRRSLSTKPMEVVFDSGSTYTYFSAQPYQATI-SAIKGSLSKSLKQV-S  310

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            DP+LP CWKG++ F+S+SDVKK FKS    F        + +I PE+YLII+  G+VCLG
Sbjct  311  DPSLPLCWKGQKAFKSVSDVKKDFKSLQFIFGK----NAVMDIPPENYLIITKNGNVCLG  366

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +L+G+ A L ++++IGD++MQD+MVIYDNEK  +GW R +C R P
Sbjct  367  ILDGSAAKL-SFSIIGDITMQDQMVIYDNEKAQLGWIRGSCSRSP  410



>gb|EEE51772.1| hypothetical protein OsJ_33215 [Oryza sativa Japonica Group]
Length=775

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 111/165 (67%), Gaps = 8/165 (5%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            +  +YSPG A L F   S G+  M VVFDSGS+Y+Y  +QPY+A +Y++   L    L +
Sbjct  134  HANYYSPGSATLYFDRHSLGMNPMDVVFDSGSTYTYFTAQPYQATVYAIKGGLSSTSLEQ  193

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               DP+LP CWKG++ F S+ DVKK FKS  L+F N      + EI PE+YLI++  G+V
Sbjct  194  V-SDPSLPLCWKGQKAFESVFDVKKEFKSLQLNFGN----NAVMEIPPENYLIVTEYGNV  248

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            CLG+L+G      N+N+IGD++MQD+MVIYDNE+  +GW R +CD
Sbjct  249  CLGILHGCRL---NFNIIGDITMQDQMVIYDNEREQLGWIRGSCD  290


 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 114/182 (63%), Gaps = 11/182 (6%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKN--MIVVFDSGSSYSYMNSQPYEAFLYSVVKE  466
            TP  R++ K+YSPG   L F   S  +    M V+FDSG++Y+Y  +QPY+A L SVVK 
Sbjct  587  TPMNREH-KYYSPGHGTLHFDSNSKAISAAPMAVIFDSGATYTYFAAQPYQATL-SVVKS  644

Query  465  L---RGKPLREAGD-DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISP  298
                  K L E  + D  L  CWKG+    +I +VKK F+S +L FA+G +  TL EI P
Sbjct  645  TLNSECKFLTEVTEKDRALTVCWKGKDKIVTIDEVKKCFRSLSLEFADGDKKATL-EIPP  703

Query  297  ESYLIISSKGSVCLGVLNGTEA--GLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            E YLIIS +G VCLG+L+G++    L   N+IG ++M D+MVIYD+E++ +GW    CDR
Sbjct  704  EHYLIISQEGHVCLGILDGSKEHLSLAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCDR  763

Query  123  PP  118
             P
Sbjct  764  IP  765



>gb|EMS62785.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=412

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 114/166 (69%), Gaps = 7/166 (4%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            Y  +YSPG   L F  +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L+E
Sbjct  244  YGNYYSPGSGTLYFDRRSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLKE  302

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               D +LP CWKG++ F+S+S+VK  FKS  LSF       ++ EI PE+YLI++  G+V
Sbjct  303  V-SDVSLPLCWKGQKVFKSVSEVKNDFKSLFLSFGK----NSVMEIPPENYLIVTKYGNV  357

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            CLG+L+GT A    +N+IGD++MQD+M+IYDNEK  +GW R +C R
Sbjct  358  CLGILDGTAAK-QTFNIIGDITMQDQMIIYDNEKGQLGWIRGSCSR  402



>ref|XP_006662787.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=422

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 113/165 (68%), Gaps = 7/165 (4%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG A L F  +S G+  M VVFDSGS+Y+Y ++QPY+A + S +K    K L++   
Sbjct  257  YYSPGSATLYFDRRSLGITPMEVVFDSGSTYTYFSAQPYQAIV-SAIKGGLSKSLKQV-T  314

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            DP+LP CWKG++ F+S+ DVKK FKS  L            EI PE+YL+++  G+VCLG
Sbjct  315  DPSLPLCWKGQKAFKSVFDVKKDFKSLQLIIGK----NAAMEIPPENYLVVTKNGNVCLG  370

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            +L+G+ A L  +N+IGD++MQD+MVIYDNE+  +GW R +C R P
Sbjct  371  ILDGSAAKLK-FNIIGDITMQDQMVIYDNERAQLGWIRGSCSRSP  414



>ref|XP_003577760.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=413

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 114/163 (70%), Gaps = 7/163 (4%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG   L F  +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L++   
Sbjct  248  YYSPGSGTLYFDRRSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLQQV-S  305

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            DP+LP CWKG++ F+S+SDVK  FKS  LSF       ++ EI PE+YLI++  G+ CLG
Sbjct  306  DPSLPLCWKGQKVFKSVSDVKNDFKSLFLSFVK----NSVLEIPPENYLIVTKNGNACLG  361

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            +L+G+ A L  +N+IGD++MQD+++IYDNE+  +GW R +C R
Sbjct  362  ILDGSAAKL-TFNIIGDITMQDQLIIYDNERGQLGWIRGSCSR  403



>ref|XP_006856698.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
 gb|ERN18165.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
Length=406

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE--  442
            K+YSPG A + FG      +   V+FDSG+S++Y  S  Y+A +  + K+L    L+E  
Sbjct  194  KYYSPGCANILFGRDVLSDRYFDVIFDSGTSFTYFTSLAYQALISRLRKDLAKTSLKELP  253

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
             G   TLP CW+G + F+S+S++K YFK   ++F NG R+R  FEISPE +LII+S+G+V
Sbjct  254  IGPHSTLPLCWRGTKAFKSLSEIKGYFKPLVMNFKNGKRAR--FEISPEGFLIITSQGNV  311

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP  118
            CLG+LNG+E GL ++ +IGD+S+   +V+YDNE + IGW   NC+R P
Sbjct  312  CLGILNGSEVGLLDHILIGDISLHGYLVVYDNENHQIGWVPQNCNRLP  359



>gb|EMT29613.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=412

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 113/163 (69%), Gaps = 7/163 (4%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG   L F  +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L+E   
Sbjct  247  YYSPGSGTLYFDRRSLGVKPMEVVFDSGSTYTYFAAQPYQATV-SALKAGLSKSLKEV-S  304

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
            D +LP CWKG++ F+S+S+VK  FKS  L+F       ++ EI PE+YLI++  G+VCLG
Sbjct  305  DVSLPLCWKGQKVFKSVSEVKNDFKSLFLNFGK----NSVMEIPPENYLIVTKYGNVCLG  360

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            +L+GT A    +N+IGD++MQD+M+IYDNEK  +GW R +C R
Sbjct  361  ILDGTAAK-QTFNIIGDITMQDQMIIYDNEKGQLGWIRGSCSR  402



>ref|XP_004978884.1| PREDICTED: aspartic proteinase Asp1-like [Setaria italica]
Length=419

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 113/166 (68%), Gaps = 11/166 (7%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRG---KPLRE  442
            +YSPG   L F  +S G+K M VVFDSGS+Y+Y  +QPY+A    VV  L+G   K L++
Sbjct  252  YYSPGSGTLYFDKRSLGLKPMEVVFDSGSTYTYFTAQPYQA----VVSALKGGLSKSLKQ  307

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
               D  LP CWKG++ F+S+ DVKK FKS  LSFA G     + EI PE+YLI++  G+V
Sbjct  308  VPGD-ELPLCWKGQKAFKSVFDVKKEFKSLHLSFATG--KNAVMEIPPENYLIVTKIGNV  364

Query  261  CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            CLG+L+ T A L ++++IGD++M D+MVIYDNEK  +GW R  C R
Sbjct  365  CLGILDATVAKL-SFSIIGDITMLDQMVIYDNEKAQLGWVRGPCSR  409



>dbj|BAJ99780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 113/161 (70%), Gaps = 7/161 (4%)
 Frame = -1

Query  612  HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD  433
            +YSPG   L F  +S G+K M VVFDSGS+Y+Y  ++PY+A + S +K    K L+E  D
Sbjct  265  YYSPGSGTLYFDRRSLGMKPMEVVFDSGSTYAYFAAEPYQATV-SALKAGLSKSLKEVSD  323

Query  432  DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG  253
              +LP CWKG++ F+S+S+VK  FKS  LSF       ++ EI PE+YLI++  G+VCLG
Sbjct  324  V-SLPLCWKGQKVFKSVSEVKNDFKSLFLSFGK----NSVMEIPPENYLIVTKYGNVCLG  378

Query  252  VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC  130
            +L+GT A L  +N+IGD++MQD+M+IYDNEK  +GW R +C
Sbjct  379  ILDGTTAKLK-FNIIGDITMQDQMIIYDNEKGQLGWIRGSC  418



>ref|XP_010912572.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=411

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 111/170 (65%), Gaps = 4/170 (2%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P   + HYSPGPA L +  +  G + + V  DSG++++Y    PY + + ++   +  +P
Sbjct  244  PMIPSDHYSPGPASLFWDNQPLGSQLITVWLDSGTTFTYFGLHPYNSLISTLNGYVSTQP  303

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK  271
            L+ A DDP+LP+CW+G + FR+I+D ++YFK   L FANG       ++ P +YLIISSK
Sbjct  304  LKRAYDDPSLPYCWRGPQKFRTIADAQRYFKILELRFANG---AAPMKLPPVNYLIISSK  360

Query  270  GSVCLGVLNGTEAGLH-NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            G+ CLG+LNGT+ GL  + NVIGD+S+ D M+IYDN+K  IGW   N  R
Sbjct  361  GNACLGILNGTQVGLKPDENVIGDISLLDLMLIYDNDKKRIGWASTNFCR  410



>gb|KHG10362.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10553.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10791.1| Asparticase Asp1 [Gossypium arboreum]
Length=490

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 111/195 (57%), Gaps = 31/195 (16%)
 Frame = -1

Query  618  TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA  439
            +KHY   PAE+ F GK TG+K++ VVFDSGSSY+Y   Q YE  L  V + L  K L + 
Sbjct  255  SKHYLSSPAEVLFDGKPTGIKDLKVVFDSGSSYTYFGFQVYEGVLNLVRESLTEKTL-DT  313

Query  438  GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS------  277
              D  LP CWKG +PF+S+ DVK YF +  L F +    +   E+ PE+YLI++      
Sbjct  314  VQDKALPICWKGTKPFKSVHDVKNYFSTLTLKFKDTQNIQ--LELQPEAYLIVTVSRSLV  371

Query  276  ----------------------SKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNE  163
                                    G+ C G+LNGTEAGL + NVIGD+S+  +MV+YDNE
Sbjct  372  LQQNDINGHGYNNISNMLFRSQEDGNACFGILNGTEAGLGDLNVIGDISLIGKMVVYDNE  431

Query  162  KNAIGWTRANCDRPP  118
            +  IGW  A+C+R P
Sbjct  432  EQRIGWISADCNRLP  446



>ref|XP_007161478.1| hypothetical protein PHAVU_001G072500g [Phaseolus vulgaris]
 gb|ESW33472.1| hypothetical protein PHAVU_001G072500g [Phaseolus vulgaris]
Length=433

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -1

Query  615  KHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAG  436
            KHYS GPAEL F GK+T VK + ++FDSGSSY+Y NS  Y+A +  V  +L+GK L  A 
Sbjct  256  KHYSSGPAELLFNGKTTKVKGLELIFDSGSSYTYFNSLAYQAVVNLVTDDLKGKQLTRAT  315

Query  435  DDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCL  256
            +D +LP CWKG + F+S+SD+KKYFK  A SF          ++ PE+YLII+  G+VCL
Sbjct  316  EDSSLPICWKGPKSFKSLSDIKKYFKPLAFSFTK--TKNVQMQLPPEAYLIITKHGNVCL  373

Query  255  GVLNGTEAGLHNYNVIG  205
            G+L+GTE GL + N+IG
Sbjct  374  GILDGTEVGLESLNIIG  390



>ref|XP_007019120.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY16345.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=440

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = -1

Query  621  YTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE  442
            + KHYS GPAEL FGGK TGVK + V+FDSG++Y+Y++S+ Y+  L  + K+L GK LR+
Sbjct  263  FDKHYSSGPAELLFGGKPTGVKGLNVIFDSGATYTYLSSKVYQTVLNLIRKDLTGKQLRD  322

Query  441  AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV  262
              D+  LP CWKG +PF+S+ DV+ YF +  LSFA    ++ +  + PE+YLI++ +G+V
Sbjct  323  VKDN-ALPICWKGAKPFKSVRDVRNYFNTLVLSFAGANNNKLV--LPPEAYLIVTERGNV  379

Query  261  CLGVLNGTEAGLHNYNVIGDVSM  193
            CLG+L+GTEAGL   NVIG  S+
Sbjct  380  CLGILSGTEAGLGITNVIGGKSV  402



>gb|EMT05967.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=306

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 111/177 (63%), Gaps = 4/177 (2%)
 Frame = -1

Query  636  PCPRDYTKHYSPGPA--ELTFGGKSTGVKN-MIVVFDSGSSYSYMNSQPYEAFLYSVVKE  466
            P  ++YT +YSPG     L    K    K   + VFDSGS+YSY++   YE  + +V   
Sbjct  122  PMVQEYTIYYSPGKVTWNLDVLLKYELSKTPRVAVFDSGSAYSYVHKDTYELLIQAVDVT  181

Query  465  LRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYL  286
            L+   L++  DDP L  CW+  +P +S+ DVK  F+   L+F +G  S+   +I PE+Y+
Sbjct  182  LQDSTLQKVPDDPELTQCWRYNQPIQSVDDVKHEFEPLELTFTHG-ASQVTLDIPPENYI  240

Query  285  IISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPA  115
            +++ +G+VCLG+ NG+E G+   N+IGD++MQ+ +V+YDNE+  IGW RA+CD  P 
Sbjct  241  VVTERGNVCLGIHNGSEHGMGELNIIGDITMQNHLVVYDNERARIGWVRASCDIMPG  297



>gb|ABR18371.1| unknown [Picea sitchensis]
Length=446

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  627  RDYTKHYSPGPAELTFGGK-----STGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL  463
            R   KHY  G A++ FG K       G K   ++FDSGS+Y+Y  +Q Y AFL  V + L
Sbjct  272  RPSIKHYYVGAAQMNFGNKPLDKDGDGKKLGGIIFDSGSTYTYFTNQAYGAFLSVVKENL  331

Query  462  RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI  283
             GK L +   D  L  CW+ +  FRS+++   YFK   L F +    +   EI PE YL+
Sbjct  332  SGKQLEQDSSDSFLSLCWRRKEGFRSVAEAAAYFKPLTLKFRSTKTKQ--MEIFPEGYLV  389

Query  282  ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
            ++ KG+VCLG+LNGT  G+ + NV+GD+S Q ++V+YDNEKN IGW R++C  
Sbjct  390  VNKKGNVCLGILNGTAIGIVDTNVLGDISFQGQLVVYDNEKNQIGWARSDCQE  442



>ref|XP_010912540.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=413

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 114/170 (67%), Gaps = 9/170 (5%)
 Frame = -1

Query  630  PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP  451
            P   + +YSPGPA L +G +S G  +  V+ DSG+ ++Y   QPY  F+ ++  ++  +P
Sbjct  241  PMTRSNYYSPGPASLLWGTRSLG-SSRSVLLDSGTPFTYFALQPYNNFISALTNKVSKQP  299

Query  450  LREAGDDPTLPFCWKGRRPFRSISDVKKYFK-SFALSFANGWRSRTLFEISPESYLIISS  274
            L+   D   LP+CW G +PF+S+SDVK+Y + S  L F NG  S T   I PE+YLIIS+
Sbjct  300  LKRVKDS-KLPYCWTGPKPFKSMSDVKQYLETSLELRFDNGGASMT---IPPENYLIISN  355

Query  273  KGSVCLGVLNGTEAGLH-NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD  127
            KG+ CLG+ NG+EAGL+ +  +IGD+SM DR+VIYDN+K  IGW   +CD
Sbjct  356  KGNACLGIFNGSEAGLNRDVILIGDISMLDRLVIYDNDKRRIGW--GSCD  403



>ref|XP_002511959.1| protein with unknown function [Ricinus communis]
 gb|EEF50628.1| protein with unknown function [Ricinus communis]
Length=583

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 115/181 (64%), Gaps = 11/181 (6%)
 Frame = -1

Query  645  LDTPCPRDYTKH-----YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLY  481
            LD+P    Y        Y  GP  L+ GG+   V+   +VFDSGSSY+Y   + Y   + 
Sbjct  397  LDSPSIDSYQTQIMKLNYGSGP--LSLGGQERRVRR--IVFDSGSSYTYFTKEAYSELVA  452

Query  480  SVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGW-RSRTLFEI  304
            S+ K++ G+ L +   DPTLPFCW+ + P RS+ DVK+YFK+  L F + W    T F I
Sbjct  453  SL-KQVSGEALIQDTSDPTLPFCWRAKFPIRSVIDVKQYFKTLTLQFGSKWWIISTKFRI  511

Query  303  SPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR  124
             PE YLIIS+KG+VCLG+L+G++    +  ++GD+S++ +++IYDN  N IGWT+++C +
Sbjct  512  PPEGYLIISNKGNVCLGILDGSDVHDGSSIILGDISLRGQLIIYDNVNNKIGWTQSDCIK  571

Query  123  P  121
            P
Sbjct  572  P  572



>ref|NP_001065918.1| Os11g0184800 [Oryza sativa Japonica Group]
 sp|Q0IU52.1|ASP1_ORYSJ RecName: Full=Aspartic proteinase Asp1; Short=OSAP1; Short=OsAsp1; 
AltName: Full=Nucellin-like protein; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAQ14543.1|AF308691_1 nucellin-like protein [Oryza sativa Japonica Group]
 gb|AAQ14544.1|AF308692_1 nucellin-like protein [Oryza sativa Japonica Group]
 gb|AAY23267.1| nucellin-like protein [Oryza sativa Japonica Group]
 gb|ABA91764.1| Aspartic proteinase Asp1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27763.1| Os11g0184800 [Oryza sativa Japonica Group]
 dbj|BAG99045.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71282.1| aspartic proteinase [Oryza sativa Japonica Group]
Length=410

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 112/181 (62%), Gaps = 9/181 (5%)
 Frame = -1

Query  639  TPCPRDYTKHYSPGPAELTFGGKSTGVKN--MIVVFDSGSSYSYMNSQPYEAFLYSVVKE  466
            TP  R++ K+YSPG   L F   S  +    M V+FDSG++Y+Y  +QPY+A L  V   
Sbjct  222  TPMNREH-KYYSPGHGTLHFDSNSKAISAAPMAVIFDSGATYTYFAAQPYQATLSVVKST  280

Query  465  LRG--KPLREAGD-DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPE  295
            L    K L E  + D  L  CWKG+    +I +VKK F+S +L FA+G +  TL EI PE
Sbjct  281  LNSECKFLTEVTEKDRALTVCWKGKDKIVTIDEVKKCFRSLSLEFADGDKKATL-EIPPE  339

Query  294  SYLIISSKGSVCLGVLNGTEA--GLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP  121
             YLIIS +G VCLG+L+G++    L   N+IG ++M D+MVIYD+E++ +GW    CDR 
Sbjct  340  HYLIISQEGHVCLGILDGSKEHLSLAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCDRI  399

Query  120  P  118
            P
Sbjct  400  P  400



>ref|XP_001783556.1| predicted protein [Physcomitrella patens]
 gb|EDQ51645.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 3/144 (2%)
 Frame = -1

Query  543  VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKY  364
            +FDSG+S++Y+    Y A L +VV++ +   L     D TLPFCW+G  PF S++DV  Y
Sbjct  255  MFDSGTSFTYLVPNAYTAVLSAVVRQAQRSGLERIKTDTTLPFCWRGPSPFESVADVSAY  314

Query  363  FKSFALSFANG--WRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ  190
            FK+  L F     W S  L E+SPE YLI+S++G+VCLGVL+ + A L   N++GD+SM+
Sbjct  315  FKTVTLDFGGSTWWSSGKLLELSPEGYLIVSTQGNVCLGVLDASVASLEVTNILGDISMR  374

Query  189  DRMVIYDNEKNAIGWTRANC-DRP  121
              +V+YDN +  IGW R NC +RP
Sbjct  375  GYLVVYDNMREQIGWVRRNCYNRP  398



>ref|XP_011027498.1| PREDICTED: aspartic proteinase Asp1-like isoform X4 [Populus 
euphratica]
 ref|XP_011014194.1| PREDICTED: aspartic proteinase Asp1-like isoform X4 [Populus 
euphratica]
Length=400

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAEL FGGK TG+K + ++FDSGSSY+Y ++Q Y++ L  V K+L GKPLR+A ++
Sbjct  262  YSSGPAELLFGGKPTGIKGLQLIFDSGSSYTYFSAQVYQSILNLVRKDLSGKPLRDAPEE  321

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
              L  CWK  +P +SI D+K +FK   ++F      +   +++PE YLII+  G+VCLG+
Sbjct  322  KALAVCWKTAKPIKSILDIKSFFKPLTINFIKAKNVQ--LQLAPEDYLIITKDGNVCLGI  379

Query  249  LNGTEAGLHNYNVIG  205
            LNG E GL N NVIG
Sbjct  380  LNGGEQGLGNLNVIG  394



>ref|XP_001766321.1| predicted protein [Physcomitrella patens]
 gb|EDQ68953.1| predicted protein, partial [Physcomitrella patens]
Length=381

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 97/145 (67%), Gaps = 2/145 (1%)
 Frame = -1

Query  546  VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKK  367
            V+FDSG+S++Y+  + Y A L ++  ++    L     D TLPFCW+G  PF S++DV++
Sbjct  237  VMFDSGTSFTYLVPEAYNAVLSAMEMQVEKSGLVRIKTDNTLPFCWRGPSPFESVADVQR  296

Query  366  YFKSFALSFA--NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSM  193
            YFK+  L F   N + +  + E+SPE YLI+S++G+VCLG+L+ + A L   N+IGDVSM
Sbjct  297  YFKTVTLDFGKRNWYSASRVLELSPEGYLIVSTQGNVCLGILDASGASLEVTNIIGDVSM  356

Query  192  QDRMVIYDNEKNAIGWTRANCDRPP  118
            +  +V+YDN +N IGW R NC   P
Sbjct  357  RGYLVVYDNARNQIGWVRRNCHNRP  381



>ref|XP_011027497.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Populus 
euphratica]
 ref|XP_011014193.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Populus 
euphratica]
Length=414

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = -1

Query  609  YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD  430
            YS GPAEL FGGK TG+K + ++FDSGSSY+Y ++Q Y++ L  V K+L GKPLR+A ++
Sbjct  262  YSSGPAELLFGGKPTGIKGLQLIFDSGSSYTYFSAQVYQSILNLVRKDLSGKPLRDAPEE  321

Query  429  PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV  250
              L  CWK  +P +SI D+K +FK   ++F          +++PE YLII+  G+VCLG+
Sbjct  322  KALAVCWKTAKPIKSILDIKSFFKPLTINFIKA--KNVQLQLAPEDYLIITKDGNVCLGI  379

Query  249  LNGTEAGLHNYNVIG  205
            LNG E GL N NVIG
Sbjct  380  LNGGEQGLGNLNVIG  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060