BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF003B02

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08361.1|  unnamed protein product                                147   9e-38   Coffea canephora [robusta coffee]
gb|AAF14242.1|AF110226_1  nuclear RNA binding protein                   141   4e-36   Nicotiana tabacum [American tobacco]
ref|XP_009613635.1|  PREDICTED: plasminogen activator inhibitor 1...    140   2e-35   Nicotiana tomentosiformis
ref|XP_009613636.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    137   2e-34   Nicotiana tomentosiformis
ref|XP_011081281.1|  PREDICTED: RNA-binding protein FUS isoform X1      136   7e-34   Sesamum indicum [beniseed]
ref|XP_009789577.1|  PREDICTED: plasminogen activator inhibitor 1...    134   4e-33   Nicotiana sylvestris
ref|XP_006362472.1|  PREDICTED: plasminogen activator inhibitor 1...    133   1e-32   Solanum tuberosum [potatoes]
ref|NP_001275449.1|  plasminogen activator inhibitor 1 RNA-bindin...    131   5e-32   Solanum tuberosum [potatoes]
ref|XP_009789579.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    130   7e-32   Nicotiana sylvestris
ref|XP_004253373.2|  PREDICTED: plasminogen activator inhibitor 1...    130   8e-32   Solanum lycopersicum
ref|XP_006362474.1|  PREDICTED: plasminogen activator inhibitor 1...    129   2e-31   Solanum tuberosum [potatoes]
ref|XP_006362473.1|  PREDICTED: plasminogen activator inhibitor 1...    129   2e-31   
ref|XP_009607512.1|  PREDICTED: intracellular hyaluronan-binding ...    129   3e-31   Nicotiana tomentosiformis
ref|XP_011081284.1|  PREDICTED: plasminogen activator inhibitor 1...    128   5e-31   Sesamum indicum [beniseed]
ref|XP_011081282.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    126   2e-30   Sesamum indicum [beniseed]
ref|XP_009607515.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    121   2e-28   Nicotiana tomentosiformis
ref|XP_009766508.1|  PREDICTED: plasminogen activator inhibitor 1...    120   4e-28   Nicotiana sylvestris
ref|XP_009594553.1|  PREDICTED: plasminogen activator inhibitor 1...    119   8e-28   Nicotiana tomentosiformis
ref|XP_010677113.1|  PREDICTED: plasminogen activator inhibitor 1...    118   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009772173.1|  PREDICTED: plasminogen activator inhibitor 1...    118   2e-27   Nicotiana sylvestris
ref|XP_004244706.2|  PREDICTED: plasminogen activator inhibitor 1...    117   4e-27   Solanum lycopersicum
ref|XP_010258760.1|  PREDICTED: plasminogen activator inhibitor 1...    117   7e-27   Nelumbo nucifera [Indian lotus]
ref|XP_002303373.2|  nuclear RNA-binding family protein                 116   9e-27   
ref|XP_010661405.1|  PREDICTED: plasminogen activator inhibitor 1...    115   2e-26   Vitis vinifera
ref|XP_011031954.1|  PREDICTED: plasminogen activator inhibitor 1...    115   2e-26   Populus euphratica
gb|KDP39931.1|  hypothetical protein JCGZ_03462                         115   3e-26   Jatropha curcas
gb|EYU19470.1|  hypothetical protein MIMGU_mgv1a008507mg                115   3e-26   Erythranthe guttata [common monkey flower]
ref|XP_007052330.1|  Hyaluronan / mRNA binding family isoform 4         112   1e-25   
ref|XP_010275458.1|  PREDICTED: plasminogen activator inhibitor 1...    112   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002266051.1|  PREDICTED: uncharacterized protein DDB_G0288133    112   3e-25   Vitis vinifera
emb|CAN75176.1|  hypothetical protein VITISV_016687                     112   3e-25   Vitis vinifera
ref|XP_007052327.1|  Hyaluronan / mRNA binding family isoform 1         111   5e-25   
gb|KJB37651.1|  hypothetical protein B456_006G214200                    110   9e-25   Gossypium raimondii
gb|KJB37648.1|  hypothetical protein B456_006G214200                    110   1e-24   Gossypium raimondii
ref|XP_007039722.1|  Hyaluronan / mRNA binding family                   110   1e-24   
gb|KJB37646.1|  hypothetical protein B456_006G214200                    110   2e-24   Gossypium raimondii
gb|AEI59279.1|  RNA binding protein                                     109   2e-24   Suaeda glauca
ref|XP_009772180.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    109   2e-24   Nicotiana sylvestris
gb|KDO57096.1|  hypothetical protein CISIN_1g017915mg                   109   2e-24   Citrus sinensis [apfelsine]
ref|XP_006477112.1|  PREDICTED: plasminogen activator inhibitor 1...    109   3e-24   Citrus sinensis [apfelsine]
ref|XP_006440205.1|  hypothetical protein CICLE_v10020747mg             109   3e-24   Citrus clementina [clementine]
ref|XP_011093236.1|  PREDICTED: plasminogen activator inhibitor 1...    108   5e-24   Sesamum indicum [beniseed]
ref|XP_002531778.1|  Plasminogen activator inhibitor 1 RNA-bindin...    107   1e-23   Ricinus communis
gb|KJB37647.1|  hypothetical protein B456_006G214200                    106   3e-23   Gossypium raimondii
ref|XP_008369209.1|  PREDICTED: plasminogen activator inhibitor 1...    106   3e-23   Malus domestica [apple tree]
gb|KJB24880.1|  hypothetical protein B456_004G166200                    106   4e-23   Gossypium raimondii
gb|KJB37652.1|  hypothetical protein B456_006G214200                    105   4e-23   Gossypium raimondii
gb|KJB24881.1|  hypothetical protein B456_004G166200                    106   4e-23   Gossypium raimondii
gb|KHG17525.1|  Plasminogen activator inhibitor 1 RNA-binding           105   8e-23   Gossypium arboreum [tree cotton]
gb|KHG30709.1|  hypothetical protein F383_14338                         105   9e-23   Gossypium arboreum [tree cotton]
gb|KHG27284.1|  hypothetical protein F383_11722                         104   1e-22   Gossypium arboreum [tree cotton]
ref|XP_007134461.1|  hypothetical protein PHAVU_010G049300g             104   2e-22   Phaseolus vulgaris [French bean]
gb|KJB25493.1|  hypothetical protein B456_004G194400                    104   2e-22   Gossypium raimondii
gb|KDO57095.1|  hypothetical protein CISIN_1g017915mg                   104   2e-22   Citrus sinensis [apfelsine]
gb|KJB24891.1|  hypothetical protein B456_004G166300                    103   2e-22   Gossypium raimondii
ref|XP_003521066.1|  PREDICTED: plasminogen activator inhibitor 1...    103   3e-22   Glycine max [soybeans]
gb|KHG05539.1|  Plasminogen activator inhibitor 1 RNA-binding           103   3e-22   Gossypium arboreum [tree cotton]
ref|XP_006398418.1|  hypothetical protein EUTSA_v10000938mg             103   3e-22   Eutrema salsugineum [saltwater cress]
ref|XP_007209289.1|  hypothetical protein PRUPE_ppa007665mg             103   4e-22   Prunus persica
ref|XP_011093237.1|  PREDICTED: plasminogen activator inhibitor 1...    102   5e-22   Sesamum indicum [beniseed]
ref|XP_008373667.1|  PREDICTED: plasminogen activator inhibitor 1...    102   1e-21   Malus domestica [apple tree]
gb|KDO57094.1|  hypothetical protein CISIN_1g017915mg                   101   1e-21   Citrus sinensis [apfelsine]
ref|XP_006477113.1|  PREDICTED: plasminogen activator inhibitor 1...    101   1e-21   Citrus sinensis [apfelsine]
ref|XP_006440206.1|  hypothetical protein CICLE_v10020747mg             101   2e-21   Citrus clementina [clementine]
gb|KDO57093.1|  hypothetical protein CISIN_1g017915mg                   101   2e-21   Citrus sinensis [apfelsine]
gb|KJB25494.1|  hypothetical protein B456_004G194400                    100   4e-21   Gossypium raimondii
gb|ABK94426.1|  unknown                                                 100   4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006368965.1|  nuclear RNA-binding family protein                 100   4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_008238397.1|  PREDICTED: plasminogen activator inhibitor 1...    100   5e-21   Prunus mume [ume]
ref|XP_008238398.1|  PREDICTED: plasminogen activator inhibitor 1...    100   5e-21   Prunus mume [ume]
ref|XP_009368154.1|  PREDICTED: plasminogen activator inhibitor 1...    100   5e-21   
ref|XP_003529036.1|  PREDICTED: plasminogen activator inhibitor 1...  99.4    9e-21   Glycine max [soybeans]
ref|XP_009343931.1|  PREDICTED: plasminogen activator inhibitor 1...  99.0    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_006853790.1|  hypothetical protein AMTR_s00056p00215280        98.6    2e-20   
ref|XP_011047584.1|  PREDICTED: plasminogen activator inhibitor 1...  97.8    3e-20   Populus euphratica
ref|XP_011032359.1|  PREDICTED: plasminogen activator inhibitor 1...  97.4    4e-20   Populus euphratica
ref|XP_004300342.1|  PREDICTED: intracellular hyaluronan-binding ...  97.4    5e-20   Fragaria vesca subsp. vesca
ref|XP_011465242.1|  PREDICTED: plasminogen activator inhibitor 1...  97.1    6e-20   Fragaria vesca subsp. vesca
ref|XP_006837401.1|  hypothetical protein AMTR_s00111p00140620        97.1    6e-20   Amborella trichopoda
ref|XP_009368155.1|  PREDICTED: plasminogen activator inhibitor 1...  96.3    9e-20   Pyrus x bretschneideri [bai li]
gb|AAF14244.1|AF110228_1  nuclear RNA binding protein A               95.9    1e-19   Spinacia oleracea
ref|NP_001241515.1|  uncharacterized protein LOC100807657             95.9    1e-19   Glycine max [soybeans]
ref|XP_007218155.1|  hypothetical protein PRUPE_ppa007410mg           95.9    2e-19   Prunus persica
ref|XP_009776248.1|  PREDICTED: plasminogen activator inhibitor 1...  95.5    2e-19   Nicotiana sylvestris
ref|XP_008347095.1|  PREDICTED: plasminogen activator inhibitor 1...  94.0    2e-19   
ref|XP_008344404.1|  PREDICTED: plasminogen activator inhibitor 1...  95.5    2e-19   
ref|XP_008232490.1|  PREDICTED: plasminogen activator inhibitor 1...  95.1    2e-19   Prunus mume [ume]
ref|XP_009373211.1|  PREDICTED: plasminogen activator inhibitor 1...  95.1    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_006375155.1|  hypothetical protein POPTR_0014s04820g           94.7    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008375773.1|  PREDICTED: LOW QUALITY PROTEIN: plasminogen ...  94.7    3e-19   
ref|XP_004306983.1|  PREDICTED: circumsporozoite protein-like         95.1    3e-19   Fragaria vesca subsp. vesca
gb|ABK94354.1|  unknown                                               94.7    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011032341.1|  PREDICTED: plasminogen activator inhibitor 1...  94.7    4e-19   Populus euphratica
emb|CDP21265.1|  unnamed protein product                              94.4    5e-19   Coffea canephora [robusta coffee]
gb|KCW77830.1|  hypothetical protein EUGRSUZ_D02118                   94.0    6e-19   Eucalyptus grandis [rose gum]
ref|XP_010531668.1|  PREDICTED: plasminogen activator inhibitor 1...  94.0    7e-19   Tarenaya hassleriana [spider flower]
ref|XP_010104826.1|  hypothetical protein L484_024026                 95.1    7e-19   
dbj|BAE71297.1|  hypothetical protein                                 94.0    7e-19   Trifolium pratense [peavine clover]
ref|XP_004515346.1|  PREDICTED: plasminogen activator inhibitor 1...  93.2    1e-18   Cicer arietinum [garbanzo]
gb|ABY60453.1|  putative nuclear RNA binding protein                  90.1    1e-18   Adonis aestivalis var. palaestina
ref|XP_011017364.1|  PREDICTED: plasminogen activator inhibitor 1...  92.4    2e-18   Populus euphratica
gb|AFK43517.1|  unknown                                               92.4    2e-18   Lotus japonicus
ref|XP_010053521.1|  PREDICTED: vasodilator-stimulated phosphopro...  92.0    3e-18   Eucalyptus grandis [rose gum]
ref|XP_003552493.1|  PREDICTED: plasminogen activator inhibitor 1...  92.0    3e-18   Glycine max [soybeans]
gb|KFK31390.1|  hypothetical protein AALP_AA6G105700                  92.0    3e-18   Arabis alpina [alpine rockcress]
ref|XP_010918620.1|  PREDICTED: plasminogen activator inhibitor 1...  92.0    3e-18   Elaeis guineensis
gb|KCW77831.1|  hypothetical protein EUGRSUZ_D02118                   92.0    3e-18   Eucalyptus grandis [rose gum]
gb|KHN00198.1|  hypothetical protein glysoja_034729                   88.2    4e-18   Glycine soja [wild soybean]
ref|XP_007139646.1|  hypothetical protein PHAVU_008G047300g           91.7    4e-18   Phaseolus vulgaris [French bean]
ref|XP_002301233.2|  transcription factor family protein              91.7    4e-18   
ref|XP_010531670.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  91.7    4e-18   Tarenaya hassleriana [spider flower]
ref|XP_002458112.1|  hypothetical protein SORBIDRAFT_03g027110        91.7    4e-18   Sorghum bicolor [broomcorn]
ref|XP_006644341.1|  PREDICTED: plasminogen activator inhibitor 1...  91.3    5e-18   Oryza brachyantha
gb|ABR26138.1|  salt tolerance protein 2                              89.0    6e-18   Oryza sativa Indica Group [Indian rice]
dbj|BAE71280.1|  putative nuclear antigen homolog                     90.9    7e-18   Trifolium pratense [peavine clover]
gb|KJB22277.1|  hypothetical protein B456_004G038700                  90.9    7e-18   Gossypium raimondii
ref|XP_009395730.1|  PREDICTED: keratin, type II cytoskeletal 2 e...  91.3    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924482.1|  PREDICTED: probable H/ACA ribonucleoprotein ...  90.9    8e-18   Elaeis guineensis
gb|KHN40549.1|  hypothetical protein glysoja_001047                   90.9    8e-18   Glycine soja [wild soybean]
dbj|BAE71204.1|  putative nuclear antigen homolog                     90.9    8e-18   Trifolium pratense [peavine clover]
ref|XP_003624316.1|  Transcription factor                             92.8    8e-18   
ref|XP_010919740.1|  PREDICTED: plasminogen activator inhibitor 1...  90.1    1e-17   Elaeis guineensis
ref|XP_010919739.1|  PREDICTED: plasminogen activator inhibitor 1...  90.1    2e-17   Elaeis guineensis
gb|EAY75654.1|  hypothetical protein OsI_03559                        89.7    2e-17   Oryza sativa Indica Group [Indian rice]
gb|AES80534.2|  nuclear RNA-binding-like protein                      91.7    2e-17   Medicago truncatula
ref|XP_010053520.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  89.7    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010053519.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  89.7    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010531669.1|  PREDICTED: plasminogen activator inhibitor 1...  88.6    4e-17   Tarenaya hassleriana [spider flower]
gb|EAZ13376.1|  hypothetical protein OsJ_03294                        88.6    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009416461.1|  PREDICTED: plasminogen activator inhibitor 1...  89.0    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007142624.1|  hypothetical protein PHAVU_007G003500g           88.6    5e-17   Phaseolus vulgaris [French bean]
ref|NP_001043502.1|  Os01g0603000                                     88.6    5e-17   
ref|NP_001044098.1|  Os01g0721900                                     88.6    5e-17   
ref|XP_008459799.1|  PREDICTED: plasminogen activator inhibitor 1...  88.2    6e-17   Cucumis melo [Oriental melon]
ref|XP_002870099.1|  hypothetical protein ARALYDRAFT_493124           88.2    6e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_009101440.1|  PREDICTED: suppressor protein STM1               87.8    7e-17   Brassica rapa
gb|EYU19467.1|  hypothetical protein MIMGU_mgv1a008831mg              88.2    7e-17   Erythranthe guttata [common monkey flower]
ref|XP_004961407.1|  PREDICTED: RNA-binding protein FUS-like          88.2    8e-17   Setaria italica
gb|AFW81314.1|  plasminogen activator inhibitor 1 RNA-binding pro...  88.2    8e-17   
ref|NP_001148572.1|  plasminogen activator inhibitor 1 RNA-bindin...  87.8    8e-17   Zea mays [maize]
gb|KHN11561.1|  hypothetical protein glysoja_006014                   85.5    8e-17   Glycine soja [wild soybean]
ref|XP_009410905.1|  PREDICTED: plasminogen activator inhibitor 1...  88.2    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004150996.1|  PREDICTED: uncharacterized protein LOC101210473  87.8    9e-17   Cucumis sativus [cucumbers]
ref|XP_008810382.1|  PREDICTED: plasminogen activator inhibitor 1...  87.4    1e-16   Phoenix dactylifera
ref|XP_006654864.1|  PREDICTED: plasminogen activator inhibitor 1...  87.4    2e-16   Oryza brachyantha
gb|KHN27127.1|  hypothetical protein glysoja_032895                   86.7    2e-16   Glycine soja [wild soybean]
ref|XP_008798813.1|  PREDICTED: plasminogen activator inhibitor 1...  87.0    2e-16   Phoenix dactylifera
ref|XP_008798814.1|  PREDICTED: plasminogen activator inhibitor 1...  87.0    2e-16   Phoenix dactylifera
ref|XP_003556572.1|  PREDICTED: plasminogen activator inhibitor 1...  86.3    2e-16   Glycine max [soybeans]
ref|XP_004969088.1|  PREDICTED: plasminogen activator inhibitor 1...  87.0    2e-16   Setaria italica
ref|XP_009396539.1|  PREDICTED: plasminogen activator inhibitor 1...  87.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003567795.1|  PREDICTED: plasminogen activator inhibitor 1...  86.7    3e-16   Brachypodium distachyon [annual false brome]
gb|ABR25759.1|  nuclear antigen                                       85.1    3e-16   Oryza sativa Indica Group [Indian rice]
emb|CDY40563.1|  BnaC02g33290D                                        85.9    3e-16   Brassica napus [oilseed rape]
emb|CDX76586.1|  BnaA08g08140D                                        85.9    3e-16   
ref|XP_010449709.1|  PREDICTED: plasminogen activator inhibitor 1...  86.3    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010449710.1|  PREDICTED: plasminogen activator inhibitor 1...  85.1    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006280739.1|  hypothetical protein CARUB_v10026708mg           85.9    4e-16   Capsella rubella
gb|ACL54182.1|  unknown                                               84.3    4e-16   Zea mays [maize]
gb|ABD64914.1|  nuclear RNA binding protein, putative                 85.5    4e-16   Brassica oleracea
ref|XP_010449600.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009108277.1|  PREDICTED: plasminogen activator inhibitor 1...  84.7    6e-16   Brassica rapa
gb|ABD65038.1|  nuclear RNA binding protein, putative                 85.1    6e-16   Brassica oleracea
ref|XP_002870130.1|  hypothetical protein ARALYDRAFT_493188           85.5    6e-16   
ref|XP_010434652.1|  PREDICTED: plasminogen activator inhibitor 1...  85.5    7e-16   Camelina sativa [gold-of-pleasure]
emb|CDY67886.1|  BnaCnng56800D                                        85.1    8e-16   Brassica napus [oilseed rape]
gb|EAY74854.1|  hypothetical protein OsI_02745                        85.5    8e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002440366.1|  hypothetical protein SORBIDRAFT_09g030400        85.1    8e-16   Sorghum bicolor [broomcorn]
emb|CDY33522.1|  BnaA06g35510D                                        84.7    9e-16   Brassica napus [oilseed rape]
emb|CDY43435.1|  BnaAnng07070D                                        84.7    9e-16   Brassica napus [oilseed rape]
ref|XP_004140509.1|  PREDICTED: uncharacterized protein LOC101209927  84.7    1e-15   Cucumis sativus [cucumbers]
ref|XP_009114287.1|  PREDICTED: uncharacterized protein LOC103839539  84.3    1e-15   Brassica rapa
ref|XP_009128949.1|  PREDICTED: suppressor protein STM1-like          84.0    1e-15   Brassica rapa
gb|KFK22256.1|  hypothetical protein AALP_AAs66747U001100             84.3    2e-15   Arabis alpina [alpine rockcress]
ref|XP_009108276.1|  PREDICTED: plasminogen activator inhibitor 1...  83.6    2e-15   Brassica rapa
ref|XP_010440090.1|  PREDICTED: uncharacterized protein LOC104723416  80.5    2e-15   
ref|XP_004961035.1|  PREDICTED: insulin receptor substrate 4-like     84.0    2e-15   Setaria italica
gb|KJB37649.1|  hypothetical protein B456_006G214200                  83.2    2e-15   Gossypium raimondii
emb|CDY35615.1|  BnaC01g21370D                                        83.2    3e-15   Brassica napus [oilseed rape]
ref|NP_001281195.1|  plasminogen activator inhibitor 1 RNA-bindin...  83.6    3e-15   Zea mays [maize]
ref|XP_006414296.1|  hypothetical protein EUTSA_v10025552mg           83.6    3e-15   Eutrema salsugineum [saltwater cress]
gb|ACG24258.1|  plasminogen activator inhibitor 1 RNA-binding pro...  83.6    3e-15   Zea mays [maize]
gb|EAY99238.1|  hypothetical protein OsI_21200                        84.0    3e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001056483.1|  Os05g0589600                                     84.0    3e-15   
ref|NP_193485.1|  hyaluronan / mRNA binding family                    83.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADE76006.1|  unknown                                               80.1    3e-15   Picea sitchensis
gb|AAM64962.1|  nuclear RNA binding protein A-like protein            83.2    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434762.1|  PREDICTED: plasminogen activator inhibitor 1...  82.8    4e-15   Camelina sativa [gold-of-pleasure]
emb|CDY65881.1|  BnaAnng21260D                                        82.4    4e-15   Brassica napus [oilseed rape]
ref|NP_199532.1|  Hyaluronan / mRNA binding family protein            82.8    5e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG90611.1|  unnamed protein product                              81.3    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010481348.1|  PREDICTED: plasminogen activator inhibitor 1...  82.4    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010441486.1|  PREDICTED: plasminogen activator inhibitor 1...  82.4    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010439990.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  82.8    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010481347.1|  PREDICTED: plasminogen activator inhibitor 1...  82.4    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008675099.1|  PREDICTED: plasminogen activator inhibitor 1...  82.8    7e-15   Zea mays [maize]
ref|XP_009145376.1|  PREDICTED: plasminogen activator inhibitor 1...  81.6    7e-15   Brassica rapa
ref|NP_001056139.1|  Os05g0533100                                     81.3    9e-15   
gb|AAM63072.1|  nuclear RNA binding protein A-like protein            82.0    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145362.1|  PREDICTED: plasminogen activator inhibitor 1...  81.6    1e-14   Brassica rapa
gb|KJB24892.1|  hypothetical protein B456_004G166300                  80.9    2e-14   Gossypium raimondii
gb|EEE64473.1|  hypothetical protein OsJ_19323                        81.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ98247.1|  predicted protein                                    78.6    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010494951.1|  PREDICTED: plasminogen activator inhibitor 1...  80.9    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003568032.1|  PREDICTED: probable H/ACA ribonucleoprotein ...  81.3    2e-14   Brachypodium distachyon [annual false brome]
emb|CDY28966.1|  BnaA02g25100D                                        80.5    3e-14   Brassica napus [oilseed rape]
gb|EEC79581.1|  hypothetical protein OsI_20751                        80.9    3e-14   Oryza sativa Indica Group [Indian rice]
gb|ABD65067.1|  nuclear RNA binding protein, putative                 80.9    3e-14   Brassica oleracea
gb|EMT12851.1|  hypothetical protein F775_28068                       79.7    3e-14   
ref|XP_002440127.1|  hypothetical protein SORBIDRAFT_09g026550        80.9    3e-14   Sorghum bicolor [broomcorn]
gb|EMT08444.1|  hypothetical protein F775_29168                       82.4    3e-14   
ref|XP_001760974.1|  predicted protein                                80.1    4e-14   
ref|XP_004969787.1|  PREDICTED: eukaryotic translation initiation...  80.5    4e-14   Setaria italica
dbj|BAJ96699.1|  predicted protein                                    80.5    4e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAS75737.1|  thermoinhibition-associated THB-4 protein             76.3    4e-14   Tagetes minuta
gb|AAT47083.1|  unknown protein                                       80.5    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KJB37650.1|  hypothetical protein B456_006G214200                  79.3    4e-14   Gossypium raimondii
ref|XP_011101848.1|  PREDICTED: plasminogen activator inhibitor 1...  80.1    5e-14   Sesamum indicum [beniseed]
ref|XP_006285507.1|  hypothetical protein CARUB_v10006948mg           80.1    5e-14   Capsella rubella
ref|XP_002863351.1|  hypothetical protein ARALYDRAFT_494257           80.1    5e-14   
ref|XP_003569708.1|  PREDICTED: RNA-binding protein FUS-like          79.7    8e-14   Brachypodium distachyon [annual false brome]
ref|XP_006284012.1|  hypothetical protein CARUB_v10005134mg           79.3    9e-14   Capsella rubella
gb|EYU40365.1|  hypothetical protein MIMGU_mgv1a008102mg              79.3    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_009108330.1|  PREDICTED: plasminogen activator inhibitor 1...  79.3    1e-13   Brassica rapa
gb|KFK24045.1|  hypothetical protein AALP_AAs42697U000600             79.3    1e-13   Arabis alpina [alpine rockcress]
ref|XP_008811725.1|  PREDICTED: uncharacterized protein LOC103722810  75.5    1e-13   Phoenix dactylifera
gb|EPS72575.1|  hypothetical protein M569_02184                       78.6    2e-13   Genlisea aurea
ref|XP_006414219.1|  hypothetical protein EUTSA_v10025512mg           78.6    2e-13   Eutrema salsugineum [saltwater cress]
gb|EMS59053.1|  hypothetical protein TRIUR3_33029                     77.8    2e-13   Triticum urartu
emb|CDX76567.1|  BnaA08g08330D                                        78.6    2e-13   
ref|NP_001078399.1|  hyaluronan / mRNA binding domain-containing ...  77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KEH17858.1|  nuclear RNA-binding-like protein                      78.2    2e-13   Medicago truncatula
ref|NP_193416.1|  hyaluronan / mRNA binding domain-containing pro...  77.8    3e-13   Arabidopsis thaliana [mouse-ear cress]
gb|EMT09866.1|  hypothetical protein F775_32096                       77.8    3e-13   
dbj|BAJ89734.1|  predicted protein                                    77.8    3e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM84169.1|  unnamed protein product                              77.4    5e-13   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001078400.1|  hyaluronan / mRNA binding domain-containing ...  76.6    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148350.1|  PREDICTED: uncharacterized protein LOC101207608  76.3    1e-12   Cucumis sativus [cucumbers]
emb|CDY38403.1|  BnaC01g10120D                                        75.9    1e-12   Brassica napus [oilseed rape]
gb|EMS68133.1|  hypothetical protein TRIUR3_26332                     77.4    1e-12   Triticum urartu
ref|XP_010925494.1|  PREDICTED: protein argonaute 2-like              76.3    1e-12   Elaeis guineensis
ref|XP_008465866.1|  PREDICTED: plasminogen activator inhibitor 1...  76.3    1e-12   Cucumis melo [Oriental melon]
gb|AAM61393.1|  nuclear antigen homolog                               75.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54489.1|  plasminogen activator inhibitor 1 RNA-binding pro...  76.3    1e-12   Phaseolus vulgaris [French bean]
ref|XP_002511578.1|  RNA binding protein, putative                    74.7    2e-12   Ricinus communis
emb|CDY43474.1|  BnaC08g10790D                                        75.5    3e-12   Brassica napus [oilseed rape]
gb|ABD65145.1|  nuclear RNA binding protein, putative                 74.3    5e-12   Brassica oleracea
emb|CDX90469.1|  BnaA03g43120D                                        73.9    6e-12   
ref|XP_001785274.1|  predicted protein                                74.3    6e-12   
ref|XP_009136852.1|  PREDICTED: plasminogen activator inhibitor 1...  73.9    6e-12   Brassica rapa
emb|CAA66481.1|  transcription factor                                 73.9    8e-12   Vicia faba var. minor [tick bean]
ref|XP_010231993.1|  PREDICTED: uncharacterized protein LOC100831026  70.1    9e-12   
ref|XP_009130695.1|  PREDICTED: intracellular hyaluronan-binding ...  72.8    2e-11   Brassica rapa
ref|XP_001756282.1|  predicted protein                                72.8    2e-11   
gb|KHG04303.1|  hypothetical protein F383_01005                       72.0    3e-11   Gossypium arboreum [tree cotton]
gb|EMS56112.1|  hypothetical protein TRIUR3_18406                     69.3    5e-11   Triticum urartu
gb|KDP28866.1|  hypothetical protein JCGZ_14637                       70.9    1e-10   Jatropha curcas
ref|XP_009605755.1|  PREDICTED: plasminogen activator inhibitor 1...  70.1    2e-10   Nicotiana tomentosiformis
ref|XP_009406178.1|  PREDICTED: plasminogen activator inhibitor 1...  70.1    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002991714.1|  hypothetical protein SELMODRAFT_448524           69.7    3e-10   Selaginella moellendorffii
ref|XP_006655517.1|  PREDICTED: plasminogen activator inhibitor 1...  69.3    3e-10   
ref|XP_001767830.1|  predicted protein                                69.3    3e-10   
ref|NP_001078724.1|  Hyaluronan / mRNA binding family protein         68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAC85227.1|  salt tolerance protein 1                             68.6    6e-10   Beta vulgaris [beet]
ref|XP_008650627.1|  PREDICTED: DNA ligase 1-like                     66.6    6e-10   
ref|NP_001275394.1|  nuclear RNA binding protein                      68.2    6e-10   Solanum tuberosum [potatoes]
ref|XP_010692032.1|  PREDICTED: uncharacterized protein DDB_G0288...  68.2    7e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004492923.1|  PREDICTED: intracellular hyaluronan-binding ...  67.8    9e-10   Cicer arietinum [garbanzo]
ref|XP_008459800.1|  PREDICTED: plasminogen activator inhibitor 1...  66.6    2e-09   Cucumis melo [Oriental melon]
ref|XP_004229741.1|  PREDICTED: plasminogen activator inhibitor 1...  66.6    3e-09   
ref|XP_010926667.1|  PREDICTED: protein argonaute 3-like              65.1    9e-09   
gb|AAF14245.1|AF110229_1  nuclear RNA binding protein B               63.5    1e-08   Spinacia oleracea
tpg|DAA57853.1|  TPA: hypothetical protein ZEAMMB73_322547            64.3    1e-08   
ref|XP_008793172.1|  PREDICTED: uncharacterized protein DDB_G0288...  64.7    1e-08   Phoenix dactylifera
ref|XP_009383830.1|  PREDICTED: keratin, type I cytoskeletal 9-like   64.7    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388577.1|  PREDICTED: plasminogen activator inhibitor 1...  64.3    1e-08   
ref|XP_002988573.1|  hypothetical protein SELMODRAFT_447366           63.9    2e-08   Selaginella moellendorffii
ref|XP_010246647.1|  PREDICTED: aspartate, glycine, lysine and se...  63.9    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008792951.1|  PREDICTED: circumsporozoite protein-like         63.9    2e-08   Phoenix dactylifera
gb|ABI18976.1|  nuclear-localized RNA binding protein                 63.9    2e-08   
tpg|DAA57846.1|  TPA: hypothetical protein ZEAMMB73_955694            63.2    3e-08   
gb|AAF14246.1|AF110230_1  nuclear RNA binding protein C               62.0    5e-08   
gb|KHN46561.1|  hypothetical protein glysoja_032653                   62.0    9e-08   
ref|XP_006848446.1|  hypothetical protein AMTR_s00013p00244720        61.6    1e-07   
ref|XP_002979268.1|  hypothetical protein SELMODRAFT_444118           61.2    1e-07   
ref|XP_002458418.1|  hypothetical protein SORBIDRAFT_03g033140        60.8    2e-07   
gb|EPS59059.1|  hypothetical protein M569_15751                       60.8    2e-07   
ref|XP_006414295.1|  hypothetical protein EUTSA_v10025552mg           59.3    5e-07   
ref|XP_006284013.1|  hypothetical protein CARUB_v10005134mg           58.5    1e-06   
gb|KHN13635.1|  UDP-glucose 4-epimerase GEPI48                        56.6    4e-06   
ref|XP_002534519.1|  RNA binding protein, putative                    55.1    2e-05   
ref|XP_003635425.2|  PREDICTED: interleukin enhancer-binding fact...  54.3    4e-05   
emb|CAN80478.1|  hypothetical protein VITISV_018750                   54.3    4e-05   
ref|NP_001173713.1|  Os03g0845300                                     53.9    4e-05   
gb|AAS07374.1|  hypothetical protein                                  53.9    5e-05   
gb|EAY92561.1|  hypothetical protein OsI_14301                        53.9    6e-05   
ref|XP_010646835.1|  PREDICTED: uncharacterized protein LOC100262339  53.5    7e-05   
ref|XP_001760895.1|  predicted protein                                52.0    2e-04   
ref|XP_002539777.1|  conserved hypothetical protein                   48.9    3e-04   
dbj|BAD87405.1|  nuclear RNA binding protein A-like                   48.1    6e-04   



>emb|CDP08361.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 130/184 (71%), Gaps = 10/184 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSP--ldepevkepedkeLTL  586
            TDEIAPE EEP    VN+G      EKQ GQE  GD  KDS     E + KEPE+KE+TL
Sbjct  204  TDEIAPETEEP----VNEGEKNADAEKQSGQETVGDGNKDSHVDEPEEKEKEPEEKEMTL  259

Query  585  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkea  406
            +EY+KLLEEKRK++LAS+PEERKV LDKEFESM LL+NKKNDD+VF+KLGS  +DK+++A
Sbjct  260  EEYQKLLEEKRKSLLASKPEERKVNLDKEFESMQLLSNKKNDDDVFIKLGS-DKDKRRDA  318

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
            GEK KK  SINEFLKPAEGE        G          G  GNN+ + E PSI DVGQF
Sbjct  319  GEKAKKAVSINEFLKPAEGEN---YYRPGGRGRGRGRGRGGYGNNSYNVEAPSIADVGQF  375

Query  225  PTLG  214
            P+LG
Sbjct  376  PSLG  379



>gb|AAF14242.1|AF110226_1 nuclear RNA binding protein [Nicotiana tabacum]
Length=299

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IA E E P    VNDG      EK+ GQE+A D  KDS   EPE KEPE+KE+TL+E
Sbjct  121  ADDIAQETEVP----VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEE  176

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEKL+EEKRKA+LA +PEERKV LDKE ESM LL+NKKNDDE+F+KLGS +++K+KEA E
Sbjct  177  YEKLMEEKRKALLALKPEERKVNLDKELESMQLLSNKKNDDEIFIKLGS-EKEKRKEAVE  235

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K +KT+SINEFLKPAEGE Y R GGRGRG G G G  G G     SF  PSIEDVGQFP+
Sbjct  236  KARKTQSINEFLKPAEGENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPS  295

Query  219  LGSK  208
            L +K
Sbjct  296  LVAK  299



>ref|XP_009613635.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana tomentosiformis]
Length=373

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IA E E P    VNDG      EK+ GQE+A D  KDS   EPE KEPE+KE+TL+E
Sbjct  195  ADDIAQETEVP----VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEE  250

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEKL+EEKRKA+LA +PEERKV LDKE ESM LL+NKKNDDE+F+KLGS +++K+KEA E
Sbjct  251  YEKLMEEKRKALLALKPEERKVNLDKELESMQLLSNKKNDDEIFIKLGS-EKEKRKEAVE  309

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K +KT+SINEFLKPAEGE Y R GGRGRG G G G  G G     SF  PSIEDVGQFP+
Sbjct  310  KARKTQSINEFLKPAEGENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPS  369

Query  219  LGSK  208
            L +K
Sbjct  370  LVAK  373



>ref|XP_009613636.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=350

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -1

Query  714  VNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILAS  535
            VNDG      EK+ GQE+A D  KDS   EPE KEPE+KE+TL+EYEKL+EEKRKA+LA 
Sbjct  183  VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  242

Query  534  RPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPA  355
            +PEERKV LDKE ESM LL+NKKNDDE+F+KLGS +++K+KEA EK +KT+SINEFLKPA
Sbjct  243  KPEERKVNLDKELESMQLLSNKKNDDEIFIKLGS-EKEKRKEAVEKARKTQSINEFLKPA  301

Query  354  EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            EGE Y R GGRGRG G G G  G G     SF  PSIEDVGQFP+L +K
Sbjct  302  EGENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSLVAK  350



>ref|XP_011081281.1| PREDICTED: RNA-binding protein FUS isoform X1 [Sesamum indicum]
Length=365

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 129/184 (70%), Gaps = 8/184 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEI PE EEP     N+GV     EKQ G++D  DA KDS  +E E KEPE+KE+TL+E
Sbjct  190  TDEIVPETEEP----TNEGVKNVDSEKQSGEDDVIDANKDSSANEQEEKEPEEKEMTLEE  245

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+LA + EERKV LDKE ESM LL+NKKNDDEVF+KLGS  +DK+KEA E
Sbjct  246  YEKVLEEKRKALLALKSEERKVGLDKELESMQLLSNKKNDDEVFIKLGS-DKDKRKEAAE  304

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KK+ SINEFLKPAEG+   +    G          G  G N  + E P+IEDVGQFP+
Sbjct  305  KAKKSVSINEFLKPAEGD---KYYRAGGRGRGRGRGRGGFGGNNYNVEAPAIEDVGQFPS  361

Query  219  LGSK  208
            L +K
Sbjct  362  LVAK  365



>ref|XP_009789577.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=374

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 132/185 (71%), Gaps = 6/185 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IA E E P    VNDG      EK+ GQEDA D  KDS   EPE KEPE+KE+TL+E
Sbjct  195  ADDIAQETEVP----VNDGEKIVEAEKEAGQEDAEDTNKDSTAAEPEEKEPEEKEMTLEE  250

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEKL+EEKRKA+LA +PEERKV LDKE E+M LL+NKKNDDE+F+KLGS +++K+KEA E
Sbjct  251  YEKLMEEKRKALLALKPEERKVNLDKELETMQLLSNKKNDDEIFIKLGS-EKEKRKEAVE  309

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQFP  223
            K +KTKSINEFLKPA+GE+ Y   G           G  GG   + +F  PSIEDVGQFP
Sbjct  310  KARKTKSINEFLKPADGESSYYRRGGRGRGQGRGRGGFGGGVGGNKNFSAPSIEDVGQFP  369

Query  222  TLGSK  208
            +L +K
Sbjct  370  SLVAK  374



>ref|XP_006362472.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum tuberosum]
Length=366

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 130/184 (71%), Gaps = 6/184 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IAP  EE     VNDG      EKQ GQEDAGD  KDS   EPE KEPE+KE+TL+E
Sbjct  189  ADDIAPVTEE----SVNDGEKIVDAEKQSGQEDAGDTNKDSSAAEPEEKEPEEKEMTLEE  244

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA++A + EERKV LD E +SM LL+NKKNDDE+F+KLG+ ++DKKKEA E
Sbjct  245  YEKVMEEKRKALVALKQEERKVNLDNELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVE  303

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KKTKSINEFLKPAEGE+ Y   G            G G    +S  +PSIEDVGQFP+
Sbjct  304  KNKKTKSINEFLKPAEGES-YYRPGGRGRGRGRGRGNGGGYGGINSVSSPSIEDVGQFPS  362

Query  219  LGSK  208
            L +K
Sbjct  363  LAAK  366



>ref|NP_001275449.1| plasminogen activator inhibitor 1 RNA-binding protein-like [Solanum 
tuberosum]
 gb|ABA81884.1| nuclear RNA binding protein-like [Solanum tuberosum]
Length=363

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 129/184 (70%), Gaps = 6/184 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IAPE E P    V DG      EKQ GQEDAGD  K+S   EPE KEPE+KE+TL+E
Sbjct  186  ADDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDTNKESTAAEPEEKEPEEKEITLEE  241

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+ ++DKKKEA E
Sbjct  242  YEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVE  300

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KKTKSINEFLKPAEGE+ Y   G            G G    +S   PSIEDVGQFP+
Sbjct  301  KTKKTKSINEFLKPAEGES-YYRPGGRGRGRGRGRGNGGGYGGINSVSAPSIEDVGQFPS  359

Query  219  LGSK  208
            L  K
Sbjct  360  LAVK  363



>ref|XP_009789579.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=351

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -1

Query  714  VNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILAS  535
            VNDG      EK+ GQEDA D  KDS   EPE KEPE+KE+TL+EYEKL+EEKRKA+LA 
Sbjct  183  VNDGEKIVEAEKEAGQEDAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  242

Query  534  RPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPA  355
            +PEERKV LDKE E+M LL+NKKNDDE+F+KLGS +++K+KEA EK +KTKSINEFLKPA
Sbjct  243  KPEERKVNLDKELETMQLLSNKKNDDEIFIKLGS-EKEKRKEAVEKARKTKSINEFLKPA  301

Query  354  EGETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQFPTLGSK  208
            +GE+ Y   G           G  GG   + +F  PSIEDVGQFP+L +K
Sbjct  302  DGESSYYRRGGRGRGQGRGRGGFGGGVGGNKNFSAPSIEDVGQFPSLVAK  351



>ref|XP_004253373.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like, 
partial [Solanum lycopersicum]
Length=327

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 127/186 (68%), Gaps = 6/186 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IA E E P    V DG      EKQ GQEDAGD  KDS   E E KEPE+KE+TL+E
Sbjct  142  ADDIALETEVP----VVDGEKIVEAEKQTGQEDAGDDNKDSTAAELEEKEPEEKEMTLEE  197

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+ ++DKKKEA E
Sbjct  198  YEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVE  256

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KK +SINEFLKPAEGE+ Y   G            G G    SS   PSIEDVGQFP+
Sbjct  257  KAKKAQSINEFLKPAEGES-YYRPGGRGRGRGRGRGNGGGYGGISSVSAPSIEDVGQFPS  315

Query  219  LGSK*G  202
            L  K G
Sbjct  316  LAVKKG  321



>ref|XP_006362474.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Solanum tuberosum]
Length=364

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 129/184 (70%), Gaps = 6/184 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IAPE E P    V DG      EKQ GQEDAGD  KDS   EPE KEPE+KE+TL+E
Sbjct  187  ADDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEE  242

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+ ++DKKKEA E
Sbjct  243  YEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVE  301

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KKT++INEFLKPAEGE  Y   G            G G    +S   PSIEDVGQFP+
Sbjct  302  KAKKTQNINEFLKPAEGEN-YYRSGGRGRGRGRGRGNGGGYVGNNSVSAPSIEDVGQFPS  360

Query  219  LGSK  208
            L +K
Sbjct  361  LAAK  364



>ref|XP_006362473.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Solanum tuberosum]
Length=364

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 129/184 (70%), Gaps = 6/184 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IAPE E P    V DG      EKQ GQEDAGD  KDS   EPE KEPE+KE+TL+E
Sbjct  187  ADDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEE  242

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+ ++DKKKEA E
Sbjct  243  YEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVE  301

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KKT++INEFLKPAEGE  Y   G            G G    +S   PSIEDVGQFP+
Sbjct  302  KAKKTQNINEFLKPAEGEN-YYRSGGRGRGRGRGRGNGGGYVGNNSVSAPSIEDVGQFPS  360

Query  219  LGSK  208
            L +K
Sbjct  361  LAAK  364



>ref|XP_009607512.1| PREDICTED: intracellular hyaluronan-binding protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=359

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 138/184 (75%), Gaps = 8/184 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             DE APE EEP+N    +G      EK   Q DA DA KDSP  EP+ KEPE+KE+TL+E
Sbjct  184  ADEFAPEKEEPLN----EGEKIVDTEKPAVQADAEDASKDSPAAEPQEKEPEEKEMTLEE  239

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEKLLE+KRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KLGS ++DK+KEA E
Sbjct  240  YEKLLEDKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKLGS-EKDKRKEAVE  298

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KKTKSINEFLKPA+G +YYR GGRGRG       G  G N+ S+   PSIEDV QFP+
Sbjct  299  KAKKTKSINEFLKPADGGSYYRRGGRGRGGRDHGRDGVVGNNSVSA---PSIEDVRQFPS  355

Query  219  LGSK  208
            LG+K
Sbjct  356  LGAK  359



>ref|XP_011081284.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=358

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEI  + EEP +    +GV     EK+ GQ+D GDA KD+   E E KEPE+KE+TL+E
Sbjct  183  TDEIVQDTEEPDS----EGVKNVESEKRSGQDDVGDANKDTSAKEQEEKEPEEKEMTLEE  238

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+LA +  ERKV LDKE ESM LL+NKKNDD+VF+KLGS  +DK+KEA E
Sbjct  239  YEKVLEEKRKALLALKSRERKVDLDKELESMQLLSNKKNDDDVFIKLGS-DKDKRKEAAE  297

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KK+ SINEFLKPAEGE   +  G  R         G  G N    + P+IEDVGQFP+
Sbjct  298  KAKKSVSINEFLKPAEGE---KYYGAVRRGRGHGRGRGGYGGNNYDLQAPAIEDVGQFPS  354

Query  219  LGSK  208
            L +K
Sbjct  355  LVAK  358



>ref|XP_011081282.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Sesamum indicum]
Length=343

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 134/178 (75%), Gaps = 8/178 (4%)
 Frame = -1

Query  741  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLE  562
            E EEP     N+GV     EKQ G++D  DA KDS  +E E KEPE+KE+TL+EYEK+LE
Sbjct  174  ETEEP----TNEGVKNVDSEKQSGEDDVIDANKDSSANEQEEKEPEEKEMTLEEYEKVLE  229

Query  561  EKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK  382
            EKRKA+LA + EERKV LDKE ESM LL+NKKNDDEVF+KLGS  +DK+KEA EK KK+ 
Sbjct  230  EKRKALLALKSEERKVGLDKELESMQLLSNKKNDDEVFIKLGS-DKDKRKEAAEKAKKSV  288

Query  381  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            SINEFLKPAEG+ YYR GGRGRGRG G G  G    N  + E P+IEDVGQFP+L +K
Sbjct  289  SINEFLKPAEGDKYYRAGGRGRGRGRGRGGFGG---NNYNVEAPAIEDVGQFPSLVAK  343



>ref|XP_009607515.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=337

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 134/178 (75%), Gaps = 8/178 (4%)
 Frame = -1

Query  741  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLE  562
            E EEP+N    +G      EK   Q DA DA KDSP  EP+ KEPE+KE+TL+EYEKLLE
Sbjct  168  EKEEPLN----EGEKIVDTEKPAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLE  223

Query  561  EKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK  382
            +KRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KLGS ++DK+KEA EK KKTK
Sbjct  224  DKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKLGS-EKDKRKEAVEKAKKTK  282

Query  381  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            SINEFLKPA+G +YYR GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  283  SINEFLKPADGGSYYRRGGRGRGGRDHGRDGVVGNNSVSA---PSIEDVRQFPSLGAK  337



>ref|XP_009766508.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=369

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 138/187 (74%), Gaps = 8/187 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE EEP    V +G      EK  G+EDAGDAKKDS    PE KEPE+KE+TL+E
Sbjct  188  TDEIAPETEEP----VTEGEKIVDPEKPAGEEDAGDAKKDSSAAAPEEKEPEEKEMTLEE  243

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEKLLEEKRKA+LA +PEERKV LDKEFESM LL+NKKN+D+VF+KLG+ ++DK+KEA E
Sbjct  244  YEKLLEEKRKALLAQKPEERKVNLDKEFESMQLLSNKKNEDDVFIKLGA-EKDKRKEAVE  302

Query  399  kvkktKSINEFLKPAEGE---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
            K KKTKSINEFLKPAEGE        GGRG     G G  G  G N  S E P IEDVGQ
Sbjct  303  KAKKTKSINEFLKPAEGENYYRGRGRGGRGGRGRGGYGGNGGNGGNNYSVEAPKIEDVGQ  362

Query  228  FPTLGSK  208
            FP+LG+K
Sbjct  363  FPSLGAK  369



>ref|XP_009594553.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana tomentosiformis]
Length=365

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 139/184 (76%), Gaps = 5/184 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE EEP      +G      EK  G+EDAGDAKKDS + EPE KEPE+KE+TL+E
Sbjct  187  TDEIAPETEEP----AAEGEKIVDSEKPAGEEDAGDAKKDSSVAEPEEKEPEEKEMTLEE  242

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEKLLEEKRKA+LA +PEERKV LDKEFESM LL+NKKN+D+VF+KLG+ ++DK+KEA E
Sbjct  243  YEKLLEEKRKALLAQKPEERKVNLDKEFESMQLLSNKKNEDDVFIKLGA-EKDKRKEAVE  301

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KKTKSINEFLKPAEG  YYR  GRG     G G     G N  S E P IEDVGQFP+
Sbjct  302  KAKKTKSINEFLKPAEGGNYYRGRGRGGRGRGGRGGYEGNGGNNYSVEAPKIEDVGQFPS  361

Query  219  LGSK  208
            LG+K
Sbjct  362  LGAK  365



>ref|XP_010677113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Beta vulgaris subsp. vulgaris]
 emb|CAC85228.1| salt tolerance protein 2 [Beta vulgaris]
Length=356

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 129/185 (70%), Gaps = 9/185 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE EEP+  V N+     A +K  G+ +  DA+K+S   E    EPE+KE+TL+E
Sbjct  178  TDEIAPETEEPV--VENEAAV--AADKPAGEGENVDAEKESQEKEVVEAEPEEKEMTLEE  233

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedkkkea  406
            YEK+LEEKRKA+L+ + EERKV LDKEFESM L++ KKNDDEVF+KLGS  +K  +  E 
Sbjct  234  YEKVLEEKRKALLSLKGEERKVDLDKEFESMQLVSKKKNDDEVFIKLGSDKDKRKEAAER  293

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             E+ KK+ SINEFLKPAEG+ Y+R G      G G   GGYG NN S+   PSIED  QF
Sbjct  294  EERSKKSVSINEFLKPAEGDGYHRRGRGRGRGGRGGYGGGYGMNNASA---PSIEDPNQF  350

Query  225  PTLGS  211
            P+LG+
Sbjct  351  PSLGA  355



>ref|XP_009772173.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=356

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 140/184 (76%), Gaps = 8/184 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             DE+APE EEP    VN+G      EKQ  Q DA DA KDSP  EP+ KEPE+KE+TL+E
Sbjct  181  ADELAPEKEEP----VNEGEKIVVTEKQAVQADAEDASKDSPAAEPQEKEPEEKEMTLEE  236

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEKLLEEKRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KLGS ++DK+KEA E
Sbjct  237  YEKLLEEKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKLGS-EKDKRKEAVE  295

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  220
            K KKTKSINEFLKPA+GE+YY  GGRGRG       G  G N+ S+   PSIEDV QFP+
Sbjct  296  KAKKTKSINEFLKPADGESYYGRGGRGRGGRDRGRDGFVGNNSVSA---PSIEDVRQFPS  352

Query  219  LGSK  208
            LG+K
Sbjct  353  LGAK  356



>ref|XP_004244706.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum lycopersicum]
Length=340

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 110/139 (79%), Gaps = 5/139 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             D+IAPE E P    V DG      EKQ GQEDAGD  KDS   EPE KEPE+KE+TL+E
Sbjct  187  ADDIAPETEVP----VVDGEKIVEAEKQTGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEE  242

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+ ++DKKKEA E
Sbjct  243  YEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVE  301

Query  399  kvkktKSINEFLKPAEGET  343
            K KKT++INEFLKPAEGE+
Sbjct  302  KAKKTQTINEFLKPAEGES  320



>ref|XP_010258760.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=358

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EK  G+E+AGDA K++P +EPE KEPEDKE+TLDEYEK+LEEKRKA+ A + EERKV LD
Sbjct  197  EKPVGEEEAGDANKENPTNEPEEKEPEDKEMTLDEYEKVLEEKRKALQALKTEERKVNLD  256

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrp  331
            K+FESM  LANKK +D+VF+KLGS+K+ +K   +  E+ KK+ SINEFLKP+EGE YY P
Sbjct  257  KDFESMQQLANKKGNDDVFIKLGSDKDKRKDNTDKEERAKKSVSINEFLKPSEGEKYYNP  316

Query  330  ggrgrgrghgsgrggygGNNTSSFET-PSIEDVGQFPTLGSK  208
            GGRGRGRG    +GG+GG N +S E  PSI D GQFPTLG K
Sbjct  317  GGRGRGRGGRGSKGGFGGGNMTSNEVAPSIGDPGQFPTLGGK  358



>ref|XP_002303373.2| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|EEE78352.2| nuclear RNA-binding family protein [Populus trichocarpa]
Length=361

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 128/189 (68%), Gaps = 10/189 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE E+P   VV++  N    EKQ G+EDA DA KD+  ++PE KEPE+KE+TL+E
Sbjct  178  TDEIAPETEDP---VVDNEKNV-ITEKQQGEEDAADANKDT-AEKPEEKEPEEKEMTLEE  232

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+L  + EERKV LDK+ + M  L++KK++DE+F+KLGSEK+ +K  A +
Sbjct  233  YEKVLEEKRKALLDLKTEERKVGLDKDLQCMQQLSSKKSNDEIFIKLGSEKDKRKDAADK  292

Query  399  --kvkktKSINEFLKPAEGETy---yrpggrgrgrghgsgrggygGNNTSSFETPSIEDV  235
              + KK  SINEFLKPAEGE      R G        G G G   G+N      PSIED 
Sbjct  293  EDRAKKAVSINEFLKPAEGERSYNSGRGGRGRGRGRGGYGSGSGYGSNARDVAAPSIEDP  352

Query  234  GQFPTLGSK  208
            GQFP+LG K
Sbjct  353  GQFPSLGGK  361



>ref|XP_010661405.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Vitis vinifera]
 emb|CBI16673.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 137/186 (74%), Gaps = 6/186 (3%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE++   EE    VVN+G      EK  G+ED  D  K++P++EPE KEPE+KE+TL+E
Sbjct  180  TDELSGVTEE----VVNEGEKNLGAEKPVGEEDVADGNKENPVNEPEEKEPEEKEMTLEE  235

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEE+RKA+   + EERKV +DKEF+SM  L++KK +D++F+KLGS+K+ +K+ A +
Sbjct  236  YEKVLEERRKALQTLKTEERKVDVDKEFKSMQQLSSKKGNDDIFIKLGSDKDKRKEAAEK  295

Query  399  --kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
              + KK  SINEFLKPAEGE +Y PGGRGRGRG GS  G  GGN  S+   PSIED GQF
Sbjct  296  EERAKKAVSINEFLKPAEGERFYSPGGRGRGRGRGSRGGYGGGNAMSNVAAPSIEDPGQF  355

Query  225  PTLGSK  208
            PTLG+K
Sbjct  356  PTLGAK  361



>ref|XP_011031954.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=362

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 124/189 (66%), Gaps = 9/189 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeL--TL  586
            TDEI PE E+P   VV++  N    EKQ G+E+A DA KD+   EPE KE E +E   TL
Sbjct  178  TDEIVPETEDP---VVDNEKNV-ITEKQQGEENAADANKDTAEKEPEEKEKEPEEKEMTL  233

Query  585  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkea  406
            +EYEK+LEEKRKA+LA + EERKV LDK+ + M  L++KK++DE+F+KLGSEK+ +K  A
Sbjct  234  EEYEKVLEEKRKALLALKTEERKVGLDKDLQCMQQLSSKKSNDEIFIKLGSEKDKRKDAA  293

Query  405  ge--kvkktKSINEFLKPAEGE-TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDV  235
             +  + KK  SINEFLKPAEGE +Y    G         G G   G+N      PSIED 
Sbjct  294  DKEDRAKKAVSINEFLKPAEGERSYNPGRGGRGRGRGRGGYGSGYGSNARDVAAPSIEDP  353

Query  234  GQFPTLGSK  208
            GQFP+LG K
Sbjct  354  GQFPSLGGK  362



>gb|KDP39931.1| hypothetical protein JCGZ_03462 [Jatropha curcas]
Length=366

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 122/186 (66%), Gaps = 9/186 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA E EEP+  +  + V     EK  G+EDA DA K+SP DEPE K  + +  TL+E
Sbjct  188  TDEIAQETEEPVTEIEKNVV----AEKPSGEEDAADANKESPADEPEEKVEDKEM-TLEE  242

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+L+S+ EERKV ++KEF SM  L+NKK +D++F+KLGSEK+ +K  A +
Sbjct  243  YEKILEEKRKALLSSKTEERKVDVEKEFGSMLQLSNKKGNDDIFIKLGSEKDKRKDAADK  302

Query  399  --kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
              + KK+ SI EFLKPA+GE      G          RGGY G N      PSIED GQF
Sbjct  303  EDRAKKSVSITEFLKPADGE--KYYSGGRGRGRGRGSRGGYVGGNARDVAAPSIEDRGQF  360

Query  225  PTLGSK  208
            P+LG K
Sbjct  361  PSLGGK  366



>gb|EYU19470.1| hypothetical protein MIMGU_mgv1a008507mg [Erythranthe guttata]
Length=371

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 133/185 (72%), Gaps = 8/185 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGV-VNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLD  583
            T++IAPE EEP + V + D       EK  G+EDA DA KDSP ++ E +  E+KE+TL+
Sbjct  194  TEDIAPETEEPASEVKIVDP------EKPSGEEDAVDANKDSPKEQEEKEPEEEKEMTLE  247

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeag  403
            EYEK+ EEKRKA+L+ + EERKV LDKE E+M LL+ KKNDDEVF+KLGS  +DK+KEA 
Sbjct  248  EYEKVREEKRKALLSLKSEERKVNLDKELEAMQLLSTKKNDDEVFIKLGS-DKDKRKEAA  306

Query  402  ekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            EK KK+ SINEFLKPAEGE YYR GGRG     G GR G  G + +    P+I DVGQFP
Sbjct  307  EKAKKSVSINEFLKPAEGENYYRGGGRGGRGRGGRGREGGFGRSNAGERAPAIGDVGQFP  366

Query  222  TLGSK  208
            +LG K
Sbjct  367  SLGGK  371



>ref|XP_007052330.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
 gb|EOX96487.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
Length=267

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 131/188 (70%), Gaps = 12/188 (6%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   EE    VVN+       EK  G+EDAGDA K+SP +EPE KEPEDKE+TL+E
Sbjct  88   TDELAQVTEE----VVNESEKNLGDEKPAGEEDAGDASKESPTNEPEEKEPEDKEMTLEE  143

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+ A + EERKV   KEF +M  L+NKK++DEVF+KLGSEK+ +K+    
Sbjct  144  YEKVLEEKRKALQALKTEERKVDA-KEFATMQQLSNKKSNDEVFIKLGSEKDKRKEAFDK  202

Query  405  gekvkktKSINEFLKPAEGETyy--rpggrgrgrghgsgrggygGNNTSSFETPSIEDVG  232
             E+ KK+ SINEFLKPAEGE YY     GRGRGRG     GG    N S+   PSIED G
Sbjct  203  EERAKKSVSINEFLKPAEGERYYNPSGRGRGRGRGSRGFGGGSAAGNVSA---PSIEDPG  259

Query  231  QFPTLGSK  208
            QFPTLG K
Sbjct  260  QFPTLGGK  267



>ref|XP_010275458.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=359

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 124/187 (66%), Gaps = 11/187 (6%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEI  E EE     +         EK  G+++ GD  K++P++EPE KEPEDKE+TLDE
Sbjct  181  TDEIVQETEEVEKTTIT--------EKTGGEDETGDTNKENPVNEPEEKEPEDKEMTLDE  232

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+ A + EERKV LDK+FESM  LA+KK +D+VF+KLGSEK+ +K+    
Sbjct  233  YEKVLEEKRKALQALKTEERKVNLDKDFESMQQLASKKGNDDVFIKLGSEKDKRKEAIDK  292

Query  405  gekvkktKSINEFLKPAE-GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
             E+ KK+ SINEFLKPAE G  Y   G      G GS  G  G N  S+   PSIED GQ
Sbjct  293  EERTKKSVSINEFLKPAEGGRYYSPGGRGRGRGGRGSRGGFSGVNQASNVVAPSIEDPGQ  352

Query  228  FPTLGSK  208
            FPTLG K
Sbjct  353  FPTLGGK  359



>ref|XP_002266051.1| PREDICTED: uncharacterized protein DDB_G0288133 [Vitis vinifera]
 emb|CBI29539.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 129/185 (70%), Gaps = 10/185 (5%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            DEIAPE EEPIN       NT A EKQ G+E A DA K++P++E E KEPEDKE+TL+EY
Sbjct  187  DEIAPENEEPINETEK---NTSA-EKQLGEEIAADANKENPVNESEEKEPEDKEMTLEEY  242

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keag  403
            +K+LEEKRKA+LA + EERKV + K+FE+M  L++KK++D+VF+KLGSEK+ +K   +  
Sbjct  243  QKVLEEKRKALLALKTEERKVDV-KDFEAMQQLSSKKDNDDVFIKLGSEKDKRKELADKE  301

Query  402  ekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            E+ KK+ SINEFLKPA      R  G          RGG+ GN  S+   PSIED GQFP
Sbjct  302  ERAKKSVSINEFLKPA---EGERYYGGRGRGRGRGTRGGFAGNTYSNVAAPSIEDPGQFP  358

Query  222  TLGSK  208
            TLG K
Sbjct  359  TLGGK  363



>emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera]
Length=363

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 129/185 (70%), Gaps = 10/185 (5%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            DEIAPE EEPIN       NT A EKQ G+E A DA K++P++E E KEPEDKE+TL+EY
Sbjct  187  DEIAPENEEPINETEK---NTSA-EKQLGEEIAADANKENPVNESEEKEPEDKEMTLEEY  242

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keag  403
            +K+LEEKRKA+LA + EERKV + K+FE+M  L++KK++D+VF+KLGSEK+ +K   +  
Sbjct  243  QKVLEEKRKALLALKTEERKVDV-KDFEAMQQLSSKKDNDDVFIKLGSEKDKRKELADKE  301

Query  402  ekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            E+ KK+ SINEFLKPA      R  G          RGG+ GN  S+   PSIED GQFP
Sbjct  302  ERAKKSVSINEFLKPA---EGERYYGGRGRGCGRGTRGGFAGNTYSNVAAPSIEDPGQFP  358

Query  222  TLGSK  208
            TLG K
Sbjct  359  TLGGK  363



>ref|XP_007052327.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052328.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052329.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96484.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96485.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96486.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
Length=375

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 124/186 (67%), Gaps = 8/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   EE    VVN+       EK  G+EDAGDA K+SP +EPE KEPEDKE+TL+E
Sbjct  196  TDELAQVTEE----VVNESEKNLGDEKPAGEEDAGDASKESPTNEPEEKEPEDKEMTLEE  251

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+ A + EERKV   KEF +M  L+NKK++DEVF+KLGSEK+ +K+    
Sbjct  252  YEKVLEEKRKALQALKTEERKVDA-KEFATMQQLSNKKSNDEVFIKLGSEKDKRKEAFDK  310

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             E+ KK+ SINEFLKPAEGE  Y              RG  GG+   +   PSIED GQF
Sbjct  311  EERAKKSVSINEFLKPAEGE-RYYNPSGRGRGRGRGSRGFGGGSAAGNVSAPSIEDPGQF  369

Query  225  PTLGSK  208
            PTLG K
Sbjct  370  PTLGGK  375



>gb|KJB37651.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=306

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 125/185 (68%), Gaps = 8/185 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KE+TL+E
Sbjct  129  TDGIAPETEEN----VPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEE  184

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E
Sbjct  185  YEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKE  243

Query  399  kv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            +  KK+ SINEFLKPAEGE     G           RGGYGGN  SS   PSIED G FP
Sbjct  244  ERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFP  301

Query  222  TLGSK  208
            +LG K
Sbjct  302  SLGGK  306



>gb|KJB37648.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 125/185 (68%), Gaps = 8/185 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KE+TL+E
Sbjct  179  TDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEE  234

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E
Sbjct  235  YEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKE  293

Query  399  kv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            +  KK+ SINEFLKPAEGE     G           RGGYGGN  SS   PSIED G FP
Sbjct  294  ERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFP  351

Query  222  TLGSK  208
            +LG K
Sbjct  352  SLGGK  356



>ref|XP_007039722.1| Hyaluronan / mRNA binding family [Theobroma cacao]
 gb|EOY24223.1| Hyaluronan / mRNA binding family [Theobroma cacao]
Length=358

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 128/185 (69%), Gaps = 8/185 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE E  +N V  +  N  A EKQ G+ED  DA K++  +EPE KEPE+KE+TL+E
Sbjct  181  TDEIAPETE--VN-VPENEKNVGA-EKQSGEEDVVDASKENAANEPEEKEPENKEMTLEE  236

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+L+EKRKA+LA + EERKV + KEFESM  L+NKK++D++F+KLGSEK+ +K    E
Sbjct  237  YEKILDEKRKALLALKTEERKVDV-KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKE  295

Query  399  kv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            +  KK+ SINEFLKPAEGE YY PG          G  G      S+   P+IED GQFP
Sbjct  296  ERVKKSVSINEFLKPAEGERYYGPGRGRGRGRGPRGGYGGIAG--SNVPAPAIEDRGQFP  353

Query  222  TLGSK  208
            TLG K
Sbjct  354  TLGGK  358



>gb|KJB37646.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=357

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 125/185 (68%), Gaps = 8/185 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KE+TL+E
Sbjct  180  TDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEE  235

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E
Sbjct  236  YEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKE  294

Query  399  kv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            +  KK+ SINEFLKPAEGE     G           RGGYGGN  SS   PSIED G FP
Sbjct  295  ERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFP  352

Query  222  TLGSK  208
            +LG K
Sbjct  353  SLGGK  357



>gb|AEI59279.1| RNA binding protein [Suaeda glauca]
Length=359

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 136/185 (74%), Gaps = 9/185 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE+ EP+  V N+ V  D  EK  G E+    +K++P  E E  EPE+K++TL+E
Sbjct  181  TDEIAPESGEPV--VENEAVAAD--EKPSGDENVV-VEKENPEKEAEETEPEEKQMTLEE  235

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            Y+K+LEEKRKA+LA + EERKV LDK+FESM L++ KKNDDEVF+KLGS+K+ +K+ A +
Sbjct  236  YQKVLEEKRKALLALKAEERKVDLDKDFESMQLVSKKKNDDEVFIKLGSDKDKRKEAAEK  295

Query  399  --kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
              + KK+ SINEFL+PAEG+ +YR GGRGR RG   G GG  G N +S   PSIED  QF
Sbjct  296  DERAKKSVSINEFLRPAEGDGHYRRGGRGRSRGGRGGYGGGYGMNNAS--APSIEDPSQF  353

Query  225  PTLGS  211
            P+LG+
Sbjct  354  PSLGA  358



>ref|XP_009772180.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=334

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 135/178 (76%), Gaps = 8/178 (4%)
 Frame = -1

Query  741  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLE  562
            E EEP    VN+G      EKQ  Q DA DA KDSP  EP+ KEPE+KE+TL+EYEKLLE
Sbjct  165  EKEEP----VNEGEKIVVTEKQAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLE  220

Query  561  EKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK  382
            EKRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KLGS ++DK+KEA EK KKTK
Sbjct  221  EKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKLGS-EKDKRKEAVEKAKKTK  279

Query  381  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            SINEFLKPA+GE+YY  GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  280  SINEFLKPADGESYYGRGGRGRGGRDRGRDGFVGNNSVSA---PSIEDVRQFPSLGAK  334



>gb|KDO57096.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=364

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 137/187 (73%), Gaps = 9/187 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KE+TL+E
Sbjct  184  TDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEE  238

Query  579  YEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGSe--kedkkke  409
            YEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GSE  K     +
Sbjct  239  YEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAAD  298

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
              EK KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQ
Sbjct  299  KEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQ  357

Query  228  FPTLGSK  208
            FP+LG K
Sbjct  358  FPSLGGK  364



>ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Citrus sinensis]
Length=364

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 140/187 (75%), Gaps = 9/187 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KE+TL+E
Sbjct  184  TDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEE  238

Query  579  YEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeag  403
            YEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A 
Sbjct  239  YEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAAD  298

Query  402  e--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
            +  K KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQ
Sbjct  299  KEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQ  357

Query  228  FPTLGSK  208
            FP+LG K
Sbjct  358  FPSLGGK  364



>ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53445.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=364

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 138/187 (74%), Gaps = 9/187 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KE+TL+E
Sbjct  184  TDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEE  238

Query  579  YEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGSe--kedkkke  409
            YEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GSE  K     +
Sbjct  239  YEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAAD  298

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
              EK KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  ++S+   P IED GQ
Sbjct  299  KEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSSSAA-APKIEDPGQ  357

Query  228  FPTLGSK  208
            FP+LG K
Sbjct  358  FPSLGGK  364



>ref|XP_011093236.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Sesamum indicum]
Length=376

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAG-DAKKDSPldepevkepedkeLTLD  583
            TDE+A EAE  + G    G+N    EK  G+EDA  D   ++  +E   KEPE+KE+TL+
Sbjct  195  TDELAQEAEG-VGGEAEKGLNA---EKPSGEEDAAADGDNEAAKNEVGEKEPENKEMTLE  250

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--ke  409
            EYEK+LEEKRKA+ A + EERKV + KEFES+  L+NKK +D+VF+KLGSEK+ K+   E
Sbjct  251  EYEKVLEEKRKALQALKTEERKVDV-KEFESLKPLSNKKTNDDVFIKLGSEKDKKRELAE  309

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
              E+ KK  SINEFLKPAEGE YY PGGRGRGRG GS  G  GGN  S+ + PSIED GQ
Sbjct  310  KEERAKKAVSINEFLKPAEGERYYNPGGRGRGRGRGSRGGYSGGNEMSNVKAPSIEDPGQ  369

Query  228  FPTLGSK  208
            FPTLG K
Sbjct  370  FPTLGGK  376



>ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
 gb|EEF30592.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
Length=364

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 129/187 (69%), Gaps = 11/187 (6%)
 Frame = -1

Query  759  TDEIAPEAEEP-INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLD  583
             DEIAPE EEP I    N G+     EK  G+E A DA KD+P++E E KEPEDKE+TL+
Sbjct  186  ADEIAPEIEEPLIENEKNIGI-----EKPSGEEGAADANKDNPMNELEEKEPEDKEMTLE  240

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeag  403
            EYEKL EE++K++  S+ EERKV ++KEF +M  L+NKK  DE+F+KLGSEK+ +K  A 
Sbjct  241  EYEKLREERKKSLSLSKAEERKVDVEKEFGTMLQLSNKKGSDEIFIKLGSEKDKRKDAAD  300

Query  402  e--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
            +  + KK  SINEFLKPAEGE Y+   GRGRGRG   G G     + ++   PSIED GQ
Sbjct  301  KEDRAKKAVSINEFLKPAEGERYFGGRGRGRGRGSRGGYGLGSARDVAA---PSIEDRGQ  357

Query  228  FPTLGSK  208
            FPTLG K
Sbjct  358  FPTLGGK  364



>gb|KJB37647.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD IAPE EE     V +     + EKQ G+EDA DA K++       ++  + ++TL+E
Sbjct  180  TDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKEN-AANEAEEKEPENKMTLEE  234

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E
Sbjct  235  YEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKE  293

Query  399  kv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            +  KK+ SINEFLKPAEGE     G           RGGYGGN  SS   PSIED G FP
Sbjct  294  ERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFP  351

Query  222  TLGSK  208
            +LG K
Sbjct  352  SLGGK  356



>ref|XP_008369209.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Malus domestica]
Length=359

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EKQ G+ +A DA K+  ++E E KEPE+KE+TL+EY+K+LEEKRKA+LA + EERKV +D
Sbjct  199  EKQSGENEAADANKEDTVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVD  258

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrp  331
            K+ ++M LL+NKK +DE+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE Y+  
Sbjct  259  KDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYHGG  318

Query  330  ggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
             GRGRGRG   G  G  G  +S+   PSI D GQFP+LG K
Sbjct  319  RGRGRGRGPRGGYSGGPGGYSSNAAAPSIGDPGQFPSLGGK  359



>gb|KJB24880.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 120/186 (65%), Gaps = 8/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   EE    V N+G      EK  G+EDA DA K+S  +EPE KEPEDKE+TL+E
Sbjct  184  TDELAQVTEE----VANEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEE  239

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++DEVF+KLGS+K+ +K+    
Sbjct  240  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDR  298

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             E+ KK+ SINEFLKPAEGE  Y              RG  GGN       PSIED G F
Sbjct  299  EERAKKSVSINEFLKPAEGER-YYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHF  357

Query  225  PTLGSK  208
            P LG K
Sbjct  358  PILGGK  363



>gb|KJB37652.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=335

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 115/162 (71%), Gaps = 4/162 (2%)
 Frame = -1

Query  690  AFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVC  511
            + EKQ G+EDA DA K++  +E E KEPE+KE+TL+EYEK++EEKRKA+LA + EERKV 
Sbjct  177  SIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVD  236

Query  510  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyr  334
              KEFESM  L++KK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE    
Sbjct  237  T-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGER--Y  293

Query  333  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
             G           RGGYGGN  SS   PSIED G FP+LG K
Sbjct  294  YGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  335



>gb|KJB24881.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 120/186 (65%), Gaps = 8/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   EE    V N+G      EK  G+EDA DA K+S  +EPE KEPEDKE+TL+E
Sbjct  184  TDELAQVTEE----VANEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEE  239

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++DEVF+KLGS+K+ +K+    
Sbjct  240  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDR  298

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             E+ KK+ SINEFLKPAEGE  Y              RG  GGN       PSIED G F
Sbjct  299  EERAKKSVSINEFLKPAEGER-YYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHF  357

Query  225  PTLGSK  208
            P LG K
Sbjct  358  PILGGK  363



>gb|KHG17525.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=361

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 119/186 (64%), Gaps = 8/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   EE    V N G      EK  G+EDA DA K+S  +EPE KEPEDKE+TL+E
Sbjct  182  TDELAQVTEE----VANGGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEE  237

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++DEVF+KLGS+K+ +K+    
Sbjct  238  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDR  296

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             E+ KK+ SINEFLKPAEGE  Y              RG  GGN       PSIED G F
Sbjct  297  EERAKKSVSINEFLKPAEGER-YYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHF  355

Query  225  PTLGSK  208
            P LG K
Sbjct  356  PILGGK  361



>gb|KHG30709.1| hypothetical protein F383_14338 [Gossypium arboreum]
Length=353

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 114/162 (70%), Gaps = 4/162 (2%)
 Frame = -1

Query  690  AFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVC  511
              EKQ G+EDA DA K++  +E E KEPE+KE+TL+EYEK++EEKRKA+LA + EERKV 
Sbjct  195  GIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVD  254

Query  510  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyr  334
              KEFESM  L++KK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE    
Sbjct  255  T-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGER--Y  311

Query  333  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
             G           RGGYGGN  SS   PSIED G FP+LG K
Sbjct  312  YGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  353



>gb|KHG27284.1| hypothetical protein F383_11722 [Gossypium arboreum]
Length=354

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 122/185 (66%), Gaps = 9/185 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE E              + EKQ G+EDA DA K++  +E E KEPE+KE+TL+E
Sbjct  178  TDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKENAANETEEKEPENKEMTLEE  232

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D++F+KLGSEK+ +K    E
Sbjct  233  YEKILEEKRKALAALKTEGRKVDV-KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKE  291

Query  399  kv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            +  KK+ SINEFLKPAEGE     G           RGGYGGN  S+ + PSI D G FP
Sbjct  292  EKVKKSVSINEFLKPAEGER--YYGPGRGRGRSRGPRGGYGGNTASNVQAPSIADPGHFP  349

Query  222  TLGSK  208
            +LG K
Sbjct  350  SLGGK  354



>ref|XP_007134461.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
 gb|ESW06455.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
Length=359

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 117/165 (71%), Gaps = 7/165 (4%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EK  G+E A D  KDSP +E E KEPE+KE+TL+EYEK+LEE+RKA+ A + E RKV + 
Sbjct  196  EKPVGEESAADGNKDSPANENEEKEPEEKEMTLEEYEKVLEERRKALQALKTETRKVDI-  254

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSIN--EFLKPAEGE----T  343
            KEF SM  L+NKK++DE+F+KLGS+K+ +K    ++ +  KS+N  EFLKPAEGE    T
Sbjct  255  KEFASMQPLSNKKDNDEIFIKLGSDKDKRKDALEKEERSKKSVNITEFLKPAEGERYYNT  314

Query  342  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
              R  GRGRG G G G GGY GN  S+   PSIED GQFPTLG K
Sbjct  315  SGRGRGRGRGGGRGGGGGGYSGNAGSNVSAPSIEDPGQFPTLGGK  359



>gb|KJB25493.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=354

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 120/185 (65%), Gaps = 9/185 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE E              + EKQ G+EDA DA K++  +E E KEPE+KE+TL+E
Sbjct  178  TDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKENAANEAEEKEPENKEMTLEE  232

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D++F+KLGSEK+ +K    E
Sbjct  233  YEKILEEKRKALDALKTEGRKVDV-KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKE  291

Query  399  kvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            +  K   SINEFLKPAEGE     G           RGGYGGN  S+ + PSI D G FP
Sbjct  292  EKAKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYGGNTASNVQAPSIADPGHFP  349

Query  222  TLGSK  208
            +LG K
Sbjct  350  SLGGK  354



>gb|KDO57095.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=363

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 136/187 (73%), Gaps = 10/187 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KE+TL+E
Sbjct  184  TDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEE  238

Query  579  YEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGSe--kedkkke  409
            YEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K GSE  K     +
Sbjct  239  YEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIK-GSEKDKRKDAAD  297

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
              EK KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQ
Sbjct  298  KEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQ  356

Query  228  FPTLGSK  208
            FP+LG K
Sbjct  357  FPSLGGK  363



>gb|KJB24891.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=361

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 120/186 (65%), Gaps = 9/186 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   E     V N+G      EK  G+EDA +A K+S  +EPE KEPEDKE+TL+E
Sbjct  183  TDELAQVTE-----VTNEGERNLGDEKPAGEEDAREANKESASNEPEEKEPEDKEMTLEE  237

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKKN+DEVF+KLGS+K+ +K+    
Sbjct  238  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKNNDEVFIKLGSDKDKRKEAYEK  296

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             E+ KK+ SINEFLKPAEGE  Y              RG  GG+       PSIED G F
Sbjct  297  EERAKKSVSINEFLKPAEGER-YYNPSGRGRGRGRGSRGFGGGSAARDVAAPSIEDPGHF  355

Query  225  PTLGSK  208
            PTLG K
Sbjct  356  PTLGGK  361



>ref|XP_003521066.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IA   EE    VVN+     A EK  G+EDA +  KDSP +E E KEPEDKE+TL+EY
Sbjct  191  DDIAEVTEE----VVNETEKVLADEKPVGEEDAAEGNKDSPANENEEKEPEDKEMTLEEY  246

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek  397
            EK+LEEKRKA+ A + E RKV + KEF SM  L+NKK +DE+F+KLGS+K+ +K    ++
Sbjct  247  EKVLEEKRKALQAQKTEARKVDI-KEFASMQPLSNKKENDEIFIKLGSDKDKRKDALEKE  305

Query  396  vkktKSIN--EFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
             K  KS+N  EFLKPAEGE      G          RGGY GN  S+   PSIED G FP
Sbjct  306  EKSKKSVNITEFLKPAEGER--YYPGGRGRGRGRGSRGGYSGNAYSNAPAPSIEDPGHFP  363

Query  222  TLGSK  208
            +LG K
Sbjct  364  SLGGK  368



>gb|KHG05539.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=362

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 120/186 (65%), Gaps = 8/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD +A   EE    V N+G      EK  G+EDA DA K+S  +EPE KEPEDKE+TL+E
Sbjct  183  TDNLAQVTEE----VTNEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEE  238

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++DEVF+KLGS+K+ +K+    
Sbjct  239  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYEK  297

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             E+ KK+ SINEFLKPAEGE  Y              RG  GG+       PSIED G F
Sbjct  298  EERAKKSVSINEFLKPAEGER-YYNPSGRGRGRGRGSRGFGGGSAARDVAAPSIEDPGHF  356

Query  225  PTLGSK  208
            PTLG K
Sbjct  357  PTLGGK  362



>ref|XP_006398418.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
 gb|ESQ39871.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
Length=359

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 101/138 (73%), Gaps = 5/138 (4%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EEP   V    V     EKQ G++D  DAKKD+P DE E KE EDKE+TL+EY
Sbjct  173  DDIPPATEEPTTEVEKSPV----AEKQSGEDDTTDAKKDAPADEQEEKEAEDKEMTLEEY  228

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek  397
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK+++E+F+KLGSEK+ +  E  EK
Sbjct  229  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSNEEIFIKLGSEKDKRTTEKEEK  287

Query  396  vkktKSINEFLKPAEGET  343
             KK+ SINEFLKPA+GET
Sbjct  288  AKKSLSINEFLKPADGET  305



>ref|XP_007209289.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
 gb|EMJ10488.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
Length=360

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 133/186 (72%), Gaps = 7/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD+IA E EEP   +     N  A EKQ G+ +A DA K++ ++E E KEPE+KE+TL+E
Sbjct  180  TDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKENTVNESEEKEPEEKEMTLEE  235

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+LA + EERKV LDKE +SM  L+NKK ++++F+KLGSEK+ +K+ A +
Sbjct  236  YEKVLEEKRKALLALKTEERKVDLDKELKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEK  295

Query  399  --kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
              + KK+ SINEFLKPAEGE YY   GRGRGRG   G  G  G  + S   PSIED GQF
Sbjct  296  EERAKKSVSINEFLKPAEGERYYGGRGRGRGRGPRGGYSGGPGGYSGSA-APSIEDPGQF  354

Query  225  PTLGSK  208
            PTLG K
Sbjct  355  PTLGGK  360



>ref|XP_011093237.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Sesamum indicum]
Length=354

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 126/178 (71%), Gaps = 7/178 (4%)
 Frame = -1

Query  732  EPINGVVNDGVNTDAFEKQHGQEDAG-DAKKDSPldepevkepedkeLTLDEYEKLLEEK  556
            E + G    G+N    EK  G+EDA  D   ++  +E   KEPE+KE+TL+EYEK+LEEK
Sbjct  181  EGVGGEAEKGLNA---EKPSGEEDAAADGDNEAAKNEVGEKEPENKEMTLEEYEKVLEEK  237

Query  555  RKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keagekvkktK  382
            RKA+ A + EERKV + KEFES+  L+NKK +D+VF+KLGSEK+ K+   E  E+ KK  
Sbjct  238  RKALQALKTEERKVDV-KEFESLKPLSNKKTNDDVFIKLGSEKDKKRELAEKEERAKKAV  296

Query  381  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            SINEFLKPAEGE YY PGGRGRGRG GS  G  GGN  S+ + PSIED GQFPTLG K
Sbjct  297  SINEFLKPAEGERYYNPGGRGRGRGRGSRGGYSGGNEMSNVKAPSIEDPGQFPTLGGK  354



>ref|XP_008373667.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=365

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 132/190 (69%), Gaps = 13/190 (7%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTD---AFEKQHGQEDAGDAKKDSP-ldepevkepedkeL  592
            +D+IAPE EEP       G  T+     EKQ G+ +A DA KDS   +  E +  E+KE+
Sbjct  183  SDDIAPEIEEP-------GTETEKNFGAEKQSGENEAADANKDSTVNETEEKESEEEKEM  235

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+LA + EERKV +DK+ ++M LL+NKK +DE+F+KLGSEK+ +K+
Sbjct  236  TLEEYEKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKE  295

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             A +  + KK+ SIN+FLKPAEGE YY   GRGRGRG   G  G  G  +S+   PSIED
Sbjct  296  AAEKEERAKKSVSINQFLKPAEGERYYGGRGRGRGRGPRGGYSGGPGGYSSNVAAPSIED  355

Query  237  VGQFPTLGSK  208
             GQFP+LG K
Sbjct  356  PGQFPSLGGK  365



>gb|KDO57094.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=342

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 132/181 (73%), Gaps = 9/181 (5%)
 Frame = -1

Query  741  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLE  562
            E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KE+TL+EYEK+LE
Sbjct  168  ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLE  222

Query  561  EKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGSe--kedkkkeagekvk  391
            EKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GSE  K     +  EK K
Sbjct  223  EKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAK  282

Query  390  ktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  211
            K+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG 
Sbjct  283  KSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGG  341

Query  210  K  208
            K
Sbjct  342  K  342



>ref|XP_006477113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Citrus sinensis]
Length=342

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 135/181 (75%), Gaps = 9/181 (5%)
 Frame = -1

Query  741  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLE  562
            E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KE+TL+EYEK+LE
Sbjct  168  ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLE  222

Query  561  EKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvk  391
            EKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K K
Sbjct  223  EKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAK  282

Query  390  ktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  211
            K+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG 
Sbjct  283  KSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGG  341

Query  210  K  208
            K
Sbjct  342  K  342



>ref|XP_006440206.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 ref|XP_006440207.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53446.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53447.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=342

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 136/181 (75%), Gaps = 9/181 (5%)
 Frame = -1

Query  741  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLE  562
            E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KE+TL+EYEK+LE
Sbjct  168  ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLE  222

Query  561  EKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvk  391
            EKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K K
Sbjct  223  EKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAK  282

Query  390  ktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  211
            K+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  ++S+   P IED GQFP+LG 
Sbjct  283  KSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSSSAA-APKIEDPGQFPSLGG  341

Query  210  K  208
            K
Sbjct  342  K  342



>gb|KDO57093.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=335

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 108/141 (77%), Gaps = 8/141 (6%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KE+TL+E
Sbjct  184  TDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEE  238

Query  579  YEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGSe--kedkkke  409
            YEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GSE  K     +
Sbjct  239  YEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAAD  298

Query  408  agekvkktKSINEFLKPAEGE  346
              EK KK+ SINEFLKPAEGE
Sbjct  299  KEEKAKKSVSINEFLKPAEGE  319



>gb|KJB25494.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=353

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 114/185 (62%), Gaps = 10/185 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIAPE E              + EKQ G+EDA DA K++       ++  + ++TL+E
Sbjct  178  TDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKEN-AANEAEEKEPENKMTLEE  231

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D++F+KLGSEK+ +K    E
Sbjct  232  YEKILEEKRKALDALKTEGRKVDV-KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKE  290

Query  399  kvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  223
            +  K   SINEFLKPAEGE     G           RGGYGGN  S+ + PSI D G FP
Sbjct  291  EKAKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYGGNTASNVQAPSIADPGHFP  348

Query  222  TLGSK  208
            +LG K
Sbjct  349  SLGGK  353



>gb|ABK94426.1| unknown [Populus trichocarpa]
Length=370

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L++KK++DE+F+KLGSEK+ +K 
Sbjct  245  TLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNDEIFIKLGSEKDKRKD  304

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             A +  + KK  SINEFLKPA G+ YY PG          G GG    NT   E PSIED
Sbjct  305  AADKEDRAKKAVSINEFLKPAGGDRYYNPGRGRGRGRGRGGYGG----NTRDVEAPSIED  360

Query  237  VGQFPTLGSK  208
             GQFPTLG K
Sbjct  361  PGQFPTLGGK  370



>ref|XP_006368965.1| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|ERP65534.1| nuclear RNA-binding family protein [Populus trichocarpa]
Length=374

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L++KK++DE+F+KLGSEK+ +K 
Sbjct  249  TLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNDEIFIKLGSEKDKRKD  308

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             A +  + KK  SINEFLKPA G+ YY PG          G GG    NT   E PSIED
Sbjct  309  AADKEDRAKKAVSINEFLKPAGGDRYYNPGRGRGRGRGRGGYGG----NTRDVEAPSIED  364

Query  237  VGQFPTLGSK  208
             GQFPTLG K
Sbjct  365  PGQFPTLGGK  374



>ref|XP_008238397.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Prunus mume]
Length=360

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 122/186 (66%), Gaps = 7/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD+IA E EEP   +     N  A EKQ G+ +A DA K++ ++E E KE E+KE+TL+E
Sbjct  180  TDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKENTVNESEEKELEEKEMTLEE  235

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+LA + EERKV LDK+ +SM  L+NKK ++++F+KLGSEK+ +K+ A +
Sbjct  236  YEKVLEEKRKALLALKTEERKVDLDKDLKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEK  295

Query  399  --kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
              + KK+ SINEFLKPAE    Y  G          G  G G    S    PSIED GQF
Sbjct  296  EERAKKSVSINEFLKPAE-GERYYGGRGRGRGRGPRGGYGGGPGGYSGSAAPSIEDPGQF  354

Query  225  PTLGSK  208
            PTLG K
Sbjct  355  PTLGGK  360



>ref|XP_008238398.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Prunus mume]
Length=359

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 122/186 (66%), Gaps = 7/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD+IA E EEP   +     N  A EKQ G+ +A DA K++ ++E E KE E+KE+TL+E
Sbjct  179  TDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKENTVNESEEKELEEKEMTLEE  234

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+LA + EERKV LDK+ +SM  L+NKK ++++F+KLGSEK+ +K+ A +
Sbjct  235  YEKVLEEKRKALLALKTEERKVDLDKDLKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEK  294

Query  399  --kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
              + KK+ SINEFLKPAE    Y  G          G  G G    S    PSIED GQF
Sbjct  295  EERAKKSVSINEFLKPAE-GERYYGGRGRGRGRGPRGGYGGGPGGYSGSAAPSIEDPGQF  353

Query  225  PTLGSK  208
            PTLG K
Sbjct  354  PTLGGK  359



>ref|XP_009368154.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Pyrus x bretschneideri]
Length=362

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EKQ G+ +A DA K+  ++E E KEPE+KE+TL+EY+K+LEEKRKA+LA + EERKV +D
Sbjct  202  EKQSGENEAADANKEDAVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVD  261

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrp  331
            K+ ++M LL+NKK +DE+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY  
Sbjct  262  KDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYGG  321

Query  330  ggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
             GRGRGRG   G  G  G  +S+   PSI D GQFP+LG K
Sbjct  322  RGRGRGRGPRGGYSGGPGGYSSNAAAPSIGDPGQFPSLGGK  362



>ref|XP_003529036.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 108/163 (66%), Gaps = 5/163 (3%)
 Frame = -1

Query  690  AFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVC  511
            A EK  G+EDA +  KD P +E E KEPEDKE+TL+EYEK+LEEKRKA+ A + E RKV 
Sbjct  209  ADEKPAGEEDAPEGNKDCPANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEVRKVD  268

Query  510  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSIN--EFLKPAEGETyy  337
            + KEF SM  L+NKK +DE+F+KLGS+K+ +K    ++ K  KS+N  EFLKPAEGE   
Sbjct  269  I-KEFASMQPLSNKKENDEIFIKLGSDKDKRKDALEKEEKSKKSVNITEFLKPAEGER--  325

Query  336  rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
               G          RGGY GN  S+   PSIED GQFPTL  K
Sbjct  326  YYSGGRGRGRGRGSRGGYSGNAYSNVPAPSIEDPGQFPTLSGK  368



>ref|XP_009343931.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=367

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 130/190 (68%), Gaps = 13/190 (7%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTD---AFEKQHGQEDAGDAKKDSP-ldepevkepedkeL  592
            +D+IAPE EEP       G  T+     EKQ G+ +  DA KDS   +  E +  E+KE+
Sbjct  185  SDDIAPEIEEP-------GTETEKNVGAEKQSGENETADANKDSTVNETEEKEPEEEKEM  237

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+LA + EERKV +DK+ ++M LL+NKK +DE+F+KLGSEK+ +K+
Sbjct  238  TLEEYEKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKE  297

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             A +  + KK+ SIN+FLKP EGE YY   GRGRGRG   G  G  G  +S+   PSIED
Sbjct  298  AAEKEERAKKSVSINQFLKPTEGERYYGGRGRGRGRGPRGGYSGGPGGYSSNVAAPSIED  357

Query  237  VGQFPTLGSK  208
             GQFP+LG K
Sbjct  358  PGQFPSLGGK  367



>ref|XP_006853790.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
 gb|ERN15257.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
Length=403

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 122/166 (73%), Gaps = 9/166 (5%)
 Frame = -1

Query  684  EKQHGQEDAGDA--KKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVC  511
            EKQ  QED  DA  +K++ ++EPE KEPEDKE+TL+EYEK+ EEKRKA+LA +PEERKV 
Sbjct  222  EKQPEQEDGVDAGKEKENAVNEPEEKEPEDKEMTLEEYEKVREEKRKALLAMKPEERKVD  281

Query  510  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv----kktKSINEFLKPAEGET  343
            +DKEF+SM  L+ KK +D++F+KLGS+K+  +++   +     KK+ SINEFLKPAEGE 
Sbjct  282  VDKEFKSMQQLSLKKGNDDIFIKLGSDKDSNRRKDSAEKDERVKKSLSINEFLKPAEGEK  341

Query  342  yyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLG  214
            YY PGGRGRGRG G   G  GG   SS      PSIED GQFPTLG
Sbjct  342  YYSPGGRGRGRGRGDRGGYRGGYTGSSANVALAPSIEDPGQFPTLG  387



>ref|XP_011047584.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=364

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 85/130 (65%), Gaps = 6/130 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L++KK++ E+F+KLGSEK+ +K 
Sbjct  239  TLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNAEIFIKLGSEKDKRKD  298

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             A +  + KK  SINEFLKPA G+                   G  G NT   E PSIED
Sbjct  299  AADKEDRAKKAVSINEFLKPAGGDR----HYNPGRGRGRGRGRGGYGGNTRDVEAPSIED  354

Query  237  VGQFPTLGSK  208
             GQFPTLG K
Sbjct  355  PGQFPTLGGK  364



>ref|XP_011032359.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Populus euphratica]
Length=360

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  660  AGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMAL  481
            A D KK++P +EPE KEPEDK +TL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  
Sbjct  213  AADGKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFQSMQQ  271

Query  480  LANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghg  301
            L+NKK +++VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE  Y   G        
Sbjct  272  LSNKKENNDVFIKLGS-DKDKRKEAYEKAKKSVSINEFLKPAEGE-RYYGAGSRSRGRGR  329

Query  300  sgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
              RG    +  SS   PSIED GQFPTLG K
Sbjct  330  GARGFGNRDGMSSVPAPSIEDPGQFPTLGGK  360



>ref|XP_004300342.1| PREDICTED: intracellular hyaluronan-binding protein 4-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=385

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 125/193 (65%), Gaps = 14/193 (7%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA E E P   V  D    DA EK  G+ +A DA K++  DEP+ KEPE+KE+TL+E
Sbjct  198  TDEIASEVE-PGTEVEKD---VDA-EKPLGENEAADANKENAEDEPKEKEPEEKEMTLEE  252

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+ A + EERKV LDKE +SM  L++KK +DE+F+KLGSEK+ +K+ A +
Sbjct  253  YEKVLEEKRKALAALKTEERKVDLDKELKSMQQLSSKKTNDEIFIKLGSEKDKRKEAAEK  312

Query  399  kvkktK--SINEFLKPAEGETyyr-------pggrgrgrghgsgrggygGNNTSSFETPS  247
            + +  K  SINEFLKPAEGE+           GGRG   G+     G   +N ++   PS
Sbjct  313  EERAKKVVSINEFLKPAEGESQRHYSGRNRGRGGRGSRGGYSGEGHGGHSSNANAKPAPS  372

Query  246  IEDVGQFPTLGSK  208
            I D   FP+LG K
Sbjct  373  IADTALFPSLGGK  385



>ref|XP_011465242.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=384

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 125/193 (65%), Gaps = 14/193 (7%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA E E P   V  D    DA EK  G+ +A DA K++  DEP+ KEPE+KE+TL+E
Sbjct  197  TDEIASEVE-PGTEVEKD---VDA-EKPLGENEAADANKENAEDEPKEKEPEEKEMTLEE  251

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+ A + EERKV LDKE +SM  L++KK +DE+F+KLGSEK+ +K+ A +
Sbjct  252  YEKVLEEKRKALAALKTEERKVDLDKELKSMQQLSSKKTNDEIFIKLGSEKDKRKEAAEK  311

Query  399  kvkktK--SINEFLKPAEGETyyr-------pggrgrgrghgsgrggygGNNTSSFETPS  247
            + +  K  SINEFLKPAEGE+           GGRG   G+     G   +N ++   PS
Sbjct  312  EERAKKVVSINEFLKPAEGESQRHYSGRNRGRGGRGSRGGYSGEGHGGHSSNANAKPAPS  371

Query  246  IEDVGQFPTLGSK  208
            I D   FP+LG K
Sbjct  372  IADTALFPSLGGK  384



>ref|XP_006837401.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
 gb|ERN00255.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
Length=362

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL EYEK+LEEKRKA+ A + EERKV LDK+FESM  L++KK +D+VF+KLGSEK+  ++
Sbjct  231  TLSEYEKVLEEKRKALQALKNEERKVNLDKDFESMLQLSDKKANDDVFIKLGSEKDAARR  290

Query  411  eagekv----kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSI  244
            +   +     KK+ SINEFLKP +G  YY P GRGRG+G G   GG   N+T+S   PSI
Sbjct  291  KEIAEKEERIKKSVSINEFLKPVDGGRYYSPRGRGRGQGRGGFGGGISSNSTNSIAAPSI  350

Query  243  EDVGQFPTLGSK  208
            ED  QFPTL +K
Sbjct  351  EDQNQFPTLAAK  362



>ref|XP_009368155.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Pyrus x bretschneideri]
Length=359

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 120/161 (75%), Gaps = 5/161 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EKQ G+ +A DA K+  ++E E KEPE+KE+TL+EY+K+LEEKRKA+LA + EERKV +D
Sbjct  202  EKQSGENEAADANKEDAVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVD  261

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrp  331
            K+ ++M LL+NKK +DE+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY  
Sbjct  262  KDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYGG  321

Query  330  ggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
             GRGRGRG   G  G  G N +    PSI D GQFP+LG K
Sbjct  322  RGRGRGRGPRGGYSGGPGGNAA---PPSIGDPGQFPSLGGK  359



>gb|AAF14244.1|AF110228_1 nuclear RNA binding protein A [Spinacia oleracea]
Length=356

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 120/187 (64%), Gaps = 7/187 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
             DEIA E EEP   V N+ V   A EK  G+E A DA K++P  E E  EPE+K++TL+E
Sbjct  173  ADEIAQETEEPAV-VENEAVV--AAEKPAGEEVA-DAGKENPEKEAEEVEPEEKQMTLEE  228

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedkkkea  406
            YEK+LEEKRKA+LA + EERKV +DK+FESM L   KK DDEVF++L S  +K+ +  E 
Sbjct  229  YEKVLEEKRKALLALKAEERKVDVDKDFESMQLKTKKKVDDEVFIQLNSDKDKKKEAAEK  288

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFET-PSIEDVGQ  229
             EK KK+ SINEFL+PAEG   Y+  G     G G   G  GG    +  T P IED  Q
Sbjct  289  EEKAKKSVSINEFLRPAEGGDQYQRRGGRGRGGRGGRGGNGGGGYGMNHATAPKIEDPNQ  348

Query  228  FPTLGSK  208
            FPTLG K
Sbjct  349  FPTLGGK  355



>ref|NP_001241515.1| uncharacterized protein LOC100807657 [Glycine max]
 gb|ACU21122.1| unknown [Glycine max]
Length=367

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 121/186 (65%), Gaps = 7/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   +E    V N+       EK   +ED  D  KDSP +E E KEPEDKE+TL+E
Sbjct  187  TDELAQVTDE----VANETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEE  242

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ ++F+KLGS+K+ +K+    
Sbjct  243  YEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEK  301

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             EK KK+ SI EFLKPAEGE YY PG          G GGY G+ T++   PSIED G F
Sbjct  302  EEKSKKSVSITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGYHGSATNNAPAPSIEDPGHF  361

Query  225  PTLGSK  208
            PTL +K
Sbjct  362  PTLSAK  367



>ref|XP_007218155.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
 gb|EMJ19354.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
Length=369

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EK  G+ DA D  K++P +EPE KEPEDKE+TL+EYEK+LEEKRKA+ A +  E +    
Sbjct  209  EKPVGEVDAADGNKETPANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTSEERKVDT  268

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrp  331
            KEF S+  L+NKK +D++F+KLGS+K+ KK+ A ++ K  K  SINEFLKPAEGE +Y P
Sbjct  269  KEFASLQQLSNKKGNDDIFIKLGSDKDKKKEAAEKEEKSKKSVSINEFLKPAEGERFYNP  328

Query  330  ggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            GGRGRGRG G   G     +  S   PSIED GQFPTLG+K
Sbjct  329  GGRGRGRGRGPRGGFSNNYSHGSAAAPSIEDPGQFPTLGAK  369



>ref|XP_009776248.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=363

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 116/189 (61%), Gaps = 18/189 (10%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A E E+ +N            EK     +AGD KK++P  E E KEPE+KE+TL+E
Sbjct  188  TDEVANEGEKNLN-----------VEKPSADGEAGDDKKENPAAEAEDKEPENKEMTLEE  236

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe-kedkkkeag  403
            YEK+LEEKR+A+ A + EERKV + KEFESM  L+ K +DD +F+KLG + K  +  E  
Sbjct  237  YEKVLEEKRQALQALKTEERKVDI-KEFESMQQLSKKSSDD-IFIKLGPKDKRRESAEKE  294

Query  402  ekvkktKSINEFLKPAEGETyyr----pggrgrgrghgsgrggygGNNTSSFETPSIEDV  235
            EK KK  SINEFLKPAEGE YY       G       G G G  G N TS+ E P IED 
Sbjct  295  EKAKKAVSINEFLKPAEGERYYAPGGRGRGGRGRGSRGYGGGYGGANTTSNVEAPLIEDP  354

Query  234  GQFPTLGSK  208
            G FPTLG K
Sbjct  355  GHFPTLGGK  363



>ref|XP_008347095.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=236

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  663  DAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  484
            DA D  KD+P  EP  KEPEDKE+TL+EYEK+LEEKRKA+ A +  E +    KEFES  
Sbjct  83   DAADGNKDTPAKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQ  142

Query  483  LLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrg  307
             L+NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE  Y PGGRGRGRG
Sbjct  143  QLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAEGERSYNPGGRGRGRG  202

Query  306  hgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  208
             GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  203  RGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  236



>ref|XP_008344404.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=367

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -1

Query  663  DAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  484
            DA D KKD+P +EPE KEPEDKE+TL+EY+K+LEEKRKA+ A +  E +    KEFES  
Sbjct  214  DAADGKKDTPANEPEEKEPEDKEMTLEEYQKVLEEKRKALQALKTTEERKVDAKEFESFQ  273

Query  483  LLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrg  307
             L+NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE +Y PGGRGRGRG
Sbjct  274  QLSNKKANDEIFIKLGSDKDKKKDSEKEEKSKKSVSINEFLKPAEGERFYNPGGRGRGRG  333

Query  306  hgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  208
             GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  334  RGSKGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  367



>ref|XP_008232490.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Prunus mume]
Length=369

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EK  G+ DA D  K++P +EPE KEPEDKE+TL+EYEK+LEEKRKA+ A +  E +    
Sbjct  209  EKPVGEVDAADGNKETPANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTSEERKVDT  268

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrp  331
            KEF S+  L+NKK +D++F+KLGS+K+ KK+ A ++ K  K  SINEFLKPAEGE +Y P
Sbjct  269  KEFASLQQLSNKKGNDDIFIKLGSDKDKKKEAAEKEEKSKKSVSINEFLKPAEGERFYNP  328

Query  330  ggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            GGRGRGRG G   G     +  S   PSIED GQFPTLG K
Sbjct  329  GGRGRGRGRGPRGGFSNNYSHGSAAAPSIEDPGQFPTLGGK  369



>ref|XP_009373211.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=372

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  663  DAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  484
            DA D  KD+P +EP  KEPEDKE+TL+EYEK+LEEKRKA+ A +  E +    KEFES  
Sbjct  219  DAADGNKDTPANEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQ  278

Query  483  LLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrg  307
             L+NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE  Y PGGRGRGRG
Sbjct  279  QLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAEGERSYNPGGRGRGRG  338

Query  306  hgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  208
             GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  339  RGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  372



>ref|XP_006375155.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 ref|XP_006375156.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52952.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52953.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
Length=373

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 115/165 (70%), Gaps = 12/165 (7%)
 Frame = -1

Query  669  QEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  490
            +E A D KK++P +EPE KEPEDK +TL+EYEK+LEEKRKA+ A + EERKV   KEF+S
Sbjct  210  EEAAADRKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEERKVDT-KEFQS  268

Query  489  MALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgr  316
            M  L+NKK +++VF+KLGS+K+ +K+   +  K KK+ SINEFLKPAEGE YY  G RGR
Sbjct  269  MQQLSNKKENNDVFIKLGSDKDKRKEAYEKDEKAKKSVSINEFLKPAEGERYYGSGSRGR  328

Query  315  grghgsgrggygGNNTSSF---------ETPSIEDVGQFPTLGSK  208
            GRG G+   G     +S F           PSIED GQFPTLG K
Sbjct  329  GRGRGARGFGNRDGMSSGFGNRDGMSSVPAPSIEDPGQFPTLGGK  373



>ref|XP_008375773.1| PREDICTED: LOW QUALITY PROTEIN: plasminogen activator inhibitor 
1 RNA-binding protein-like [Malus domestica]
Length=373

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  663  DAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  484
            DA D  KD+P  EP  KEPEDKE+TL+EYEK+LEEKRKA+ A +  E +    KEFES  
Sbjct  220  DAADGNKDTPXKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQ  279

Query  483  LLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrg  307
             L+NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE  Y PGGRGRGRG
Sbjct  280  QLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAEGERSYNPGGRGRGRG  339

Query  306  hgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  208
             GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  340  RGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  373



>ref|XP_004306983.1| PREDICTED: circumsporozoite protein-like [Fragaria vesca subsp. 
vesca]
Length=387

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 118/177 (67%), Gaps = 11/177 (6%)
 Frame = -1

Query  714  VNDGVNTDAFEKQHGQE------DAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKR  553
            V +GV  DA EK  G+E      +A D  K++P +EPE KEPE+KE+TL+EYEK+LEEKR
Sbjct  214  VTEGV--DATEKNLGEEKLVGEVEAADGSKETPANEPEEKEPEEKEMTLEEYEKVLEEKR  271

Query  552  KAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK--S  379
            KA+ A + EERKV   KEFES+  ++NKK +D+VF+KLGS+K+ KK+ A ++ K  K  S
Sbjct  272  KALQALKTEERKVDT-KEFESLQQISNKKGNDDVFIKLGSDKDKKKESAEKEEKAKKSVS  330

Query  378  INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            INEFLKPAEGE +  P   GRGRG G   G       SS   P IED   FPTLG K
Sbjct  331  INEFLKPAEGERFSYPSRGGRGRGRGPRGGSSSNYPQSSVRAPPIEDPSHFPTLGGK  387



>gb|ABK94354.1| unknown [Populus trichocarpa]
Length=373

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 115/165 (70%), Gaps = 12/165 (7%)
 Frame = -1

Query  669  QEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  490
            +E A D KK++P +EPE KEPEDK +TL+EYEK+LEEKRKA+ A + EERKV   KEF+S
Sbjct  210  EEAAADRKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEERKVDT-KEFQS  268

Query  489  MALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgr  316
            M  L+NKK +++VF+KLGS+K+ +K+   +  K KK+ SINEFLKPAEGE YY  G RGR
Sbjct  269  MQQLSNKKENNDVFIKLGSDKDKRKEAYEKDEKAKKSVSINEFLKPAEGERYYGSGSRGR  328

Query  315  grghgsgrggygGNNTSSF---------ETPSIEDVGQFPTLGSK  208
            GRG G+   G     +S F           PSIED GQFPTLG K
Sbjct  329  GRGRGARGFGNRDGMSSGFGNRDGMSSVPAPSIEDPGQFPTLGGK  373



>ref|XP_011032341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
 ref|XP_011032350.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
Length=370

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 114/160 (71%), Gaps = 11/160 (7%)
 Frame = -1

Query  660  AGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMAL  481
            A D KK++P +EPE KEPEDK +TL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  
Sbjct  213  AADGKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFQSMQQ  271

Query  480  LANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghg  301
            L+NKK +++VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE YY  G R RGRG G
Sbjct  272  LSNKKENNDVFIKLGS-DKDKRKEAYEKAKKSVSINEFLKPAEGERYYGAGSRSRGRGRG  330

Query  300  sgrggygGNNTSSFET---------PSIEDVGQFPTLGSK  208
            +   G     +S F +         PSIED GQFPTLG K
Sbjct  331  ARGFGNRDGMSSGFGSRDGMSSVPAPSIEDPGQFPTLGGK  370



>emb|CDP21265.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 121/187 (65%), Gaps = 10/187 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQH-GQEDAGDAKKDSPldepevkepedkeLTLD  583
            +DE+A  AEE     VN+G      EKQ  G+ED  D  K++P +E E KEPE+KE+TL+
Sbjct  185  SDEVAQAAEE-----VNEGEKNPNAEKQPPGEEDTADGSKETPANESEEKEPENKEMTLE  239

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedkkke  409
            EYEK+LEEKRK +   + EERKV   K F SM  LANKK +++VF+KLGS  +K+ +  E
Sbjct  240  EYEKVLEEKRKTLQTLKTEERKVDA-KAFASMQQLANKKANEDVFIKLGSDKDKKKEANE  298

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
              EK KK+ SINEFLKPAEGE  +   G          RG  GGN+  + ETPSIED+  
Sbjct  299  KEEKAKKSLSINEFLKPAEGE-KFYNPGGRGRGRGRGSRGYGGGNSYGNVETPSIEDLVL  357

Query  228  FPTLGSK  208
            FP+LGSK
Sbjct  358  FPSLGSK  364



>gb|KCW77830.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=370

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -1

Query  696  TDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERK  517
            T   EKQ   ED  DA K+ PL+EPE KEPEDKE+TL+EYEK+ EE RK++LA + EERK
Sbjct  202  TGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEERK  261

Query  516  VCLDKEFESMALLANKKND-DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGE  346
            V LDK+ +SM  L+NKK D +++F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE
Sbjct  262  VELDKDLKSMQQLSNKKKDNNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGE  321

Query  345  TyyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  208
             YY PGGRGRGRG G+  G  GG           PSIED GQFP+LG K
Sbjct  322  RYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  370



>ref|XP_010531668.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 114/162 (70%), Gaps = 5/162 (3%)
 Frame = -1

Query  687  FEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAI--LASRPEERKV  514
             EK  G ++A DA K++P +  E KEPEDKE+TLDEYEK+LEEKRKA+  LA+   ERKV
Sbjct  196  VEKPAGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLATSDSERKV  255

Query  513  CLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETy  340
             L KEFESM  L+NKK +DE+F+KLGS+K+ +K      EK KK  SINEFLKPAEGE Y
Sbjct  256  DL-KEFESMQQLSNKKANDEIFIKLGSDKDKRKDALDKEEKAKKAVSINEFLKPAEGEGY  314

Query  339  yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  214
            Y  GGRGRGRG G G  G G     S   P+IED  QFP+LG
Sbjct  315  YPRGGRGRGRGRGGGSRGGGYGGYQSKAAPAIEDTAQFPSLG  356



>ref|XP_010104826.1| hypothetical protein L484_024026 [Morus notabilis]
 gb|EXC02062.1| hypothetical protein L484_024026 [Morus notabilis]
Length=463

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 122/164 (74%), Gaps = 5/164 (3%)
 Frame = -1

Query  699  NTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEER  520
            N DA  ++ G E+A DA K+ P  E E KEPEDKE+TL+EYEK+LEEKRKA+LA + EER
Sbjct  229  NVDA--EKLGDEEASDANKEKPEKEAEEKEPEDKEMTLEEYEKVLEEKRKALLALKTEER  286

Query  519  KVCLDKEFESMALLANKKNDDEVFVKLGSe--kedkkkeagekvkktKSINEFLKPAEGE  346
            KV   KEFESM  L++KK +DE+F+KLGSE  K  +  E  EK KK+ SINEFLKPAEGE
Sbjct  287  KVD-SKEFESMQQLSSKKGNDEIFIKLGSEKDKRKEAAEKEEKAKKSLSINEFLKPAEGE  345

Query  345  TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  214
             YY PGGRGRGRG GS  G  GG ++S+   PSIED GQFPTLG
Sbjct  346  RYYTPGGRGRGRGRGSRGGYGGGYSSSNVAAPSIEDPGQFPTLG  389



>dbj|BAE71297.1| hypothetical protein [Trifolium pratense]
Length=371

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 122/188 (65%), Gaps = 11/188 (6%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA-GDAKKDSPldepevkepedkeLTLD  583
            +DEIA   EE    V N+     A EK  G EDA  +  KD+P +E E KEPEDKE+TL+
Sbjct  186  SDEIAQVTEE----VSNEPEKNVAEEKPAGGEDATAEGNKDAPANEAEEKEPEDKEMTLE  241

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke-a  406
            EYEK+LEEKRKA+ A + E RKV   KEFESM  L+ KK +DE+F KLGS+K+ +K    
Sbjct  242  EYEKVLEEKRKALQALKTEGRKVDT-KEFESMKPLSCKKENDEIFAKLGSDKDKRKDAFE  300

Query  405  gekvkktKSINEFLKPAEGE----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             EK KK  SINEFLKPAEGE       R G  GRG   GS  GGYGGN  S+   PSIED
Sbjct  301  KEKAKKALSINEFLKPAEGEKYYNPGGRGGRGGRGGRGGSRGGGYGGNAYSNVPAPSIED  360

Query  237  VGQFPTLG  214
             GQFPTLG
Sbjct  361  PGQFPTLG  368



>ref|XP_004515346.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cicer arietinum]
Length=371

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 123/186 (66%), Gaps = 9/186 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            +DEIA   EE    V N+       EK  G+E+A D  K++P +E E KEPEDKE+TL+E
Sbjct  188  SDEIAQVTEE----VANETEKNLGEEKPAGEEEAADVSKETPANEAEEKEPEDKEMTLEE  243

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke-ag  403
            YEK+LEEKRKA+ A + E RKV   KEFESM  L+ KK++ E+F KLGS+K+ +K+    
Sbjct  244  YEKVLEEKRKALQALKTEGRKVDA-KEFESMKPLSCKKDNVEIFAKLGSDKDKRKEAFDK  302

Query  402  ekvkktKSINEFLKPAEGE---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVG  232
            EK KK  SINEFLKPA+GE        GGRG   G GS  GG+GGN  S+   PSIED G
Sbjct  303  EKSKKALSINEFLKPADGEKFYNPGGRGGRGGRGGRGSRGGGFGGNAYSNVPAPSIEDPG  362

Query  231  QFPTLG  214
            QFPTLG
Sbjct  363  QFPTLG  368



>gb|ABY60453.1| putative nuclear RNA binding protein, partial [Adonis aestivalis 
var. palaestina]
Length=154

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 94/135 (70%), Gaps = 7/135 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedk  418
            TLDEY+K+LEEKRKA+LA + EERKV +DK+FESM  L+ KKN+DE+F KLGS  +K+ +
Sbjct  19   TLDEYQKVLEEKRKALLALKVEERKVTVDKDFESMQQLSGKKNNDEIFAKLGSDKDKKKE  78

Query  417  kkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-----SFET  253
              E  EK KK  SINEFLKPA GE YY PGGRGRGRG   G  G G    S     + E 
Sbjct  79   IAEKEEKAKKAVSINEFLKPAGGEKYYSPGGRGRGRGGRGGARGGGAGGFSGGVSKNVEA  138

Query  252  PSIEDVGQFPTLGSK  208
            PSIED G+FP L  K
Sbjct  139  PSIEDPGEFPNLLKK  153



>ref|XP_011017364.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
 ref|XP_011017365.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=359

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 90/128 (70%), Gaps = 3/128 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+LA + EERKV   KEF+SM  +++KK +++VF+KLGS  +DK+K
Sbjct  235  TLEEYEKVLEEKRKALLALKTEERKVDA-KEFQSMQQISSKKENNDVFIKLGS-DKDKRK  292

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVG  232
            EA EK KK+ SINEFLKPAEGE  Y+  G          RG    +  S+   PSIED G
Sbjct  293  EASEKAKKSVSINEFLKPAEGER-YQGSGGRGRGRGRGARGFGNRDGISNVPAPSIEDPG  351

Query  231  QFPTLGSK  208
            QFPTLG K
Sbjct  352  QFPTLGGK  359



>gb|AFK43517.1| unknown [Lotus japonicus]
Length=370

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = -1

Query  666  EDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESM  487
            ED  D  K+S  +E E KEPEDKE+TL+EYEK+LEEKRKA+ A + E RKV + KEFESM
Sbjct  215  EDVADGNKESSANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEGRKVDI-KEFESM  273

Query  486  ALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETy--yrpggrg  319
              L+ KK+++++F KLGS+K+ +K+     EK KK+ SINEFLKPAEGETY     G   
Sbjct  274  QPLSCKKDNNDIFAKLGSDKDKRKEAFEKEEKAKKSVSINEFLKPAEGETYYPSGRGRGR  333

Query  318  rgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
                 G G G + GN TS+   PSIED G FPTLG K
Sbjct  334  GRGSRGGGGGSFRGNATSNAPAPSIEDPGHFPTLGGK  370



>ref|XP_010053521.1| PREDICTED: vasodilator-stimulated phosphoprotein-like [Eucalyptus 
grandis]
Length=368

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EKQ   E+A DA K++PL+EPE KEPEDKE+TL+EYEK+ EEKRKA+L  + EERKV +D
Sbjct  205  EKQLVDEEAADASKENPLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEERKVEVD  264

Query  504  KEFESMALLANKKNDDEVFVKLGSe--kedkkkeagekvkktKSINEFLKPAEGETyyrp  331
            KE +SM  L++KK + ++F+KLGSE  K  +  E  E+ KK+ SINEFLKPAEGE YY P
Sbjct  265  KELKSMQQLSSKKENHDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYNP  324

Query  330  ggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  208
            GGRGRGRG G+  G  GG           PSIED GQFP+LG K
Sbjct  325  GGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  368



>ref|XP_003552493.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=370

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 122/190 (64%), Gaps = 11/190 (6%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   +E    VVN+       EK   +ED  D  KDSP +E E KEPEDKE+TL+E
Sbjct  186  TDELAQVTDE----VVNETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEE  241

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ ++F+KLGS+K+ +K+    
Sbjct  242  YEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEK  300

Query  405  gekvkktKSINEFLKPAEGET----yyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             EK KK+ SI EFLKPAEGE         G     RG G G G Y G++T++   PSIED
Sbjct  301  EEKSKKSVSITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGGGGVYRGSSTNNAPAPSIED  360

Query  237  VGQFPTLGSK  208
             G FP LG+K
Sbjct  361  PGHFPNLGAK  370



>gb|KFK31390.1| hypothetical protein AALP_AA6G105700 [Arabis alpina]
Length=353

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 112/188 (60%), Gaps = 16/188 (9%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EEP+  V    V     EKQ G+++  DAKK++P +E E K+      TL+EY
Sbjct  174  DDIPPATEEPMTEVEKSPVTA---EKQEGEDETTDAKKETPAEEEEEKQM-----TLEEY  225

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek  397
            EK+ EEK+KA+  ++ EERKV   K FESM  L+NKK+++E+F+KLGSEK     E  EK
Sbjct  226  EKIQEEKKKAMQGAKVEERKVDT-KVFESMQQLSNKKSNEEIFIKLGSEKRKDATEKEEK  284

Query  396  vkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE-------TPSIED  238
             +K+ SINEFLKPA+GE+Y   GG     G   GRGG      +           P+I D
Sbjct  285  ARKSLSINEFLKPADGESYNPRGGYRGRGGGRGGRGGQRDGRGNGGGNQRFGGAAPAIGD  344

Query  237  VGQFPTLG  214
              QFPTLG
Sbjct  345  NAQFPTLG  352



>ref|XP_010918620.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Elaeis guineensis]
Length=369

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 120/187 (64%), Gaps = 16/187 (9%)
 Frame = -1

Query  726  INGVVNDGVNTD----AFEKQHGQEDA----GDAKKDSPldepevkepedkeLTLDEYEK  571
            I    ++ VN D    A EKQ  Q++A     + +KD   +E E KEP+DKE+TL+EYEK
Sbjct  182  IAQATDENVNADDKIPASEKQPEQDNAPSSEANKEKDVQANEAEEKEPDDKEMTLEEYEK  241

Query  570  LLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke----ag  403
            + EEKRKA+LA + EERKV +DKE +SM  L+ KK +D+VF+KLGS+K+  KK+      
Sbjct  242  IREEKRKALLAMKTEERKVEIDKELQSMQQLSLKKGNDDVFIKLGSDKDMGKKKDVADRD  301

Query  402  ekvkktKSINEFLKPAEGE---TyyrpggrgrgrghgsgrggygGNNTSSFET-PSIEDV  235
            E+ KK  SINEFLKPAEGE   +    G        G  RGG+GG  TS+  T PSIED 
Sbjct  302  ERAKKPVSINEFLKPAEGERYYSPVGRGRGRGRGDRGPFRGGFGGRGTSTPATAPSIEDP  361

Query  234  GQFPTLG  214
            GQFPTLG
Sbjct  362  GQFPTLG  368



>gb|KCW77831.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=369

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EKQ   E+A DA K++PL+EPE KEPEDKE+TL+EYEK+ EEKRKA+L  + EERKV +D
Sbjct  206  EKQLVDEEAADASKENPLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEERKVEVD  265

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrp  331
            KE +SM  L++KK + ++F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY P
Sbjct  266  KELKSMQQLSSKKENHDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYNP  325

Query  330  ggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  208
            GGRGRGRG G+  G  GG           PSIED GQFP+LG K
Sbjct  326  GGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  369



>gb|KHN00198.1| hypothetical protein glysoja_034729 [Glycine soja]
Length=128

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 85/130 (65%), Gaps = 5/130 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+ A + E RKV + KEF SM  L+NKK +DE+F+KLGS+K+ +K 
Sbjct  2    TLEEYEKVLEEKRKALQAQKTEARKVDI-KEFASMQPLSNKKENDEIFIKLGSDKDKRKD  60

Query  411  eagekvkktKSIN--EFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
               ++ K  KS+N  EFLKPAEGE      G          RGGY GN  S+   PSIED
Sbjct  61   ALEKEEKSKKSVNITEFLKPAEGER--YYPGGRGRGRGRGSRGGYSGNAYSNAPAPSIED  118

Query  237  VGQFPTLGSK  208
             G FP+LG K
Sbjct  119  PGHFPSLGGK  128



>ref|XP_007139646.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
 gb|ESW11640.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
Length=365

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 114/155 (74%), Gaps = 3/155 (2%)
 Frame = -1

Query  666  EDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESM  487
            E+  D  KDSP +E E KEPEDKE+TL+EYEK+LEE+RKA  A + E RKV   KEFE+M
Sbjct  212  EEVADGNKDSPANETEEKEPEDKEMTLEEYEKVLEERRKAFQALKTEGRKVDA-KEFETM  270

Query  486  ALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrg  313
              L++KK + ++F+KLGS+K+ +K+     EK KK+ SI EFLKPAEGETYY PGGRGRG
Sbjct  271  QPLSSKKTNHDIFIKLGSDKDKRKEALEKEEKSKKSVSITEFLKPAEGETYYNPGGRGRG  330

Query  312  rghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
            RG    RGGY G  T++   PSIED G FPTLG+K
Sbjct  331  RGGRGSRGGYRGGATNNAPAPSIEDPGHFPTLGAK  365



>ref|XP_002301233.2| transcription factor family protein [Populus trichocarpa]
 gb|ABK94212.1| unknown [Populus trichocarpa]
 gb|EEE80506.2| transcription factor family protein [Populus trichocarpa]
Length=359

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+LA + EERKV   +EF+SM  +++KK +++VF+KLGS  +DK+K
Sbjct  235  TLEEYEKVLEEKRKALLALKTEERKVDT-REFQSMQQISSKKENNDVFIKLGS-DKDKRK  292

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVG  232
            EA EK KK+ SINEFLKPAEGE  Y   G          RG    +  S+   PSIED G
Sbjct  293  EASEKAKKSVSINEFLKPAEGE-RYHGSGGRGRGRGRGARGFGNRDGISNVPAPSIEDPG  351

Query  231  QFPTLGSK  208
            QFPTLG K
Sbjct  352  QFPTLGGK  359



>ref|XP_010531670.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Tarenaya 
hassleriana]
Length=359

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAI--LASRPEERKVC  511
            EK  G ++A DA K++P +  E KEPEDKE+TLDEYEK+LEEKRKA+  LAS   ERKV 
Sbjct  197  EKPAGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLASSDFERKVD  256

Query  510  LDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyy  337
            L KEFESM  L+NKK +DE+F+KLGS+K+ +K      EK KK+ SINEFLKPAEGE YY
Sbjct  257  L-KEFESMQQLSNKKANDEIFIKLGSDKDKRKDALDKEEKAKKSVSINEFLKPAEGEGYY  315

Query  336  rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  214
              GGRGRGRG G G  G G     +   P+IED  QFP+LG
Sbjct  316  PRGGRGRGRGRGGGSRGGGYGGYQNKAAPAIEDTAQFPSLG  356



>ref|XP_002458112.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
 gb|EES03232.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
Length=366

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 7/135 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L  +PEERKV +DKE +SM  L+ KK  DE+F+KLGS+K+ KK+
Sbjct  232  TLEEYEKVLEEKRKALLGLKPEERKVEVDKELQSMQQLSVKKGADEIFIKLGSDKDKKKE  291

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE-----T  253
                  + KK+ SINEFLKPAEG+ YY PGGRGRGRG G G  G      S  E      
Sbjct  292  NTERDERAKKSVSINEFLKPAEGQRYYSPGGRGRGRGRGRGDRGGFRGGYSPREVAAAPA  351

Query  252  PSIEDVGQFPTLGSK  208
            P+I+D  QFP+LG K
Sbjct  352  PAIQDQAQFPSLGGK  366



>ref|XP_006644341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=370

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS+K+ KK+
Sbjct  238  TLEEYEKVLEEKRKALLSLKAEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKE  297

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS---FETPS  247
                  + +K+ SINEFLKPAEGE YY PGGRGRGRG G G  G   +  SS      P+
Sbjct  298  NVERDERTRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPA  357

Query  246  IEDVGQFPTLGSK  208
            IED  QFP+L  K
Sbjct  358  IEDQAQFPSLAGK  370



>gb|ABR26138.1| salt tolerance protein 2 [Oryza sativa Indica Group]
Length=175

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS+K+ KK+
Sbjct  40   TLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKE  99

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS---FETPS  247
                  + +K+ SINEFLKPAEGE YY PGGRGRGRG G G  G   +  SS      P 
Sbjct  100  NVERDERTRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPR  159

Query  246  IEDVGQFPTLGSK  208
            IED  QFP L  +
Sbjct  160  IEDQAQFPGLAGR  172



>dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 117/187 (63%), Gaps = 9/187 (5%)
 Frame = -1

Query  759  TDEIAPEAEEP-INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLD  583
            TDEIA   EE  I G  N G    A E      DA +  KDS  +E E KE EDKE+TL+
Sbjct  191  TDEIAQVTEEAVIEGEKNIGDEKPAVEN-----DAAEGNKDSAANEAEEKEAEDKEMTLE  245

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--  409
            EY+K+LEEKRKA+   + EERKV   KEFE+M  L+ KK++ E+F KLGS+K+ +K+   
Sbjct  246  EYQKVLEEKRKALQVVKTEERKVDT-KEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFD  304

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
              EK KK+ SINEFLKPAEG+ Y+R  G       G G G  GGN   +   PSIED G 
Sbjct  305  KEEKAKKSVSINEFLKPAEGDAYHRGRGGRGREARGGGGGYRGGNLNRNVRAPSIEDPGH  364

Query  228  FPTLGSK  208
            FPTLG+K
Sbjct  365  FPTLGAK  371



>gb|KJB22277.1| hypothetical protein B456_004G038700 [Gossypium raimondii]
Length=366

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 120/194 (62%), Gaps = 15/194 (8%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            T+E+A   EE    V N+G      EK     D GDA K+S  +E E KEPE+K +TL+E
Sbjct  178  TNELARVTEE----VANEGNQNLGDEKLARDGDGGDADKESLTNELEEKEPEEKVMTLEE  233

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEKL+EEKRKA+ A + E RKV   KEFESM  L+NKK++DE+F+KLGS+K+ +K+    
Sbjct  234  YEKLMEEKRKALQALKTEGRKVDA-KEFESMQQLSNKKSNDEIFIKLGSDKDKRKEAYEK  292

Query  405  gekvkktKSINEFLKPAE--------GETyyrpggrgrgrghgsgrggygGNNTSSFETP  250
             E+ KK+ SINEFLKPAE        G    R  G+ +GRGH S   G G   +S    P
Sbjct  293  EERAKKSLSINEFLKPAERKRYYNPSGRGRGRVQGQDQGRGHSSRGFGGGNARSSMAAAP  352

Query  249  SIEDVGQFPTLGSK  208
            SIED   FPTLG K
Sbjct  353  SIEDRSHFPTLGGK  366



>ref|XP_009395730.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal-like [Musa 
acuminata subsp. malaccensis]
Length=381

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 89/136 (65%), Gaps = 8/136 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+ EEKRKA+ A + EERKV +DK+ +SM  L+ KK +D++FVKLGS+K+  KK
Sbjct  246  TLEEYEKVREEKRKALAAMKSEERKVEMDKDLQSMKQLSLKKENDDIFVKLGSDKDTGKK  305

Query  411  eage----kvkktKSINEFLKPAEGET--yyrpggrgrgrghgsgrggygGNNTSSFET-  253
            +       + KK  SINEFLKPAEGE        GRGRGRG      G      S+F T 
Sbjct  306  KENTDRDERNKKPMSINEFLKPAEGERYYNSGGRGRGRGRGGRGQFRGGFMGGVSTFTTD  365

Query  252  -PSIEDVGQFPTLGSK  208
             PSIED GQFPTLG K
Sbjct  366  APSIEDPGQFPTLGGK  381



>ref|XP_010924482.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1-like 
protein [Elaeis guineensis]
Length=376

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 119/186 (64%), Gaps = 15/186 (8%)
 Frame = -1

Query  726  INGVVNDGVNTD----AFEKQHGQEDA--GDAKKDSP-ldepevkepedkeLTLDEYEKL  568
            I    ++ VN D    A EKQ  QEDA   +A KD       E KEPEDKE+TL+EYEK+
Sbjct  190  IAQASDENVNADDKLVATEKQQEQEDAPSSEANKDKDVQTNEEEKEPEDKEMTLEEYEKI  249

Query  567  LEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke----age  400
             EEKRKA+LA + EERKV +D+E +SM  L++KK +++VF+KLGS+K+  KK+      E
Sbjct  250  REEKRKALLALKIEERKVEIDRELQSMQQLSSKKGNEDVFIKLGSDKDMGKKKDVADRDE  309

Query  399  kvkktKSINEFLKPAEGE----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVG  232
            + KK+ SIN+FLKPAEGE       R  GRGRG       G  GG+ ++    PSIED G
Sbjct  310  RGKKSVSINQFLKPAEGERYYSATGRGRGRGRGGRGPFRGGFGGGDTSAPAAAPSIEDPG  369

Query  231  QFPTLG  214
            QFPTLG
Sbjct  370  QFPTLG  375



>gb|KHN40549.1| hypothetical protein glysoja_001047 [Glycine soja]
Length=363

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 123/192 (64%), Gaps = 13/192 (7%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   +E    VVN+       EK   +ED  D  KDSP +E E KEPEDKE+TL+E
Sbjct  177  TDELAQVTDE----VVNETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEE  232

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ ++F+KLGS+K+ +K+    
Sbjct  233  YEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEK  291

Query  405  gekvkktKSINEFLKPAEGET------yyrpggrgrgrghgsgrggygGNNTSSFETPSI  244
             EK KK+ SI EFLKPAEGE           G   RG G G G G Y G++T++   PSI
Sbjct  292  EEKSKKSVSITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGGGGGGVYRGSSTNNAPAPSI  351

Query  243  EDVGQFPTLGSK  208
            ED G FP LG+K
Sbjct  352  EDPGHFPNLGAK  363



>dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 117/187 (63%), Gaps = 9/187 (5%)
 Frame = -1

Query  759  TDEIAPEAEEP-INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLD  583
            TDEIA   EE  I G  N G    A E      DA +  KDS  +E E KE EDKE+TL+
Sbjct  191  TDEIAQVTEEAVIEGEKNIGDEKPAVEN-----DAAEGNKDSAANEAEEKEAEDKEMTLE  245

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--  409
            EY+K+LEEKRKA+   + EERKV   KEFE+M  L+ KK++ E+F KLGS+K+ +K+   
Sbjct  246  EYQKVLEEKRKALQVVKTEERKVDT-KEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFD  304

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
              EK KK+ SINEFLKPAEG+ YYR  G       G G G  GGN   +   PSIED G 
Sbjct  305  KEEKAKKSVSINEFLKPAEGDAYYRGRGGRGREARGGGGGYRGGNLNRNVRAPSIEDPGH  364

Query  228  FPTLGSK  208
            FPTLG+K
Sbjct  365  FPTLGAK  371



>ref|XP_003624316.1| Transcription factor [Medicago truncatula]
Length=625

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 124/185 (67%), Gaps = 8/185 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA   EE    V+N+G      EK   + D  +  KDSP +E E KEPEDKE+TL+E
Sbjct  197  TDEIAQVTEE----VMNEGEKNLGDEKPAVEADVAEGNKDSPANEAEEKEPEDKEMTLEE  252

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEK+LEEKRKA+   + EERKV   K FE+M  L+ KK++ E+F KLG++K+ +K+   +
Sbjct  253  YEKVLEEKRKALQTLKTEERKVDT-KAFETMQALSCKKDNTEIFAKLGADKDKRKEAYDK  311

Query  399  --kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQ  229
              K KK+ SINEFLKPAEGE++Y  GGRGRGRG    RGG    N+ S+   PSIED G 
Sbjct  312  EEKAKKSVSINEFLKPAEGESHYNSGGRGRGRGGRGARGGGFRGNSYSNVPAPSIEDPGH  371

Query  228  FPTLG  214
            FPTLG
Sbjct  372  FPTLG  376



>ref|XP_010919740.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Elaeis guineensis]
Length=375

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk  415
            TLDEYEKLLEEKRKA+ A  R EERKV +DKEFE M  L+ KKNDD+VF+KLGSE++  +
Sbjct  243  TLDEYEKLLEEKRKALQALQRTEERKVDVDKEFEFMQQLSAKKNDDDVFIKLGSERDSAR  302

Query  414  keagekvkktKS----INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPS  247
            +      +        IN FL+PAE E  + PGGRGRGRG   G  G G     +   PS
Sbjct  303  RRDTADREDLTRRPAIINTFLRPAEEERQHNPGGRGRGRGGRDGGIGSGRTGAMNTTPPS  362

Query  246  IEDVGQFPTLG  214
            IED G FPTLG
Sbjct  363  IEDPGHFPTLG  373



>ref|XP_010919739.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Elaeis guineensis]
Length=376

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk  415
            TLDEYEKLLEEKRKA+ A  R EERKV +DKEFE M  L+ KKNDD+VF+KLGSE++  +
Sbjct  244  TLDEYEKLLEEKRKALQALQRTEERKVDVDKEFEFMQQLSAKKNDDDVFIKLGSERDSAR  303

Query  414  keagekvkktKS----INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPS  247
            +      +        IN FL+PAE E  + PGGRGRGRG   G  G G     +   PS
Sbjct  304  RRDTADREDLTRRPAIINTFLRPAEEERQHNPGGRGRGRGGRDGGIGSGRTGAMNTTPPS  363

Query  246  IEDVGQFPTLG  214
            IED G FPTLG
Sbjct  364  IEDPGHFPTLG  374



>gb|EAY75654.1| hypothetical protein OsI_03559 [Oryza sativa Indica Group]
Length=332

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 114/165 (69%), Gaps = 6/165 (4%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSP--ldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVC  511
            EKQ  Q+DA   +KDS       E ++ EDKE+TL+E+EKL EEKRKA+LA + EERKV 
Sbjct  165  EKQGEQDDAPTGEKDSKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVE  224

Query  510  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyy  337
            +DK+ +SM  L+ KK +DE+F+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY
Sbjct  225  VDKDLQSMQPLSTKKGNDEIFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYY  284

Query  336  rpggrgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  208
               GRGRGRG   GRG  GG     + T  PSIED  QFPTLG K
Sbjct  285  GGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  329



>gb|AES80534.2| nuclear RNA-binding-like protein [Medicago truncatula]
Length=583

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 124/186 (67%), Gaps = 8/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA   EE    V+N+G      EK   + D  +  KDSP +E E KEPEDKE+TL+E
Sbjct  197  TDEIAQVTEE----VMNEGEKNLGDEKPAVEADVAEGNKDSPANEAEEKEPEDKEMTLEE  252

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--a  406
            YEK+LEEKRKA+   + EERKV   K FE+M  L+ KK++ E+F KLG++K+ +K+    
Sbjct  253  YEKVLEEKRKALQTLKTEERKVDT-KAFETMQALSCKKDNTEIFAKLGADKDKRKEAYDK  311

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQ  229
             EK KK+ SINEFLKPAEGE++Y  GGRGRGRG    RGG    N+ S+   PSIED G 
Sbjct  312  EEKAKKSVSINEFLKPAEGESHYNSGGRGRGRGGRGARGGGFRGNSYSNVPAPSIEDPGH  371

Query  228  FPTLGS  211
            FPTL +
Sbjct  372  FPTLAT  377



>ref|XP_010053520.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW77832.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=352

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 111/173 (64%), Gaps = 10/173 (6%)
 Frame = -1

Query  696  TDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERK  517
            T   EKQ   ED  DA K+ PL+EPE KEPEDKE+TL+EYEK+ EE RK++LA + EERK
Sbjct  180  TGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEERK  239

Query  516  VCLDKEFESMALLANKKND-DEVFVKLGSekedk--kkeagekvkktKSINEFLKPAEGE  346
            V LDK+ +SM  L+NKK D +++F+KLG EK+ +    E  EK KK+ SINEFLKPAEGE
Sbjct  240  VELDKDLKSMQQLSNKKKDNNDIFIKLGCEKDKRKEAAEKEEKAKKSVSINEFLKPAEGE  299

Query  345  -------TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
                        G   RG   G G GG GG        PSIED GQFP+LG K
Sbjct  300  RYYNPGGRGRGRGRGARGGYGGGGGGGGGGGYARDVSAPSIEDPGQFPSLGGK  352



>ref|XP_010053519.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X1 [Eucalyptus grandis]
Length=374

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 111/173 (64%), Gaps = 10/173 (6%)
 Frame = -1

Query  696  TDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERK  517
            T   EKQ   ED  DA K+ PL+EPE KEPEDKE+TL+EYEK+ EE RK++LA + EERK
Sbjct  202  TGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEERK  261

Query  516  VCLDKEFESMALLANKKND-DEVFVKLGSekedk--kkeagekvkktKSINEFLKPAEGE  346
            V LDK+ +SM  L+NKK D +++F+KLG EK+ +    E  EK KK+ SINEFLKPAEGE
Sbjct  262  VELDKDLKSMQQLSNKKKDNNDIFIKLGCEKDKRKEAAEKEEKAKKSVSINEFLKPAEGE  321

Query  345  -------TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
                        G   RG   G G GG GG        PSIED GQFP+LG K
Sbjct  322  RYYNPGGRGRGRGRGARGGYGGGGGGGGGGGYARDVSAPSIEDPGQFPSLGGK  374



>ref|XP_010531669.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAI--LASRPEERKVC  511
            EK  G ++A DA K++P +  E KEPEDKE+TLDEYEK+LEEKRKA+  LAS   ERKV 
Sbjct  197  EKPAGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLASSDFERKVD  256

Query  510  LDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyy  337
            L KEFESM  L+NKK +DE F+KLGS+K+ +K      EK KK  SINEFLKPA+GE YY
Sbjct  257  L-KEFESMQQLSNKKANDEFFIKLGSDKDKRKDALDKEEKAKKAVSINEFLKPADGEGYY  315

Query  336  rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  214
              GGRGRGRG G G  G G     +   P+IED  QFP+LG
Sbjct  316  PRGGRGRGRGRGGGSRGGGYGGYQNKAAPAIEDTAQFPSLG  356



>gb|EAZ13376.1| hypothetical protein OsJ_03294 [Oryza sativa Japonica Group]
Length=332

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EKL EEKRKA+LA + EERKV +DK+ +SM  L+ KK +DE+F+KLGS+K+ KK+
Sbjct  198  TLEEFEKLREEKRKALLAFKAEERKVEVDKDLQSMQPLSTKKGNDEIFIKLGSDKDKKKE  257

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFET--PSI  244
             A    + KK+ SINEFLKPAEGE YY   GRGRGRG   GRG  GG     + T  PSI
Sbjct  258  NAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSI  317

Query  243  EDVGQFPTLGSK  208
            ED  QFPTLG K
Sbjct  318  EDQAQFPTLGGK  329



>ref|XP_009416461.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=389

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 87/137 (64%), Gaps = 9/137 (7%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS----eke  424
            TL+EYEK+ EEKRKA+LA + EERKV +DKE +SM  L+ KK +D +FVKLGS     K+
Sbjct  253  TLEEYEKIREEKRKALLAMKAEERKVEIDKELQSMQQLSTKKENDPIFVKLGSDKDFGKK  312

Query  423  dkkkeagekvkktKSINEFLKPAEG-----ETyyrpggrgrgrghgsgrggygGNNTSSF  259
             +  +  E+ KK+ SINEFLKPAEG           G     RG   G  G GG++ ++ 
Sbjct  313  KENADRDERSKKSLSINEFLKPAEGGRYYSPGGRGRGRGRGDRGPLRGSYGGGGSSFAAA  372

Query  258  ETPSIEDVGQFPTLGSK  208
              PSIED GQFPTLG K
Sbjct  373  AAPSIEDPGQFPTLGGK  389



>ref|XP_007142624.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
 gb|ESW14618.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
Length=358

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 112/162 (69%), Gaps = 5/162 (3%)
 Frame = -1

Query  681  KQHGQED-AGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            K  G++D A D  K++P +E E KEPEDKE+TL+EYEK+LEE+RKA+ A + EERKV   
Sbjct  198  KPSGEDDVAADGNKENPANEAEEKEPEDKEMTLEEYEKVLEERRKALQALKTEERKVDT-  256

Query  504  KEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGET-yyr  334
            K FESM  L+NKK++ ++F+KLGSEK+ +K+     EK KK+ SINEFLKP EGE+ Y  
Sbjct  257  KVFESMQQLSNKKDNFDIFIKLGSEKDKRKETLEKEEKAKKSVSINEFLKPPEGESFYSA  316

Query  333  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
             G           RGG+GG  T++   PSIED GQFPTLG K
Sbjct  317  GGRGRGRGRGRGARGGFGGYATANVTAPSIEDPGQFPTLGVK  358



>ref|NP_001043502.1| Os01g0603000 [Oryza sativa Japonica Group]
 dbj|BAD52651.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAD53119.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAF05416.1| Os01g0603000 [Oryza sativa Japonica Group]
 gb|EAZ12602.1| hypothetical protein OsJ_02509 [Oryza sativa Japonica Group]
Length=378

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS+K+ KK+
Sbjct  243  TLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKE  302

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS---FETPS  247
                  + +K+ SINEFLKPAEGE YY PGGRGRGRG G G  G   +  SS      P 
Sbjct  303  NVERDERTRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPR  362

Query  246  IEDVGQFPTLGSK  208
            IED  QFP L  +
Sbjct  363  IEDQAQFPGLAGR  375



>ref|NP_001044098.1| Os01g0721900 [Oryza sativa Japonica Group]
 dbj|BAB84432.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 dbj|BAF06012.1| Os01g0721900 [Oryza sativa Japonica Group]
Length=380

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EKL EEKRKA+LA + EERKV +DK+ +SM  L+ KK +DE+F+KLGS+K+ KK+
Sbjct  246  TLEEFEKLREEKRKALLAFKAEERKVEVDKDLQSMQPLSTKKGNDEIFIKLGSDKDKKKE  305

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFET--PSI  244
             A    + KK+ SINEFLKPAEGE YY   GRGRGRG   GRG  GG     + T  PSI
Sbjct  306  NAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSI  365

Query  243  EDVGQFPTLGSK  208
            ED  QFPTLG K
Sbjct  366  EDQAQFPTLGGK  377



>ref|XP_008459799.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=361

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 119/186 (64%), Gaps = 8/186 (4%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE A  AEE     VN+       EK   + D   A  D P  EPE  EPEDKE+TL+E
Sbjct  182  TDEFAEVAEE----TVNETEKNVGDEKPIQENDTSGANTDDPAKEPEETEPEDKEMTLEE  237

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--kea  406
            YEKLLE+KRK++LA + EERKV   KEF SM  L++KK+++++F+KLGSEK+ +K   + 
Sbjct  238  YEKLLEDKRKSLLALKTEERKVD-PKEFASMQQLSSKKDNNDIFIKLGSEKDKRKEIADK  296

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
             E+ KK+ SINEFL+PAEGE  +   G          RGGY G++ S+   PSIED GQF
Sbjct  297  EERTKKSLSINEFLRPAEGE-RHYTPGGRGRGRGRGSRGGYSGSSMSNVAAPSIEDPGQF  355

Query  225  PTLGSK  208
            P LG+K
Sbjct  356  PILGAK  361



>ref|XP_002870099.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46358.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
Length=372

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 100/137 (73%), Gaps = 6/137 (4%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  EE  + VV+  +     EKQ G+ +A DA K++P +    ++PEDKE+TL+EY
Sbjct  168  DDIAPVTEE-TSAVVDKNL---TVEKQGGEGEATDANKETPAEVQAEEKPEDKEMTLEEY  223

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  224  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREE  282

Query  399  kvkktKSINEFLKPAEG  349
            K +K+ SINEFLKPA+G
Sbjct  283  KTRKSLSINEFLKPADG  299



>ref|XP_009101440.1| PREDICTED: suppressor protein STM1 [Brassica rapa]
Length=333

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 114/187 (61%), Gaps = 11/187 (6%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P   EP   V    V     E   G++D  DAKKDSP  E E KEPEDKE+TL+EY
Sbjct  151  DDIPPPTVEPTTEVEKSPV----AENDGGEDDTTDAKKDSPAAEQEEKEPEDKEMTLEEY  206

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK N++E+F+KLGS+K+ +K  A +
Sbjct  207  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTNNEEIFIKLGSDKDKRKDAAEK  265

Query  399  kvkktK--SINEFLKPAEGE---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDV  235
            + K  K  SINEFLKPA+GE             GRG G G+   G         P+I D 
Sbjct  266  EEKTKKSLSINEFLKPADGERYNNPRGGYRGRGGRGGGRGQRDGGNQRHGGAPAPAIGDS  325

Query  234  GQFPTLG  214
             QFP+LG
Sbjct  326  AQFPSLG  332



>gb|EYU19467.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
 gb|EYU19468.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
Length=361

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 116/163 (71%), Gaps = 5/163 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDS-PldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCL  508
            EK+ G+++  DA KDS P ++ E +  E+KE+TL+EYEK+LEEKRK +L+ + E RKV +
Sbjct  198  EKKSGEDETDDANKDSSPKEKEEKEAEEEKEMTLEEYEKVLEEKRKTLLSMKSEARKVNV  257

Query  507  DKEFESMALLANKKND-DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE--Tyy  337
            DKE ESM LL+NKK D D+VF+KLGS  +DK+KEA EK KK+ SINEFLKP EGE  +  
Sbjct  258  DKELESMQLLSNKKIDHDDVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPVEGEKYSRG  316

Query  336  rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  208
               GRGRGRG     GG GG    S   P+IEDV QFP+LG K
Sbjct  317  GGRGRGRGRGREGFGGGGGGGFGRSERAPAIEDVDQFPSLGGK  359



>ref|XP_004961407.1| PREDICTED: RNA-binding protein FUS-like [Setaria italica]
Length=374

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 111/166 (67%), Gaps = 7/166 (4%)
 Frame = -1

Query  684  EKQHGQEDAGDAK--KDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVC  511
            EKQ   EDA  A+  KDS     E ++ EDKE+TL+E+EK+ EEKRKA+LA + EERKV 
Sbjct  209  EKQGALEDAPQAEENKDSKDANAEEEKEEDKEMTLEEFEKIREEKRKALLALKTEERKVE  268

Query  510  LDKEFESMALLANKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGET  343
            +DK+ +SM  L+NKK +DE+FVKLGS+    K+ +  E  E+ KK+ SINEFLKPAEGE 
Sbjct  269  VDKDLQSMQPLSNKKENDEIFVKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGER  328

Query  342  yyrpggrgrgrghgsgrggygGNNTSSFE-TPSIEDVGQFPTLGSK  208
            +Y   GRGRGRG   G  G  G    +    P+I+D  QFP+LG K
Sbjct  329  FYGGRGRGRGRGDRGGFRGGYGGGYRAPPAAPAIQDQSQFPSLGGK  374



>gb|AFW81314.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=365

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe---ked  421
            TL+EYEK+LEEKRKA+L+ + EERKV +DKE ++M  L+ KK+ DEVF+KLGS+   K+ 
Sbjct  237  TLEEYEKVLEEKRKALLSLKAEERKVEIDKELQAMQQLSVKKDGDEVFIKLGSDKDLKKK  296

Query  420  kkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIE  241
            +  E  E+ KK+ SINEFLKPAEGE YY P GRGRGRG G  RGGY G        P+IE
Sbjct  297  ESAEREERGKKSLSINEFLKPAEGERYYNPSGRGRGRGRGGFRGGYNGGYRGPAAAPAIE  356

Query  240  DVGQFPTL  217
            D  QFP L
Sbjct  357  DQAQFPAL  364



>ref|NP_001148572.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACG32086.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=364

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe---ked  421
            TL+EYEK+LEEKRKA+L+ + EERKV +DKE ++M  L+ KK+ DEVF+KLGS+   K+ 
Sbjct  236  TLEEYEKVLEEKRKALLSLKAEERKVEIDKELQAMQQLSVKKDGDEVFIKLGSDKDLKKK  295

Query  420  kkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIE  241
            +  E  E+ KK+ SINEFLKPAEGE YY P GRGRGRG G  RGGY G        P+IE
Sbjct  296  ESAEREERGKKSLSINEFLKPAEGERYYNPSGRGRGRGRGGFRGGYNGGYRGPAAAPAIE  355

Query  240  DVGQFPTL  217
            D  QFP L
Sbjct  356  DQAQFPAL  363



>gb|KHN11561.1| hypothetical protein glysoja_006014 [Glycine soja]
Length=170

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ ++F+KLGS+K+ +K+
Sbjct  42   TLEEYEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKE  100

Query  411  e--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
                 EK KK+ SI EFLKPAEGE YY PG          G GGY G+ T++   PSIED
Sbjct  101  AFEKEEKSKKSVSITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGYHGSATNNAPAPSIED  160

Query  237  VGQFPTLGSK  208
             G FPTL +K
Sbjct  161  PGHFPTLSAK  170



>ref|XP_009410905.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=387

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 92/136 (68%), Gaps = 8/136 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEKL EEKRKA+LA + EERKV +D+E +SM  L+ KK +D+VFVKLGS+K+  KK
Sbjct  252  TLEEYEKLREEKRKALLALKNEERKVEIDEELQSMKQLSVKKGNDDVFVKLGSDKDTGKK  311

Query  411  eage----kvkktKSINEFLKPAEGETyyr--pggrgrgrghgsgrggygGNNTSSF--E  256
            +       + KK+  I EFLKPAEGE YY     GRGRGRG     GG  G   S+F   
Sbjct  312  KENADRDERSKKSMRITEFLKPAEGERYYSPGGRGRGRGRGGRGQYGGGFGGGVSTFPAA  371

Query  255  TPSIEDVGQFPTLGSK  208
             PSIED GQFPTLG K
Sbjct  372  APSIEDPGQFPTLGGK  387



>ref|XP_004150996.1| PREDICTED: uncharacterized protein LOC101210473 [Cucumis sativus]
 ref|XP_004166647.1| PREDICTED: uncharacterized LOC101210473 [Cucumis sativus]
 gb|KGN46514.1| hypothetical protein Csa_6G105680 [Cucumis sativus]
Length=360

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedk  418
            TL+EYEKLL+EKRK++LA + EERKV   KEF S+  L++KK + ++F+KLGS  +K  +
Sbjct  231  TLEEYEKLLDEKRKSLLALKTEERKVD-PKEFASLQQLSSKKENQDIFIKLGSDKDKRKE  289

Query  417  kkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIE  241
              +  E+ KK+ SINEFLKPAEGE +Y PGGRGRGRG GS  GGY G++ SS    PSIE
Sbjct  290  TADKEERTKKSVSINEFLKPAEGEKHYTPGGRGRGRGRGSRGGGYVGSSMSSNVAAPSIE  349

Query  240  DVGQFPTLGSK  208
            D GQFPTLG+K
Sbjct  350  DPGQFPTLGAK  360



>ref|XP_008810382.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Phoenix dactylifera]
Length=373

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 86/135 (64%), Gaps = 9/135 (7%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+ EEKRKA+LA + EERKV +D+E +SM  L+ KK +D+VF+KLGS+K+  KK
Sbjct  238  TLEEYEKIREEKRKALLALKTEERKVEIDQELQSMQQLSLKKRNDDVFMKLGSDKDTGKK  297

Query  411  e----agekvkktKSINEFLKPAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSF  259
            +      E+ KK  SINEFLKPAEGE          G     RG   G  G G  + +  
Sbjct  298  KDVADRDERAKKPVSINEFLKPAEGERYYSPVGRGRGRARGDRGQFRGGFGGGRGSGAPA  357

Query  258  ETPSIEDVGQFPTLG  214
              PSIED GQFPTLG
Sbjct  358  TAPSIEDPGQFPTLG  372



>ref|XP_006654864.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=379

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 93/137 (68%), Gaps = 9/137 (7%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe---ked  421
            TL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK+++EVF+KLGS+   K+ 
Sbjct  243  TLEEYEKVLEEKRKALLALKAEERKVEVDKELQSMQQLSVKKDNEEVFIKLGSDKDLKKK  302

Query  420  kkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF------  259
            +  E  E+ KK+ SINEFLKPAEGE YY P GRGRGRG G G         +        
Sbjct  303  EIAERDERAKKSLSINEFLKPAEGERYYNPSGRGRGRGRGRGEHRGFYGGFNGNGGRRHA  362

Query  258  ETPSIEDVGQFPTLGSK  208
              P+IED  QFP+LG K
Sbjct  363  SAPAIEDQAQFPSLGGK  379



>gb|KHN27127.1| hypothetical protein glysoja_032895 [Glycine soja]
Length=319

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 119/191 (62%), Gaps = 21/191 (11%)
 Frame = -1

Query  720  GVVNDGVNTDAF----------------EKQHGQED-AGDAKKDSPldepevkepedkeL  592
            G  N GV TD F                EK  G++D A    K++P +E E KEPEDKE+
Sbjct  130  GRGNWGVQTDEFAQATDEVNETSKNFGDEKPSGEDDVAAIGNKENPANEAEEKEPEDKEM  189

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEE+RKA+ A + EERKV   K FESM  L+NKK+ D++F+KLGS+K+ +++
Sbjct  190  TLEEYEKVLEERRKALQALKTEERKVDT-KVFESMQQLSNKKDIDDIFIKLGSDKDKRRE  248

Query  411  eagekvkktKS--INEFLKPAEGETyyr-pggrgrgrghgsgrggygGNNTSSFETPSIE  241
               ++ K  KS  INEFLK  EGE+YY   G   R       RGGYGG  T++   PSIE
Sbjct  249  TLEKEDKSKKSVNINEFLKSPEGESYYNPGGHGRRHGRGRGARGGYGGYATANIPAPSIE  308

Query  240  DVGQFPTLGSK  208
            D GQFPTLG K
Sbjct  309  DPGQFPTLGVK  319



>ref|XP_008798813.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Phoenix dactylifera]
Length=373

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 109/163 (67%), Gaps = 5/163 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILA-SRPEERKVCL  508
            EK  G+ED     K++   E + KEPEDKE+TLDEYEKLLEEKRKA+ A  + EERKV +
Sbjct  210  EKPVGEEDGVAVDKENAPGETKEKEPEDKEMTLDEYEKLLEEKRKALQALQKIEERKVDV  269

Query  507  DKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS----INEFLKPAEGETy  340
            DKEFE M  L+ KKN+D+VF+KLGSE+E  ++      + +      IN FL+PAE E +
Sbjct  270  DKEFEFMQQLSAKKNNDDVFIKLGSERESARRRDAADREDSARRPAIINTFLRPAEEERH  329

Query  339  yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  211
            Y PGGRGRGRG    RGG+G   T +   PSIED G FPTLG 
Sbjct  330  YNPGGRGRGRGGRGARGGFGRTGTMNTPPPSIEDPGHFPTLGG  372



>ref|XP_008798814.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Phoenix dactylifera]
Length=372

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 109/163 (67%), Gaps = 5/163 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILA-SRPEERKVCL  508
            EK  G+ED     K++   E + KEPEDKE+TLDEYEKLLEEKRKA+ A  + EERKV +
Sbjct  209  EKPVGEEDGVAVDKENAPGETKEKEPEDKEMTLDEYEKLLEEKRKALQALQKIEERKVDV  268

Query  507  DKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS----INEFLKPAEGETy  340
            DKEFE M  L+ KKN+D+VF+KLGSE+E  ++      + +      IN FL+PAE E +
Sbjct  269  DKEFEFMQQLSAKKNNDDVFIKLGSERESARRRDAADREDSARRPAIINTFLRPAEEERH  328

Query  339  yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  211
            Y PGGRGRGRG    RGG+G   T +   PSIED G FPTLG 
Sbjct  329  YNPGGRGRGRGGRGARGGFGRTGTMNTPPPSIEDPGHFPTLGG  371



>ref|XP_003556572.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Glycine max]
Length=332

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 119/191 (62%), Gaps = 21/191 (11%)
 Frame = -1

Query  720  GVVNDGVNTDAF----------------EKQHGQED-AGDAKKDSPldepevkepedkeL  592
            G  N GV TD F                EK  G++D A    K++P +E E KEPEDKE+
Sbjct  143  GRGNWGVQTDEFAQATDEVNETSKNFGDEKPSGEDDVAAIGNKENPANEAEEKEPEDKEM  202

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEE+RKA+ A + EERKV   K FESM  L+NKK+ D++F+KLGS+K+ +++
Sbjct  203  TLEEYEKVLEERRKALQALKTEERKVDT-KVFESMQQLSNKKDIDDIFIKLGSDKDKRRE  261

Query  411  eagekvkktKS--INEFLKPAEGETyyr-pggrgrgrghgsgrggygGNNTSSFETPSIE  241
               ++ K  KS  INEFLK  EGE+YY   G   R       RGGYGG  T++   PSIE
Sbjct  262  TLEKEDKSKKSVNINEFLKSPEGESYYNPGGHGRRHGRGRGARGGYGGYATANIPAPSIE  321

Query  240  DVGQFPTLGSK  208
            D GQFPTLG K
Sbjct  322  DPGQFPTLGVK  332



>ref|XP_004969088.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Setaria italica]
Length=371

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 94/134 (70%), Gaps = 6/134 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L  + E RKV +DKE +SM  L+ KK  DE+F+KLGS+KE KK+
Sbjct  238  TLEEYEKVLEEKRKALLGLKTEVRKVEVDKELQSMQQLSVKKGSDEIFIKLGSDKEKKKE  297

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TP  250
             A    + KK+ SINEFLKPAEGE YY PGGRGRGRG G G  G   +  S  E     P
Sbjct  298  NAERDERAKKSVSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRSGYSPREPGALAP  357

Query  249  SIEDVGQFPTLGSK  208
            +I+D  QFP+LG K
Sbjct  358  AIQDQAQFPSLGGK  371



>ref|XP_009396539.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=385

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 91/135 (67%), Gaps = 7/135 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+ EEKRKA+LA + EERKV +D+E +SM  L+ KK +D+VFVKLGS+K+  KK
Sbjct  251  TLEEYEKVREEKRKALLAMKNEERKVEIDEELQSMKQLSVKKGNDDVFVKLGSDKDIGKK  310

Query  411  e----agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF---ET  253
            +      E+ KK+ SINEFLKP EGE      GRGRGRG     G   G   S+F     
Sbjct  311  KENIDRDERSKKSMSINEFLKPTEGERNRGGRGRGRGRGGRGQFGSGFGGEGSTFAAAAA  370

Query  252  PSIEDVGQFPTLGSK  208
            PSIED GQFPTLG K
Sbjct  371  PSIEDPGQFPTLGGK  385



>ref|XP_003567795.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brachypodium distachyon]
Length=381

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 88/139 (63%), Gaps = 11/139 (8%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe---ked  421
            TL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK  DEVF+KLGS+   K+ 
Sbjct  243  TLEEYEKVLEEKRKALLALKAEERKVEVDKELQSMQQLSVKKVADEVFIKLGSDKELKKK  302

Query  420  kkkeagekvkktKSINEFLKPAEGE--------TyyrpggrgrgrghgsgrggygGNNTS  265
            +  E  E+ KK+ SINEFLKPAEGE              GRG  RG  +G G  GG    
Sbjct  303  ENAEREERAKKSLSINEFLKPAEGERYNPGGRGRGRGFRGRGELRGGYNGGGYNGGGGRR  362

Query  264  SFETPSIEDVGQFPTLGSK  208
                P+IED  QFPTLG K
Sbjct  363  QAPAPAIEDQAQFPTLGGK  381



>gb|ABR25759.1| nuclear antigen [Oryza sativa Indica Group]
Length=243

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 2/84 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS+K+ KK+
Sbjct  131  TLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKE  190

Query  411  --eagekvkktKSINEFLKPAEGE  346
              E  E+ +K+ SINEFLKPAEGE
Sbjct  191  NVERDERTRKSLSINEFLKPAEGE  214



>emb|CDY40563.1| BnaC02g33290D [Brassica napus]
Length=330

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 122/185 (66%), Gaps = 9/185 (5%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EE    V    V     EK+ G++D  DAKKD+P DE + KEPEDKE+TL+EY
Sbjct  150  DDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDTPADEGKEKEPEDKEMTLEEY  205

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--kea  406
            EK+LEEK+KA+ A++ EERKV   K FESM  L++KK N++E+F+KLGS+K+ +K   E 
Sbjct  206  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEK  264

Query  405  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQ  229
             EK KK+ SINEFLKPA+GE Y   GG  RGRG  +G  G      +     P+I D  Q
Sbjct  265  EEKAKKSLSINEFLKPADGERYNPRGGGYRGRGGRNGGRGQRDEKVNEGAPAPAIGDSAQ  324

Query  228  FPTLG  214
            FP+LG
Sbjct  325  FPSLG  329



>emb|CDX76586.1| BnaA08g08140D [Brassica napus]
Length=342

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 115/173 (66%), Gaps = 11/173 (6%)
 Frame = -1

Query  705  GVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPE  526
            GV T   EK  G E A DAKK++  +  E KEPEDKE+TLDEYEK+LEEK+K++ +    
Sbjct  174  GVET---EKPAGDEVAADAKKENTAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTS  230

Query  525  ERKVCLDKEFESMALLAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEG  349
            ERKV   K FESM  L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG
Sbjct  231  ERKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEG  289

Query  348  ETyyrpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  208
            E YYR GGRG GRG G G    G  +   F+       P+I D  QFP+LG K
Sbjct  290  ENYYRGGGRGGGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  342



>ref|XP_010449709.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=352

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 87/132 (66%), Gaps = 5/132 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +DE+F+KLGS+K+ +K 
Sbjct  222  TLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKD  280

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGN----NTSSFETPSI  244
            +  EK KK  SINEFLKPAEGE YYR G  GRGRG      G   N       +   P+I
Sbjct  281  DKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSNEEHVGYRNEAAPAI  340

Query  243  EDVGQFPTLGSK  208
            ED  QFP+LG K
Sbjct  341  EDTAQFPSLGGK  352



>ref|XP_010449710.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=263

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 87/132 (66%), Gaps = 5/132 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +DE+F+KLGS+K+ +K 
Sbjct  133  TLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKD  191

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGN----NTSSFETPSI  244
            +  EK KK  SINEFLKPAEGE YYR G  GRGRG      G   N       +   P+I
Sbjct  192  DKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSNEEHVGYRNEAAPAI  251

Query  243  EDVGQFPTLGSK  208
            ED  QFP+LG K
Sbjct  252  EDTAQFPSLGGK  263



>ref|XP_006280739.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
 gb|EOA13637.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
Length=346

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 118/183 (64%), Gaps = 9/183 (5%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  EE    V      + A EKQ G ED  DA K++   E   KE EDKE+TL+EY
Sbjct  170  DDIAPATEEATTEVEK----SPAAEKQGG-EDETDASKEAAAAEQAQKEAEDKEMTLEEY  224

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN ++E+FVKLGS ++DK+K+A E
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTEEEIFVKLGS-EKDKRKDAAE  282

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIEDVGQFP  223
            K KK+ SINEFLKPA+GETY   GG     G G      GGN +      P I D  QFP
Sbjct  283  KAKKSLSINEFLKPAKGETYNPRGGNRGRGGRGGREQRGGGNQSHREAAAPVIGDTAQFP  342

Query  222  TLG  214
            +LG
Sbjct  343  SLG  345



>gb|ACL54182.1| unknown [Zea mays]
 gb|ACN34418.1| unknown [Zea mays]
Length=204

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EK+ EEKRKA+LA + EERKV +DK+ +S+  L+NKK +DEVF+KLGS+K+ KK+
Sbjct  72   TLEEFEKIREEKRKALLALKAEERKVEVDKDLQSLQPLSNKKENDEVFIKLGSDKDKKKE  131

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS---SFETPS  247
             A    + KK+ SINEFLKPAEGE YY   GRGRGRG   G  G  G   S   +   PS
Sbjct  132  NAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPS  191

Query  246  IEDVGQFPTLGSK  208
            IED  QFP+LG K
Sbjct  192  IEDQAQFPSLGGK  204



>gb|ABD64914.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 114/190 (60%), Gaps = 16/190 (8%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EEP   V    V     EK+ G++   DAKK++P  E E ++ E    TL+EY
Sbjct  155  DDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEAPEVEQEPEDKEM---TLEEY  207

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--kea  406
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K   E 
Sbjct  208  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSNDEEIFIKLGSDKDKRKDAAEK  266

Query  405  gekvkktKSINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIE  241
             EK KK+ SINEFLKPA GET      YR  G    R      GG   N  +S   P+I 
Sbjct  267  EEKAKKSLSINEFLKPANGETYNPRGGYRGRGGRGQRDGKVNGGGNQRNGGASAPAPAIG  326

Query  240  DVGQFPTLGS  211
            D  QFP+L S
Sbjct  327  DSAQFPSLAS  336



>ref|XP_010449600.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 [Camelina 
sativa]
Length=387

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 98/138 (71%), Gaps = 6/138 (4%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  +E     V   V  D   KQ G+ +A DA K++P +E   KEPE+KE+TL+EY
Sbjct  172  DDIAPVTDEST-AAVEKNVTVD---KQGGEGEATDANKETPAEEQPEKEPENKEMTLEEY  227

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  228  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREE  286

Query  399  kvkktKSINEFLKPAEGE  346
            K KK+ SINEFLKPA GE
Sbjct  287  KTKKSLSINEFLKPANGE  304



>ref|XP_009108277.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Brassica rapa]
Length=273

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 111/167 (66%), Gaps = 8/167 (5%)
 Frame = -1

Query  687  FEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCL  508
             EK  G E   DAKK++  +  E KEPEDKE+TLDEYEK+LEEK+K++ +    ERKV  
Sbjct  108  IEKPAGDEVVADAKKENAAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT  167

Query  507  DKEFESMALLAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrp  331
             K FESM  L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR 
Sbjct  168  -KVFESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRG  226

Query  330  ggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  208
            GGRG GRG G G    G  +   F+       P+I D  QFP+LG K
Sbjct  227  GGRGGGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  273



>gb|ABD65038.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 120/185 (65%), Gaps = 9/185 (5%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EE    V    V     EK+ G++D  DAKKD P DE + KEPEDKE+TL+EY
Sbjct  156  DDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDPPADEGKEKEPEDKEMTLEEY  211

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FESM  L++KK N++E+F+KLGS+K+ +K  A +
Sbjct  212  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEK  270

Query  399  kvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQ  229
            + K  K  SINEFLKPA+GE Y   GG  RGRG  +G  G      +     P+I D  Q
Sbjct  271  EEKAKKSFSINEFLKPADGERYNPRGGGYRGRGGRNGGRGQRDEKVNEGAPAPAIGDSAQ  330

Query  228  FPTLG  214
            FP+LG
Sbjct  331  FPSLG  335



>ref|XP_002870130.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46389.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 89/131 (68%), Gaps = 4/131 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS+K+ +K 
Sbjct  229  TLDEYEKILEEKKKALQSLATSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKD  287

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---TPSIE  241
            E  EK KK  SINEFLKPAEGE YYR GGRG     G GRGG     +  +     P+I 
Sbjct  288  EKEEKAKKAVSINEFLKPAEGENYYRGGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIG  347

Query  240  DVGQFPTLGSK  208
            D  QFP+LG K
Sbjct  348  DAAQFPSLGGK  358



>ref|XP_010434652.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=389

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 98/138 (71%), Gaps = 6/138 (4%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  +E    V  +       EKQ G+ +A DA K++P +E   KEPE+KE+TL+EY
Sbjct  175  DDIAPVTDESTAAVEKNVT----VEKQGGEGEATDANKETPAEEQPEKEPENKEMTLEEY  230

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  231  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVMEREE  289

Query  399  kvkktKSINEFLKPAEGE  346
            K KK+ SINEFLKPA GE
Sbjct  290  KTKKSLSINEFLKPANGE  307



>emb|CDY67886.1| BnaCnng56800D [Brassica napus]
Length=361

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 115/190 (61%), Gaps = 16/190 (8%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EEP   V    V     EK+ G++   DAKK++P  E E ++ E    TL+EY
Sbjct  180  DDIQPATEEPTTEVEKSPVA----EKEGGEDATTDAKKEAPEVEQEPEDKEM---TLEEY  232

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--kea  406
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K   E 
Sbjct  233  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSNDEEIFIKLGSDKDKRKDAAEK  291

Query  405  gekvkktKSINEFLKPAEGETy-----yrpggrgrgrghgsgrggygGNNTSSFETPSIE  241
             EK KK+ SINEFLKPA GETY     YR  G    R      GG   N  +S   P+I 
Sbjct  292  EEKAKKSLSINEFLKPANGETYNPRGGYRGRGGRGQRDGKVNGGGNQRNGGASAPAPAIG  351

Query  240  DVGQFPTLGS  211
            D  QFP+L S
Sbjct  352  DSAQFPSLAS  361



>gb|EAY74854.1| hypothetical protein OsI_02745 [Oryza sativa Indica Group]
Length=380

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 83/135 (61%), Gaps = 7/135 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS+K+ KK+
Sbjct  243  TLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKE  302

Query  411  eage--kvkktKSINEFLKPAEGETyyr-----pggrgrgrghgsgrggygGNNTSSFET  253
                  + +K+ SINEFLKPAEGE YY       G          G    G ++      
Sbjct  303  NVERDERTRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGRGDRGGFRDGYSSRGPVAA  362

Query  252  PSIEDVGQFPTLGSK  208
            P IED  QFP L  +
Sbjct  363  PRIEDQAQFPGLAGR  377



>ref|XP_002440366.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
 gb|EES18796.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
Length=378

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 85/133 (64%), Gaps = 8/133 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe---ked  421
            TL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK+ DEVF+KLGS+   K+ 
Sbjct  245  TLEEYEKVLEEKRKALLALKAEERKVEIDKELQSMQQLSVKKDADEVFIKLGSDKDLKKK  304

Query  420  kkkeagekvkktKSINEFLKPAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSFE  256
            +  E  E+ KK+ SINEFLKPAEGE     +    G        G  RGGY G+      
Sbjct  305  ENAEREERAKKSLSINEFLKPAEGERYYNPSSRGRGRGRGRGERGGFRGGYNGSYRGPAA  364

Query  255  TPSIEDVGQFPTL  217
             P+IED  QFP L
Sbjct  365  APAIEDQAQFPAL  377



>emb|CDY33522.1| BnaA06g35510D [Brassica napus]
Length=327

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 106/161 (66%), Gaps = 10/161 (6%)
 Frame = -1

Query  669  QEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  490
            ++D  DAKKDSP  E E KEPEDKE+TL+EYEK+LEEK+KA+ A++ EERKV   K FES
Sbjct  167  EDDTTDAKKDSPAAEQEEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFES  225

Query  489  MALLANKK-NDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGE------Tyy  337
            M  L+NKK ND+E+F+KLGS+K+ +K  A ++ K  K  SINEFLKPA+GE        Y
Sbjct  226  MQQLSNKKTNDEEIFIKLGSDKDKRKDAAEKEEKTKKSLSINEFLKPADGERYNNPRGGY  285

Query  336  rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  214
            R  G   GR  G G+   G         P+I D  QFP+LG
Sbjct  286  RGRGGRGGRRDGRGQRDGGNQRHGGAPAPAIGDSAQFPSLG  326



>emb|CDY43435.1| BnaAnng07070D [Brassica napus]
Length=339

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 112/193 (58%), Gaps = 20/193 (10%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EEP   V    V     EK+ G++   DAKK++P  E E ++ E    TL+EY
Sbjct  154  DDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEAPEVEQEPEDKEM---TLEEY  206

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--kea  406
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K   E 
Sbjct  207  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTNDEEIFIKLGSDKDKRKDAAEK  265

Query  405  gekvkktKSINEFLKPAEGET---------yyrpggrgrgrghgsgrggygGNNTSSFET  253
             EK KK+ SINEFLKPA GET              G    R      GG   N  +S   
Sbjct  266  EEKAKKSLSINEFLKPANGETYNPRGGYRGRGGRSGGRGQRDGKVNGGGNQRNGGASAPA  325

Query  252  PSIEDVGQFPTLG  214
            P+I D  QFP+LG
Sbjct  326  PAIGDSAQFPSLG  338



>ref|XP_004140509.1| PREDICTED: uncharacterized protein LOC101209927 [Cucumis sativus]
 ref|XP_004166646.1| PREDICTED: uncharacterized LOC101209927 [Cucumis sativus]
 gb|KGN46515.1| hypothetical protein Csa_6G106180 [Cucumis sativus]
Length=361

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEKLLE+KRKA+LA + EERKV   KEF SM  L++KK+++++F+KLGSEK+ +K+
Sbjct  234  TLEEYEKLLEDKRKALLALKTEERKVD-PKEFASMQQLSSKKDNNDIFIKLGSEKDKRKE  292

Query  411  eagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             A ++ +  K  SINEFL+PA+GE  +   G          RGGY G+  S+   PSI D
Sbjct  293  MADKEERTKKSLSINEFLRPADGE-RHYAPGGRGRGRGRGSRGGYSGSPMSNVAAPSIGD  351

Query  237  VGQFPTLGSK  208
             GQFPTLG+K
Sbjct  352  PGQFPTLGAK  361



>ref|XP_009114287.1| PREDICTED: uncharacterized protein LOC103839539 [Brassica rapa]
Length=343

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 112/193 (58%), Gaps = 20/193 (10%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EEP   V    V     EK+ G++   DAKK++P  E E ++ E    TL+EY
Sbjct  158  DDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEAPEVEQEPEDKEM---TLEEY  210

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--kea  406
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K   E 
Sbjct  211  EKILEEKKKALQATKVEERKVDT-KAFESMQQLSNKKTNDEEIFIKLGSDKDKRKDAAEK  269

Query  405  gekvkktKSINEFLKPAEGET---------yyrpggrgrgrghgsgrggygGNNTSSFET  253
             EK KK+ SIN+FLKPA GET              G    R      GG   N  +S   
Sbjct  270  EEKAKKSLSINQFLKPANGETYNPRGGYRGRGGRSGGRGQRDGKVNGGGNQRNGGASAPA  329

Query  252  PSIEDVGQFPTLG  214
            P+I D  QFP+LG
Sbjct  330  PAIGDSAQFPSLG  342



>ref|XP_009128949.1| PREDICTED: suppressor protein STM1-like [Brassica rapa]
Length=337

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 101/140 (72%), Gaps = 8/140 (6%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EE    V    V     EK+ G++D  DAKKD+P DE + KEPEDKE+TL+EY
Sbjct  150  DDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDAPADEGKEKEPEDKEMTLEEY  205

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--kea  406
            EK+LEEK+KA+ A++ EERKV   K FESM  L++KK N++E+F+KLGS+K+ +K   E 
Sbjct  206  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEK  264

Query  405  gekvkktKSINEFLKPAEGE  346
             EK KK+ SINEFLKPA+GE
Sbjct  265  EEKAKKSLSINEFLKPADGE  284



>gb|KFK22256.1| hypothetical protein AALP_AAs66747U001100 [Arabis alpina]
Length=374

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 86/134 (64%), Gaps = 7/134 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS+K+ +K 
Sbjct  242  TLDEYEKILEEKKKALQSETVSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKD  300

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------TP  250
            +  EK KK  SINEFLKPAEGE Y+R GGRG     G G  G        F        P
Sbjct  301  DKEEKAKKAVSINEFLKPAEGENYHRGGGRGGRGRGGRGGRGGNSTGGGGFAGYRNEPAP  360

Query  249  SIEDVGQFPTLGSK  208
            +I D  QFP+LG K
Sbjct  361  AIADTAQFPSLGGK  374



>ref|XP_009108276.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Brassica rapa]
Length=342

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 111/167 (66%), Gaps = 8/167 (5%)
 Frame = -1

Query  687  FEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCL  508
             EK  G E   DAKK++  +  E KEPEDKE+TLDEYEK+LEEK+K++ +    ERKV  
Sbjct  177  IEKPAGDEVVADAKKENAAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT  236

Query  507  DKEFESMALLAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrp  331
             K FESM  L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR 
Sbjct  237  -KVFESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRG  295

Query  330  ggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  208
            GGRG GRG G G    G  +   F+       P+I D  QFP+LG K
Sbjct  296  GGRGGGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  342



>ref|XP_010440090.1| PREDICTED: uncharacterized protein LOC104723416 [Camelina sativa]
Length=132

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 86/132 (65%), Gaps = 5/132 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +DE+F+KLGS+K+ +K 
Sbjct  2    TLDEYEKILEEKKKALQSLTTSERKVD-TKVFESMQQLSNKKANDEIFIKLGSDKDKRKD  60

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGN----NTSSFETPSI  244
            +  EK KK  SINEFLKPAEGE YYR G  GRGRG      G   +       +   P+I
Sbjct  61   DKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSSEEHGGYRNEAAPAI  120

Query  243  EDVGQFPTLGSK  208
             D  QFP+LG K
Sbjct  121  GDTAQFPSLGGK  132



>ref|XP_004961035.1| PREDICTED: insulin receptor substrate 4-like [Setaria italica]
Length=373

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 86/134 (64%), Gaps = 9/134 (7%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe---ked  421
            TL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK+ DEVF+KLGS+   K+ 
Sbjct  239  TLEEYEKVLEEKRKALLALKAEERKVEIDKELQSMQQLSIKKDADEVFIKLGSDKDLKKK  298

Query  420  kkkeagekvkktKSINEFLKPAEGE------TyyrpggrgrgrghgsgrggygGNNTSSF  259
            +  E  E+ KK+ SINEFLKPAEGE         R   RGRG   G   G  GG    + 
Sbjct  299  ENAERDERAKKSLSINEFLKPAEGERYYNPSGRGRGRSRGRGERGGFYGGYNGGYRGPAA  358

Query  258  ETPSIEDVGQFPTL  217
              P+IED  QFP L
Sbjct  359  AAPAIEDQAQFPAL  372



>gb|KJB37649.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=307

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KE+TL+E
Sbjct  180  TDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEE  235

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  433
            YEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGS
Sbjct  236  YEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGS  283



>emb|CDY35615.1| BnaC01g21370D [Brassica napus]
Length=338

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 88/135 (65%), Gaps = 8/135 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKNDDEVFVKLGSekedkk  415
            TLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK++DE+F+KLGS+K+ +K
Sbjct  205  TLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRK  263

Query  414  keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF------ET  253
             +  EK KK  SINEFLKPA+GE YYR G  GRGRG    R      ++  +        
Sbjct  264  DDKEEKPKKAVSINEFLKPADGENYYRGGRGGRGRGGRESRDRGARASSGGYGGNRSEAA  323

Query  252  PSIEDVGQFPTLGSK  208
            P+I D  QFP+LG K
Sbjct  324  PAIADTAQFPSLGGK  338



>ref|NP_001281195.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACF84633.1| unknown [Zea mays]
 gb|ACR38621.1| unknown [Zea mays]
 tpg|DAA57852.1| TPA: hypothetical protein ZEAMMB73_322547 [Zea mays]
Length=378

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EK+ EEKRKA+LA + EERKV +DK+ +S+  L+NKK +DEVF+KLGS+K+ KK+
Sbjct  246  TLEEFEKIREEKRKALLALKAEERKVEVDKDLQSLQPLSNKKENDEVFIKLGSDKDKKKE  305

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS---SFETPS  247
             A    + KK+ SINEFLKPAEGE YY   GRGRGRG   G  G  G   S   +   PS
Sbjct  306  NAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPS  365

Query  246  IEDVGQFPTLGSK  208
            IED  QFP+LG K
Sbjct  366  IEDQAQFPSLGGK  378



>ref|XP_006414296.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
 gb|ESQ55749.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
Length=359

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 111/167 (66%), Gaps = 6/167 (4%)
 Frame = -1

Query  693  DAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKV  514
            +A EK  G + A DA K++  +  E KEPE+KE+TLDEYEK+LEEK+KA+ +    ERKV
Sbjct  194  NAVEKPAGDDVAADANKENTAEAEEEKEPENKEMTLDEYEKILEEKKKALQSQTTSERKV  253

Query  513  CLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyr  334
               K FESM  L+NKK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR
Sbjct  254  DT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYR  312

Query  333  pggrgrgrghgsgrggygGNNTS-----SFETPSIEDVGQFPTLGSK  208
             GGRG     G GRG  G ++       S   P I D  QFP+LG K
Sbjct  313  GGGRGGRERGGRGRGRGGASSGGFGGHRSEAAPVIGDTAQFPSLGGK  359



>gb|ACG24258.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=360

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 119/199 (60%), Gaps = 24/199 (12%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EE    VV+  +     EKQ G+ +A DAK ++P ++ E K  + +  TL+EY
Sbjct  167  DDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPAEKAEEKPEDKEM-TLEEY  221

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  222  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREE  280

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------------  256
            K +K+ SINEFLKPA+G++YYRP G  +G   G G       +    +            
Sbjct  281  KTRKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNQREGGRNQRDGGA  340

Query  255  -----TPSIEDVGQFPTLG  214
                 TP+I D  QFPTLG
Sbjct  341  AAQAPTPAIGDSAQFPTLG  359



>gb|EAY99238.1| hypothetical protein OsI_21200 [Oryza sativa Indica Group]
Length=383

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 87/136 (64%), Gaps = 8/136 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS---eked  421
            TL+EYEK+LEEKRKA+LA + EERKV +DKE ++M  L+ KK ++EVF+KLGS    K+ 
Sbjct  248  TLEEYEKVLEEKRKALLALKAEERKVEVDKELQAMQQLSVKKANEEVFIKLGSDKDLKKK  307

Query  420  kkkeagekvkktKSINEFLKPAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSFE  256
            +K E  E+ KK+ SINEFLKPAEGE        R  GRGRG   G   G  G        
Sbjct  308  EKDEKDERTKKSLSINEFLKPAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAA  367

Query  255  TPSIEDVGQFPTLGSK  208
             P IED  QFP+LG K
Sbjct  368  APVIEDQAQFPSLGGK  383



>ref|NP_001056483.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|AAT38003.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 gb|AAT58811.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18397.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|EEE64880.1| hypothetical protein OsJ_19739 [Oryza sativa Japonica Group]
Length=383

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 87/136 (64%), Gaps = 8/136 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS---eked  421
            TL+EYEK+LEEKRKA+LA + EERKV +DKE ++M  L+ KK ++EVF+KLGS    K+ 
Sbjct  248  TLEEYEKVLEEKRKALLALKAEERKVEVDKELQAMQQLSVKKANEEVFIKLGSDKDLKKK  307

Query  420  kkkeagekvkktKSINEFLKPAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSFE  256
            +K E  E+ KK+ SINEFLKPAEGE        R  GRGRG   G   G  G        
Sbjct  308  EKDEKDERTKKSLSINEFLKPAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAA  367

Query  255  TPSIEDVGQFPTLGSK  208
             P IED  QFP+LG K
Sbjct  368  APVIEDQAQFPSLGGK  383



>ref|NP_193485.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
 emb|CAB10532.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78755.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL09735.1| AT4g17520/dl4795w [Arabidopsis thaliana]
 gb|AAL91151.1| unknown protein [Arabidopsis thaliana]
 gb|AAN65040.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83906.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
Length=360

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 119/199 (60%), Gaps = 24/199 (12%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EE    VV+  +     EKQ G+ +A DAK ++P ++ E K  + +  TL+EY
Sbjct  167  DDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPAEKAEEKPEDKEM-TLEEY  221

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  222  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREE  280

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN-----------------  271
            K +K+ SINEFLKPA+G++YYRP G  +G   G G       +                 
Sbjct  281  KTRKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNLREGGRNQRDGGA  340

Query  270  TSSFETPSIEDVGQFPTLG  214
             +   TP+I D  QFPTLG
Sbjct  341  AAQAPTPAIGDSAQFPTLG  359



>gb|ADE76006.1| unknown [Picea sitchensis]
Length=135

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 84/135 (62%), Gaps = 8/135 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKND-DEVFVKLGSekedk  418
            TLDEYE + EEKRKA+LA  + EERKV + KEFESM +L+NKK D D +F+KLG EKE  
Sbjct  2    TLDEYEIVREEKRKALLALKKVEERKVDV-KEFESMQVLSNKKKDEDAMFIKLGPEKEKI  60

Query  417  kkeage---kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF--ET  253
            KK       +V+K  SINEFLKPAEGE YY  G          G    G +   S   E 
Sbjct  61   KKIDAAENERVRKAVSINEFLKPAEGERYYSGGRVRGRGCGERGGFRGGYSGAYSNYPEA  120

Query  252  PSIEDVGQFPTLGSK  208
            PSIED  QFPTLG K
Sbjct  121  PSIEDPRQFPTLGGK  135



>gb|AAM64962.1| nuclear RNA binding protein A-like protein [Arabidopsis thaliana]
Length=360

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 119/199 (60%), Gaps = 24/199 (12%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+I P  EE    VV+  +     EKQ G+ +A DAK ++P ++ E K  + +  TL+EY
Sbjct  167  DDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPAEKAEEKPEDKEM-TLEEY  221

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  222  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREE  280

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN-----------------  271
            K +K+ SINEFLKPA+G++YYRP G  +G   G G       +                 
Sbjct  281  KTRKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNQREGGRNQRDGGA  340

Query  270  TSSFETPSIEDVGQFPTLG  214
             +   TP+I D  QFPTLG
Sbjct  341  AAQAPTPAIGDSAQFPTLG  359



>ref|XP_010434762.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
 ref|XP_010434763.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=347

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 84/130 (65%), Gaps = 3/130 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +DE+F+KLGS+K+ +K 
Sbjct  219  TLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKD  277

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE--TPSIED  238
            +  EK KK  SINEFLKPAEGE YYR G  GRGRG           +        P+I D
Sbjct  278  DKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRVSSEEHGGYRNEAAPAIGD  337

Query  237  VGQFPTLGSK  208
              QFP+LG K
Sbjct  338  TAQFPSLGGK  347



>emb|CDY65881.1| BnaAnng21260D [Brassica napus]
Length=333

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 87/129 (67%), Gaps = 4/129 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk  415
            TL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG++K+ + 
Sbjct  205  TLEEYEKVLEEKRKALQATKIEERKVDT-KAFETMQQLSSKKSNNDEVFIKLGTDKDKRP  263

Query  414  keagekvkktKSINEFLKPAEGETyyrp--ggrgrgrghgsgrggygGNNTSSFETPSIE  241
             E  EK KK+ SINEFLKPA GE Y     GGRGRG   G      G +  ++   P IE
Sbjct  264  VEKEEKTKKSLSINEFLKPANGERYRGADEGGRGRGAEGGGRGPKGGADRKAAAPAPKIE  323

Query  240  DVGQFPTLG  214
            D   FPTLG
Sbjct  324  DAAHFPTLG  332



>ref|NP_199532.1| Hyaluronan / mRNA binding family protein [Arabidopsis thaliana]
 dbj|BAA97154.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM98181.1| putative protein [Arabidopsis thaliana]
 gb|AAQ56814.1| At5g47210 [Arabidopsis thaliana]
 dbj|BAE98584.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95484.1| Hyaluronan / mRNA binding family protein [Arabidopsis thaliana]
Length=357

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 121/186 (65%), Gaps = 11/186 (6%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD---SPldepevkepedkeLTL  586
            D+I P +EEP   V    V     EKQ G+++  +AKK+       + E +E E +E+TL
Sbjct  178  DDIPPTSEEPTTEVEKSPV----AEKQGGEDETPEAKKELTAEEKAQKEAEEAEAREMTL  233

Query  585  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGSekedkkke  409
            +EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS  ++K+K+
Sbjct  234  EEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGS-DKEKRKD  291

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIEDVG  232
            A EK KK+ SINEFLKPA+G+ Y   GG  RGRG   GRG  G    +     P+I D  
Sbjct  292  ATEKAKKSLSINEFLKPADGKRYNGRGGGSRGRGGRGGRGEGGNQRYAKEAAAPAIGDTA  351

Query  231  QFPTLG  214
            QFP+LG
Sbjct  352  QFPSLG  357



>dbj|BAG90611.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 89/134 (66%), Gaps = 6/134 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----ke  424
            TL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS+    K+
Sbjct  88   TLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKK  147

Query  423  dkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETP  250
             +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P
Sbjct  148  KENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAP  207

Query  249  SIEDVGQFPTLGSK  208
             I+D  QFPTLG K
Sbjct  208  EIKDQSQFPTLGRK  221



>ref|XP_010481348.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=349

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 117/186 (63%), Gaps = 13/186 (7%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKE+TL+EY
Sbjct  171  DDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEY  224

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  ++E+FVKLGS  +DK+K+A E
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGS-DKDKRKDAAE  282

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TPSIEDVG  232
            K KK+ SINEFLKPA+G      GGRG   G G      G N   +       P+I D  
Sbjct  283  KTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTA  342

Query  231  QFPTLG  214
            QFP+LG
Sbjct  343  QFPSLG  348



>ref|XP_010441486.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 117/186 (63%), Gaps = 13/186 (7%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKE+TL+EY
Sbjct  171  DDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEY  224

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  ++E+FVKLGS  +DK+K+A E
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGS-DKDKRKDAAE  282

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TPSIEDVG  232
            K KK+ SINEFLKPA+G      GGRG   G G      G N   +       P+I D  
Sbjct  283  KTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTA  342

Query  231  QFPTLG  214
            QFP+LG
Sbjct  343  QFPSLG  348



>ref|XP_010439990.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Camelina 
sativa]
Length=390

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 97/138 (70%), Gaps = 6/138 (4%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  +E    V  +       EKQ G+ +A  A K++P +E   KEPE+KE+TL+EY
Sbjct  175  DDIAPVTDESTAAVEKNVT----VEKQSGEGEATIANKETPAEEQPEKEPENKEMTLEEY  230

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  231  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREE  289

Query  399  kvkktKSINEFLKPAEGE  346
            K KK+ SINEFLKPA GE
Sbjct  290  KTKKSLSINEFLKPANGE  307



>ref|XP_010481347.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=349

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 117/186 (63%), Gaps = 13/186 (7%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKE+TL+EY
Sbjct  171  DDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEY  224

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  ++E+FVKLGS  +DK+K+A E
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGS-DKDKRKDAAE  282

Query  399  kvkktKSINEFLKPAE----GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVG  232
            K KK+ SINEFLKPA+    G    R G  GRG     G G  G N       P+I D  
Sbjct  283  KTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGGNGGENQRRGPSAPAIGDTA  342

Query  231  QFPTLG  214
            QFP+LG
Sbjct  343  QFPSLG  348



>ref|XP_008675099.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Zea mays]
 gb|ACG33523.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 tpg|DAA57847.1| TPA: plasminogen activator inhibitor 1 RNA-binding protein [Zea 
mays]
Length=378

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EK+ EEKRKA+LA + EERKV +DK+  S+  L+NKK +DEVF+KLGS+K+ KK+
Sbjct  246  TLEEFEKIREEKRKALLALKAEERKVEVDKDLRSLQPLSNKKENDEVFIKLGSDKDKKKE  305

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS---SFETPS  247
             A    + KK+ SINEFLKPAEGE YY   GRGRGRG   G  G  G   S   +   PS
Sbjct  306  NAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPS  365

Query  246  IEDVGQFPTLGSK  208
            IED  QFP+LG K
Sbjct  366  IEDQAQFPSLGGK  378



>ref|XP_009145376.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 ref|XP_009145384.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 emb|CDY42945.1| BnaA01g18090D [Brassica napus]
Length=304

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKNDDEVFVKLGSekedkk  415
            TLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK++DE+F+KLGS+K+ +K
Sbjct  178  TLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRK  236

Query  414  keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDV  235
             +  EK KK  SINEFLKPAEGE YYR G  GRGRG     GG    N S    P+I D 
Sbjct  237  DDKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRVSSGGGFSGNRSEA-APAIADT  295

Query  234  GQFPTLGSK  208
             QFP+LG K
Sbjct  296  AQFPSLGGK  304



>ref|NP_001056139.1| Os05g0533100 [Oryza sativa Japonica Group]
 dbj|BAF18053.1| Os05g0533100, partial [Oryza sativa Japonica Group]
Length=286

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 89/134 (66%), Gaps = 6/134 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----ke  424
            TL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS+    K+
Sbjct  153  TLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKK  212

Query  423  dkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETP  250
             +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P
Sbjct  213  KENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAP  272

Query  249  SIEDVGQFPTLGSK  208
             I+D  QFPTLG K
Sbjct  273  EIKDQSQFPTLGRK  286



>gb|AAM63072.1| nuclear RNA binding protein A-like protein [Arabidopsis thaliana]
Length=357

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 121/186 (65%), Gaps = 11/186 (6%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD---SPldepevkepedkeLTL  586
            D+I P +EEP   V    V     EKQ G+++  +AKK+       + E +E E +E+TL
Sbjct  178  DDIPPTSEEPTTEVEKSPV----AEKQGGEDETPEAKKELTAEEKAQKEAEEAEAREMTL  233

Query  585  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGSekedkkke  409
            +EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS  ++K+K+
Sbjct  234  EEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGS-DKEKRKD  291

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIEDVG  232
            A EK KK+ SINEFLKPA+G+ Y   GG  RGRG   GRG  G    +     P+I D  
Sbjct  292  ATEKAKKSLSINEFLKPADGKRYNGRGGGSRGRGGRGGRGEGGNQRYAKEAAAPAIGDTA  351

Query  231  QFPTLG  214
            QFP+LG
Sbjct  352  QFPSLG  357



>ref|XP_009145362.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
 ref|XP_009145369.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
Length=335

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKNDDEVFVKLGSekedkk  415
            TLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK++DE+F+KLGS+K+ +K
Sbjct  209  TLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRK  267

Query  414  keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDV  235
             +  EK KK  SINEFLKPAEGE YYR G  GRGRG     GG    N S    P+I D 
Sbjct  268  DDKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRVSSGGGFSGNRSEA-APAIADT  326

Query  234  GQFPTLGSK  208
             QFP+LG K
Sbjct  327  AQFPSLGGK  335



>gb|KJB24892.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=333

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDE+A   E     V N+G      EK  G+EDA +A K+S  +EPE KEPEDKE+TL+E
Sbjct  183  TDELAQVTE-----VTNEGERNLGDEKPAGEEDAREANKESASNEPEEKEPEDKEMTLEE  237

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  433
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKKN+DEVF+KLGS
Sbjct  238  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKNNDEVFIKLGS  285



>gb|EEE64473.1| hypothetical protein OsJ_19323 [Oryza sativa Japonica Group]
Length=392

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 89/134 (66%), Gaps = 6/134 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----ke  424
            TL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS+    K+
Sbjct  259  TLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKK  318

Query  423  dkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETP  250
             +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P
Sbjct  319  KENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAP  378

Query  249  SIEDVGQFPTLGSK  208
             I+D  QFPTLG K
Sbjct  379  EIKDQSQFPTLGRK  392



>dbj|BAJ98247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 84/133 (63%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKAILA + EERKV +DKE +SM  L+ KK+ +EVF+KLGS+KE KK 
Sbjct  39   TLEEYEKVLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGSDKEKKKD  98

Query  411  eagekvkktKS--INEFLKPAE---GETyyrpggrgrgrghgsgrggygGNNTSSFETPS  247
             A  + +  KS  INEFLKPAE          G   RGRG   G    GG        P+
Sbjct  99   NAEREERAKKSLNINEFLKPAEGERYNGGRGRGRGFRGRGEPRGGYNGGGGGRRPAAAPA  158

Query  246  IEDVGQFPTLGSK  208
            IED  QFPTLG K
Sbjct  159  IEDQSQFPTLGGK  171



>ref|XP_010494951.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 116/186 (62%), Gaps = 13/186 (7%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKE+TL+EY
Sbjct  171  DDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEY  224

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEK+KA+ A++ EERKV   K F+SM  L+NKK  ++E+FVKLGS  +DK+K+  E
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFDSMQQLSNKKTTEEEIFVKLGS-DKDKRKDTAE  282

Query  399  kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TPSIEDVG  232
            K KK+ SINEFLKPA+G      GGRG   G G      G N   +       P+I D  
Sbjct  283  KTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTA  342

Query  231  QFPTLG  214
            QFP+LG
Sbjct  343  QFPSLG  348



>ref|XP_003568032.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1 
[Brachypodium distachyon]
Length=376

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 90/135 (67%), Gaps = 7/135 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----ke  424
            TL+E+EK+LEEKRKA+LA + EERKV +DK+ ++M  L+ KK +DEVF+KLGS+    K+
Sbjct  242  TLEEFEKVLEEKRKALLALKSEERKVEIDKDLQAMQQLSTKKGNDEVFIKLGSDKDALKK  301

Query  423  dkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---T  253
             +  E  E+ KK+ SINEFLKPAEGE +Y   GRGRGRG   G    G            
Sbjct  302  KENAERDERAKKSVSINEFLKPAEGERFYGGRGRGRGRGGDRGGFRGGAGGGGYRGPPAA  361

Query  252  PSIEDVGQFPTLGSK  208
            P+I+D  QFPTLG K
Sbjct  362  PAIQDQNQFPTLGGK  376



>emb|CDY28966.1| BnaA02g25100D [Brassica napus]
Length=340

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLD  505
            EK+ G+++  DAKKD+P DE + KEPEDKE+TL+EYEK+LEEK+KA+ A++ EERKV   
Sbjct  173  EKEGGEDNTTDAKKDAPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-  231

Query  504  KEFESMALLANKK-NDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGE  346
            K FESM  L++KK N++E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA+GE
Sbjct  232  KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPADGE  287



>gb|EEC79581.1| hypothetical protein OsI_20751 [Oryza sativa Indica Group]
Length=381

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 89/134 (66%), Gaps = 6/134 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----ke  424
            TL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS+    K+
Sbjct  248  TLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKK  307

Query  423  dkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETP  250
             +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P
Sbjct  308  KENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAP  367

Query  249  SIEDVGQFPTLGSK  208
             I+D  QFPTLG K
Sbjct  368  EIKDQSQFPTLGRK  381



>gb|ABD65067.1| nuclear RNA binding protein, putative [Brassica oleracea]
 emb|CDY52558.1| BnaC08g48170D [Brassica napus]
Length=367

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 96/139 (69%), Gaps = 9/139 (6%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            DEI P  EE    V  D     A EK+    +A DA K++P++    KEPED E+TL+EY
Sbjct  157  DEIPPVTEESATVVEKD----LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEY  209

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEKRKA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  210  EKVLEEKRKALQATKVEERKVDT-KVFEAMQQLSSKKSNNDEVFIKLGTEKDKRPVEREE  268

Query  399  kvkktKSINEFLKPAEGET  343
            K KK+ SINEFLKPA GE+
Sbjct  269  KTKKSLSINEFLKPANGES  287



>gb|EMT12851.1| hypothetical protein F775_28068 [Aegilops tauschii]
Length=288

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 84/134 (63%), Gaps = 6/134 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk-  415
            TL+EYEK+LEEKRKAILA + EERKV +DKE +SM  L+ KK+ +EVF+KLGS+KE KK 
Sbjct  155  TLEEYEKVLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGSDKEKKKE  214

Query  414  -keagekvkktKSINEFLKPAE----GETyyrpggrgrgrghgsgrggygGNNTSSFETP  250
              E  E+ KK+ SINEFLKPAE         R  G         G  G GG        P
Sbjct  215  NTEREERAKKSLSINEFLKPAEGERYSGGRGRGRGFRGRGEARGGYNGGGGGGRRPAAAP  274

Query  249  SIEDVGQFPTLGSK  208
            +IED  QFPTLG K
Sbjct  275  AIEDQSQFPTLGGK  288



>ref|XP_002440127.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
 gb|EES18557.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
Length=373

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----ke  424
            TL+E+EK+ EEKRK++LA + EERKV +D++ +SM  LANKK +DE+FVKLGS+    K+
Sbjct  241  TLEEFEKIREEKRKSLLALKTEERKVEVDRDLQSMQPLANKKGNDEIFVKLGSDKDALKK  300

Query  423  dkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE-TPS  247
             +  +  E+ KK+ SINEFLKPAEGE YY   GRGRGRG   G  G  G    +    P+
Sbjct  301  KENADRDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYHAPPAAPA  360

Query  246  IEDVGQFPTLGSK  208
            I+D  QFP+LG K
Sbjct  361  IQDQSQFPSLGGK  373



>gb|EMT08444.1| hypothetical protein F775_29168 [Aegilops tauschii]
Length=833

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 77/173 (45%), Positives = 103/173 (60%), Gaps = 12/173 (7%)
 Frame = -1

Query  690  AFEKQHGQEDAGDAKKDSPldepev----kepedkeLTLDEYEKLLEEKRKAILA-SRPE  526
            A EKQ   EDA  A ++    +       ++ ED E+TLDE+EK++EEKRKA+ A  + E
Sbjct  224  APEKQGAPEDAPQADENKATKDGAAVVEEEKEEDNEMTLDEFEKVMEEKRKALAALKKSE  283

Query  525  ERKVCLDKEFESMALLANKKNDDEVFVKLGSeke----dkkkeagekvkktKSINEFLKP  358
            ERKV +DK+ ++M LL+ KK +DEVF+KLG++KE     +  E  E+ KK+ SINEFLKP
Sbjct  284  ERKVEIDKDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAEREERAKKSVSINEFLKP  343

Query  357  AEGETyyrpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLGSK  208
            AEGE +Y   GRG       G    G            P+I+D  QFPTLG K
Sbjct  344  AEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLGGK  396



>ref|XP_001760974.1| predicted protein [Physcomitrella patens]
 gb|EDQ74363.1| predicted protein [Physcomitrella patens]
Length=343

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 91/153 (59%), Gaps = 25/153 (16%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK++EEKRK + AS+  ERKV +DK FE M L++NKK ++++F+KLG EKE  K+
Sbjct  191  TLEEYEKVMEEKRKTLEASKASERKVEVDKAFEKMQLVSNKKREEDIFIKLGQEKEKSKR  250

Query  411  eagekvkktK---SINEFLKPAEGETy------yrpggrgrgrghgsgrggygGNNTSSF  259
            EA E+ +K++   SIN+FLKPAEGE         R G  GR     SG  G   +  S+F
Sbjct  251  EAAEREEKSRKPVSINQFLKPAEGEKSYFPSNRGRGGRGGRDDRRESGGRGNRESTRSNF  310

Query  258  ----------------ETPSIEDVGQFPTLGSK  208
                              P IED  QFPTLG+K
Sbjct  311  SAGRGGGGRGSAAGDASAPKIEDQAQFPTLGAK  343



>ref|XP_004969787.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
A-like [Setaria italica]
Length=375

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 85/131 (65%), Gaps = 3/131 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EK+ EEKRKA+LA + EER+V +DK+ +S+  L+NKK +DEVF+KLGS+K+ KK+
Sbjct  245  TLEEFEKIREEKRKALLALKAEERRVEVDKDLQSLQPLSNKKENDEVFIKLGSDKDKKKE  304

Query  411  eage--kvkktKSINEFLKPA-EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIE  241
             A    + KK+ SINEFLKPA     Y   G        G   G +GG +      P+IE
Sbjct  305  SAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGERGGRGGYFGGYHRGPAAAPAIE  364

Query  240  DVGQFPTLGSK  208
            D  QFP+LG K
Sbjct  365  DQAQFPSLGGK  375



>dbj|BAJ96699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 84/133 (63%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+LEEKRKAILA + EERKV +DKE +SM  L+ KK+ +EVF+KLGS+KE KK 
Sbjct  237  TLEEYEKVLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGSDKEKKKD  296

Query  411  eagekvkktKS--INEFLKPAE---GETyyrpggrgrgrghgsgrggygGNNTSSFETPS  247
             A  + +  KS  INEFLKPAE          G   RGRG   G    GG        P+
Sbjct  297  NAEREERAKKSLNINEFLKPAEGERYNGGRGRGRGFRGRGEPRGGYNGGGGGRRPAAAPA  356

Query  246  IEDVGQFPTLGSK  208
            IED  QFPTLG K
Sbjct  357  IEDQSQFPTLGGK  369



>gb|AAS75737.1| thermoinhibition-associated THB-4 protein [Tagetes minuta]
Length=115

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk-  415
            TL+EY+K+LEEKRKA+   + EERKV +DKE  SM  L+NKK++DE+F KLG++K+ +K 
Sbjct  18   TLEEYQKVLEEKRKALETLKTEERKVEVDKELASMQQLSNKKSNDEIFAKLGTDKDKRKE  77

Query  414  -keagekvkktKSINEFLKPAEGE  346
              E  E+ KK+ SINEFLKPA GE
Sbjct  78   LAEKEERAKKSLSINEFLKPAAGE  101



>gb|AAT47083.1| unknown protein [Oryza sativa Japonica Group]
Length=390

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 89/134 (66%), Gaps = 6/134 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----ke  424
            TL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS+    K+
Sbjct  257  TLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKK  316

Query  423  dkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETP  250
             +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P
Sbjct  317  KENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAP  376

Query  249  SIEDVGQFPTLGSK  208
             I+D  QFPTLG K
Sbjct  377  EIKDQSQFPTLGRK  390



>gb|KJB37650.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=284

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 5/107 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KE+TL+E
Sbjct  180  TDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEE  235

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  439
            YEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KL
Sbjct  236  YEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKL  281



>ref|XP_011101848.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=369

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 128/187 (68%), Gaps = 9/187 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA-GDAKKDSPldepevkepedkeLTLD  583
            TDE+A   EE    VVN+G  +   EK  G ED   D  K++       ++PEDKE+TL+
Sbjct  189  TDELAEVTEE----VVNEGEKSLNVEKPSGDEDPPADGDKEA-ATTEVEEKPEDKEMTLE  243

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedkkke  409
            EYEKLLEEKRKA+ A + EERKV + KEFE+M  LANKK +D+VF+KLGS  +K+ +  E
Sbjct  244  EYEKLLEEKRKALQALKTEERKVDV-KEFETMQQLANKKANDDVFIKLGSDKDKKKELAE  302

Query  408  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  229
              E+ KK+ SINEFLKPAEGE YY  GGRGRGRG GS  G  GG+   + E P+IED GQ
Sbjct  303  KEERAKKSVSINEFLKPAEGEAYYNRGGRGRGRGRGSRGGYTGGSKMGNAEAPAIEDPGQ  362

Query  228  FPTLGSK  208
            FPTLG K
Sbjct  363  FPTLGGK  369



>ref|XP_006285507.1| hypothetical protein CARUB_v10006948mg [Capsella rubella]
 gb|EOA18405.1| hypothetical protein CARUB_v10006948mg [Capsella rubella]
Length=363

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = -1

Query  738  AEEPINGVVNDGVNTD----AFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEK  571
            AE+ I  V ++    D      EKQ G+ +A DA K+   +E   KEPEDKE+TL+EYEK
Sbjct  169  AEDDIAPVTDESAAVDEKNLTVEKQGGEGEATDANKEISAEEQAEKEPEDKEMTLEEYEK  228

Query  570  LLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekv  394
            +LEEK+KA+ A++ EERKV   K FE+M  LANKK N+DEVF+KLG+EK+ +  E  EK 
Sbjct  229  VLEEKKKALQATKVEERKVDT-KAFEAMQQLANKKSNNDEVFIKLGTEKDKRITEREEKT  287

Query  393  kktKSINEFLKPA  355
            KK+ SINEFLKPA
Sbjct  288  KKSLSINEFLKPA  300



>ref|XP_002863351.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39610.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 118/192 (61%), Gaps = 17/192 (9%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD---SPldepevkepedkeLTL  586
            D+I P  EEP   V    V     EKQ G+++  +A K+       + E +E E +E+TL
Sbjct  177  DDIPPVTEEPTTEVEKSPV----AEKQGGEDETAEANKEPTAEEKAQKEAEEAEAREMTL  232

Query  585  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGSekedkkke  409
            +EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS ++DK+K+
Sbjct  233  EEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGS-EKDKRKD  290

Query  408  agekvkktKSINEFLKPAEGE-------TyyrpggrgrgrghgsgrggygGNNTSSFETP  250
            A EK KK+ SINEFLKPA+GE          R G  GRG     G GG   N   +   P
Sbjct  291  AAEKTKKSLSINEFLKPADGERYNGRGGHRGRGGCGGRGGREHRGDGGNQRNVKPAAPAP  350

Query  249  SIEDVGQFPTLG  214
            +I D  QFP+LG
Sbjct  351  AIGDTAQFPSLG  362



>ref|XP_003569708.1| PREDICTED: RNA-binding protein FUS-like [Brachypodium distachyon]
Length=377

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 5/133 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EK+ EEKRKA+LA + EERKV LDK+ +S+  L+ KK +DE+F+KLGS+K+ KK+
Sbjct  245  TLEEFEKIREEKRKALLALKTEERKVELDKDLQSLQPLSTKKANDEIFIKLGSDKDKKKE  304

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---TPS  247
             A    + KK+ SINEFLKPAEGE YY   GRGRG     G    G            PS
Sbjct  305  SAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGGRGDRGGFRGGYGGGGYQRGPAAPS  364

Query  246  IEDVGQFPTLGSK  208
            I+D  +FPTLG K
Sbjct  365  IQDQAEFPTLGGK  377



>ref|XP_006284012.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
 gb|EOA16910.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
Length=354

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS+K+ +K 
Sbjct  226  TLDEYEKILEEKKKALQSLTTTERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKD  284

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE--TPSIED  238
            +  EK KK  SINEFLKPAEG+ +YR G  GRGRG     G     +        P+I D
Sbjct  285  DKEEKAKKAVSINEFLKPAEGQNFYRGGRGGRGRGGRGRGGVSSEEHGGYRNEPAPAIGD  344

Query  237  VGQFPTLGSK  208
               FP+LG K
Sbjct  345  TTHFPSLGGK  354



>gb|EYU40365.1| hypothetical protein MIMGU_mgv1a008102mg [Erythranthe guttata]
Length=385

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRP--EERKVCLDKEFESMALLANKK-NDDEVFVKLGS--ek  427
            TL+EYEK+LEEKRK++LA +   E RKV + KEFESM  L++KK ++D++F+KLGS  +K
Sbjct  252  TLEEYEKVLEEKRKSLLALKADSEARKVDV-KEFESMQQLSSKKRSNDDIFIKLGSEKDK  310

Query  426  edkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-SFETP  250
            + +  E  E+ KK+ SINEFLKPAEGE +Y  GGRGRGRG GS  GG  G   + +   P
Sbjct  311  KKELAEKEERAKKSVSINEFLKPAEGERHYSSGGRGRGRGRGSRGGGGYGVGGNENVRAP  370

Query  249  SIEDVGQFPTLGSK  208
            +IED GQFPTLG K
Sbjct  371  AIEDPGQFPTLGGK  384



>ref|XP_009108330.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
 ref|XP_009108331.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
Length=367

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 96/139 (69%), Gaps = 9/139 (6%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            DE+ P  EE    V  D     A EK+    +A DA K++P++    KEPED E+TL+EY
Sbjct  157  DEVPPVTEESTTVVEKD----LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEY  209

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEKRKA+ +++ EERKV   K F+SM  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  210  EKVLEEKRKALQSTKVEERKVDT-KVFDSMQQLSSKKSNNDEVFIKLGTEKDKRPVEREE  268

Query  399  kvkktKSINEFLKPAEGET  343
            K KK+ SINEFLKPA GE+
Sbjct  269  KTKKSLSINEFLKPANGES  287



>gb|KFK24045.1| hypothetical protein AALP_AAs42697U000600 [Arabis alpina]
Length=393

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 93/141 (66%), Gaps = 13/141 (9%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeL--TLD  583
            D++AP  EE           T A EKQ  + +A DAKK+SP  E    EPE + +  TL+
Sbjct  179  DDVAPVTEE---------SKTVAVEKQGSKGEAADAKKESPAKEQAKSEPEPEPVEFTLE  229

Query  582  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkea  406
            EYEK++EEK+KA+  ++ EERKV   K F+SM  L+NK+ N+DEVF+KLG+EK+ +  E 
Sbjct  230  EYEKIMEEKKKALEVTKVEERKVDT-KVFDSMQQLSNKRSNNDEVFIKLGTEKDKRLVEK  288

Query  405  gekvkktKSINEFLKPAEGET  343
             EK KK+ SINEFLKP  G++
Sbjct  289  EEKAKKSLSINEFLKPVNGKS  309



>ref|XP_008811725.1| PREDICTED: uncharacterized protein LOC103722810 [Phoenix dactylifera]
Length=140

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 97/139 (70%), Gaps = 11/139 (8%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLG----Seke  424
            TL+EYEK+ EEKRKA+LAS+PEERKV LDK+FESM LL+ KK +D+VF+KLG    S K+
Sbjct  2    TLEEYEKIKEEKRKALLASKPEERKVELDKDFESMQLLSLKKGNDDVFMKLGTDKDSGKK  61

Query  423  dkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN-------TS  265
                +  E+VKK+ SI EFLKPAEGE YY PGGRG GRG G GRG             T 
Sbjct  62   RDNADREERVKKSFSITEFLKPAEGERYYSPGGRGFGRGRGRGRGDRRPFGDGFGSGVTV  121

Query  264  SFETPSIEDVGQFPTLGSK  208
            +   PSIED GQFPTLG K
Sbjct  122  NATAPSIEDPGQFPTLGGK  140



>gb|EPS72575.1| hypothetical protein M569_02184 [Genlisea aurea]
Length=362

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 84/128 (66%), Gaps = 7/128 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk-  415
            TL+EYEK+LEEKRK + + + EERKV   KEFE+M  L+NKK  D +F+KLGSEK+ KK 
Sbjct  240  TLEEYEKVLEEKRKGLQSLKTEERKVDA-KEFEAMQQLSNKKTGDHIFIKLGSEKDRKKE  298

Query  414  -keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
              E  E+ KK+ SINEFLK  EGE           RG G GRG  GG N    + PSIED
Sbjct  299  VAEKEERAKKSVSINEFLKAGEGEK----YYNNPSRGRGRGRGSRGGGNVGGVQAPSIED  354

Query  237  VGQFPTLG  214
             G+FP+LG
Sbjct  355  PGEFPSLG  362



>ref|XP_006414219.1| hypothetical protein EUTSA_v10025512mg [Eutrema salsugineum]
 gb|ESQ55672.1| hypothetical protein EUTSA_v10025512mg [Eutrema salsugineum]
Length=368

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 97/138 (70%), Gaps = 9/138 (7%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            DEI P  EE    VV   +   A EK  G+++A    KD+P+ E   +EPEDK +TL+EY
Sbjct  163  DEITPVTEESTT-VVEKNL---AVEKLGGEDEA---NKDTPVKEKAEEEPEDKSMTLEEY  215

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEKR+A+ A++ EERKV   K FE+M  +++KK N+D+VF+KLG+EK+ +  E  E
Sbjct  216  EKVLEEKRQALQATKVEERKVDT-KAFETMQQISSKKSNNDDVFIKLGTEKDKRTTEKEE  274

Query  399  kvkktKSINEFLKPAEGE  346
            K KK+ SINEFLKPA+GE
Sbjct  275  KTKKSLSINEFLKPADGE  292



>gb|EMS59053.1| hypothetical protein TRIUR3_33029 [Triticum urartu]
Length=296

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 90/136 (66%), Gaps = 8/136 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EK+ EE+RKA+LA + EERKV +DK+ +S+  L+ KK +DEVF+KLGS+KE KK+
Sbjct  161  TLEEFEKIREEQRKALLALKTEERKVEVDKDLQSLQPLSTKKANDEVFIKLGSDKEKKKE  220

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------  256
                  + KK+ SINEFLKPAEGE YY   GRGRGRG G G  G                
Sbjct  221  STERDERAKKSLSINEFLKPAEGERYYGGRGRGRGRGEGRGDRGGFRGGFGGGYQRGQAA  280

Query  255  TPSIEDVGQFPTLGSK  208
             PSIED  QFPTLG K
Sbjct  281  APSIEDRSQFPTLGGK  296



>emb|CDX76567.1| BnaA08g08330D [Brassica napus]
Length=367

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 96/139 (69%), Gaps = 9/139 (6%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEY  577
            DE+ P  EE    V  D     A EK+    +A DA K++P++    KEPED E+TL+EY
Sbjct  157  DELPPVTEESTTVVEKD----LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEY  209

Query  576  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeage  400
            EK+LEEKRKA+ +++ EERKV   K F+SM  L++KK N+DEVF+KLG+EK+ +  E  E
Sbjct  210  EKVLEEKRKALQSTKVEERKVDT-KVFDSMQQLSSKKSNNDEVFIKLGTEKDKRPVEREE  268

Query  399  kvkktKSINEFLKPAEGET  343
            K KK+ SINEFLKPA GE+
Sbjct  269  KTKKSLSINEFLKPANGES  287



>ref|NP_001078399.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83810.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=265

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS+K+ +K 
Sbjct  137  TLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKD  195

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE--TPSIED  238
            +  EK KK  SINEFLKPAEG  YYR G  GRGRG     G   G +        P+I D
Sbjct  196  DKEEKAKKAVSINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGD  255

Query  237  VGQFPTLGSK  208
              QFP+LG K
Sbjct  256  AAQFPSLGGK  265



>gb|KEH17858.1| nuclear RNA-binding-like protein [Medicago truncatula]
Length=373

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 115/191 (60%), Gaps = 13/191 (7%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAG--DAKKDSPldepevkepedkeLTL  586
            +DEIA   +E    V N+     A +K  G+EDA   D  K++P  E E KEPEDKE+TL
Sbjct  186  SDEIAQVTDE----VANETEKNVAEDKPVGEEDAAAADGNKETPAPEAEEKEPEDKEMTL  241

Query  585  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkea  406
            +EYEK+LEEKRKA+       RKV   KEFES+  L+ KK +DE+F KLGS+K+ +K   
Sbjct  242  EEYEKVLEEKRKALNVKTDGGRKVDT-KEFESLKPLSCKKENDEIFAKLGSDKDRRKDAI  300

Query  405  gekvkktK-SINEFLKPAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSFETPSI  244
             ++  +   SINEFLKPAEGE           G   GRG   G GGYGGN   +   PSI
Sbjct  301  EKEKARKALSINEFLKPAEGEKYYNPGGRGGRGGRGGRGGSRGGGGYGGNAYGNVSAPSI  360

Query  243  EDVGQFPTLGS  211
            ED GQFPTLG 
Sbjct  361  EDPGQFPTLGG  371



>ref|NP_193416.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAF14243.1|AF110227_1 nuclear RNA binding protein [Arabidopsis thaliana]
 emb|CAB10456.1| nuclear antigen homolog [Arabidopsis thaliana]
 emb|CAB80954.1| nuclear antigen homolog [Arabidopsis thaliana]
 gb|AAL36252.1| putative nuclear antigen homolog [Arabidopsis thaliana]
 gb|AAM20150.1| putative nuclear antigen-like protein [Arabidopsis thaliana]
 gb|AAM83242.1| AT4g16830/dl4440w [Arabidopsis thaliana]
 gb|AAN18128.1| At4g16830/dl4440w [Arabidopsis thaliana]
 gb|AEE83809.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=355

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS+K+ +K 
Sbjct  227  TLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKD  285

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE--TPSIED  238
            +  EK KK  SINEFLKPAEG  YYR G  GRGRG     G   G +        P+I D
Sbjct  286  DKEEKAKKAVSINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGD  345

Query  237  VGQFPTLGSK  208
              QFP+LG K
Sbjct  346  AAQFPSLGGK  355



>gb|EMT09866.1| hypothetical protein F775_32096 [Aegilops tauschii]
Length=339

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 90/136 (66%), Gaps = 8/136 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EK+ EE+RKA+LA + EERKV +DK+ +S+  L+ KK +DEVF+KLGS+KE KK+
Sbjct  204  TLEEFEKIREEQRKALLALKTEERKVEVDKDLQSLQPLSTKKANDEVFIKLGSDKEKKKE  263

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------  256
                  + KK+ SINEFLKPAEGE YY   GRGRGRG G G  G                
Sbjct  264  STERDERAKKSLSINEFLKPAEGERYYGGRGRGRGRGEGRGDRGGFRGGFGGGYQHGQAA  323

Query  255  TPSIEDVGQFPTLGSK  208
             PSIED  QFPTLG K
Sbjct  324  APSIEDQSQFPTLGGK  339



>dbj|BAJ89734.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=375

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 86/136 (63%), Gaps = 8/136 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----k  427
            TLDE+EK++EEKRKA+ A  + EERKV +DK+ ++M LL+ KK +DEVF+KLG++    K
Sbjct  240  TLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKKGNDEVFIKLGADKEALK  299

Query  426  edkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---  256
            + +  E  E+ KK+ SINEFLKPAEGE +Y   GRG       G    G           
Sbjct  300  KKENAEREERAKKSVSINEFLKPAEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHNPPP  359

Query  255  TPSIEDVGQFPTLGSK  208
             P+I+D  QFPTLG K
Sbjct  360  APAIQDQNQFPTLGGK  375



>emb|CDM84169.1| unnamed protein product [Triticum aestivum]
Length=381

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 90/136 (66%), Gaps = 8/136 (6%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+E+EK+ EE+RKA+LA + EERKV +DK+ +S+  L+ KK +DEVF+KLGS+KE KK+
Sbjct  246  TLEEFEKIREEQRKALLALKTEERKVEVDKDLQSLQPLSTKKANDEVFIKLGSDKEKKKE  305

Query  411  eage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------  256
                  + KK+ SINEFLKPAEGE YY   GRGRGRG G G  G                
Sbjct  306  STERDERAKKSLSINEFLKPAEGERYYGGRGRGRGRGEGRGDRGGFRGGFGGGYQRGQAA  365

Query  255  TPSIEDVGQFPTLGSK  208
             PSIED  QFPTLG K
Sbjct  366  APSIEDQSQFPTLGGK  381



>ref|NP_001078400.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83811.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=345

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS+K+ +K 
Sbjct  217  TLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKD  275

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE--TPSIED  238
            +  EK KK  SINEFLKPAEG  YYR G  GRGRG     G   G +        P+I D
Sbjct  276  DKEEKAKKAVSINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGD  335

Query  237  VGQFPTLGSK  208
              QFP+LG K
Sbjct  336  AAQFPSLGGK  345



>ref|XP_004148350.1| PREDICTED: uncharacterized protein LOC101207608 [Cucumis sativus]
 ref|XP_004166199.1| PREDICTED: uncharacterized protein LOC101223435 [Cucumis sativus]
 gb|KGN60476.1| hypothetical protein Csa_3G914560 [Cucumis sativus]
Length=358

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL EYEKL EE RK  L ++ E RK  +D+E E+M  L++KK +DE+F KLG++K+ +K 
Sbjct  231  TLKEYEKLREESRK--LLAKTEVRKAEVDEELENMQQLSSKKTNDEIFAKLGTDKDKRKD  288

Query  411  eagekvkktKS--INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIED  238
             A ++ +  KS  I EFLKPAEGE YY PGGRGRGRG GS  G   G+N  +   PSIED
Sbjct  289  AADKEERAKKSVTITEFLKPAEGERYYNPGGRGRGRGRGSRGGFNNGSNRMNVAAPSIED  348

Query  237  VGQFPTLGSK  208
             GQFP+L +K
Sbjct  349  PGQFPSLSAK  358



>emb|CDY38403.1| BnaC01g10120D [Brassica napus]
Length=336

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 85/132 (64%), Gaps = 7/132 (5%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk  415
            TL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG++K+ + 
Sbjct  205  TLEEYEKVLEEKRKALQATKIEERKVDT-KAFETMQQLSSKKSNNDEVFIKLGTDKDKRP  263

Query  414  keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg-----GNNTSSFETP  250
             E  EK KK+ SINEFLKPA GE Y      GRGRG      G        +  ++   P
Sbjct  264  VEKEEKTKKSLSINEFLKPANGERYRGGYRGGRGRGPRGADEGGRGPKGGADRKAAAPAP  323

Query  249  SIEDVGQFPTLG  214
             IED   FPTLG
Sbjct  324  KIEDAAHFPTLG  335



>gb|EMS68133.1| hypothetical protein TRIUR3_26332 [Triticum urartu]
Length=785

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 107/181 (59%), Gaps = 17/181 (9%)
 Frame = -1

Query  684  EKQHGQEDAGDAKKDSP----ldepevkepedkeLTLDEYEKLLEEKRKAILA-SRPEER  520
            EKQ   EDA  A ++ P        E ++ ED E+TLDE+EK++EEKRKA+ A  + EER
Sbjct  206  EKQGAPEDAPQADENKPTKDGATVVEEEKEEDNEMTLDEFEKVMEEKRKALAALKKSEER  265

Query  519  KVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPAE  352
            KV +DK+ ++M LL+ KK +DEVF+KLG++KE  KK+       + KK+ SINEFLKPAE
Sbjct  266  KVEIDKDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAEREERAKKSVSINEFLKPAE  325

Query  351  GETyyrpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLGSK*GIKPFLPS  181
            GE +Y   GRG       G    G            P+I+D  QFPTLG K     FL S
Sbjct  326  GERFYGGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLGGK-----FLMS  380

Query  180  S  178
            S
Sbjct  381  S  381



>ref|XP_010925494.1| PREDICTED: protein argonaute 2-like [Elaeis guineensis]
Length=378

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 125/201 (62%), Gaps = 26/201 (13%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTD----AFEKQHGQEDA--GDAKKDSPldepevkeped-  601
            TD++  +A E       D VNTD    + EKQ  QEDA   +A KD+   E    E ++ 
Sbjct  185  TDDVLAQATE-------DNVNTDEKVASPEKQPEQEDAPFAEANKDTKEGEVNEAEEKEP  237

Query  600  --keLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLG---  436
              KE+TL+EYEK+ EEKRKA+LA +PEERKV LDKEFESM  L+ KK DD VFVKLG   
Sbjct  238  EDKEMTLEEYEKIKEEKRKALLALKPEERKVQLDKEFESMQQLSLKKGDD-VFVKLGTDK  296

Query  435  -SekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy-----gGN  274
             S K+    + GE+ +K+ SINEFLKPAEGE YY P GRGRGRG G G         G  
Sbjct  297  DSSKKRDNADRGERARKSFSINEFLKPAEGERYYSPAGRGRGRGRGRGDRRTFGDGFGRG  356

Query  273  NTSSFETPSIEDVGQFPTLGS  211
             T +   PSIED GQFPTLG 
Sbjct  357  GTIAAAAPSIEDPGQFPTLGG  377



>ref|XP_008465866.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=358

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 122/186 (66%), Gaps = 9/186 (5%)
 Frame = -1

Query  756  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKK-DSPldepevkepedkeLTLDE  580
            DE AP+ EEP    V +     A E+Q G++   D  K +  + EPE KEPEDKE+TL E
Sbjct  179  DENAPDVEEP----VAENEKNVAPEQQLGEDGVDDNNKAEEAVKEPEEKEPEDKEMTLKE  234

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage  400
            YEKL EE RK  L ++ E RK  +D+E E+M  L++KK +DE+F KLG++K+ +K  A +
Sbjct  235  YEKLREESRK--LLAKTEVRKAEVDEELENMQQLSSKKTNDEIFAKLGTDKDKRKDVADK  292

Query  399  kvkktKS--INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  226
            + +  KS  I EFLKPAEGE YY PGGRGRGRG GS  G   G+N  +   PSIED GQF
Sbjct  293  EERAKKSVTITEFLKPAEGERYYNPGGRGRGRGRGSRGGFNNGSNRMNVAAPSIEDPGQF  352

Query  225  PTLGSK  208
            P+L +K
Sbjct  353  PSLSAK  358



>gb|AAM61393.1| nuclear antigen homolog [Arabidopsis thaliana]
Length=354

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS+K+ +K 
Sbjct  226  TLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKD  284

Query  411  eagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE--TPSIED  238
            +  EK KK  SINEFLKPA G  YYR G  GRGRG     G   G +        P+I D
Sbjct  285  DKEEKAKKAVSINEFLKPAGGGDYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGD  344

Query  237  VGQFPTLGSK  208
              QFP+LG K
Sbjct  345  AAQFPSLGGK  354



>gb|AGV54489.1| plasminogen activator inhibitor 1 RNA-binding protein [Phaseolus 
vulgaris]
Length=411

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 116/179 (65%), Gaps = 7/179 (4%)
 Frame = -1

Query  666  EDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESM  487
            E+  D  KDSP +E E KEPEDKE+TL+EYEK+LEE+RKA  A + E RKV   KEFE+M
Sbjct  214  EEVADENKDSPANETEEKEPEDKEMTLEEYEKVLEERRKAFQALKTEGRKVDA-KEFETM  272

Query  486  ALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrg  313
              L++KK + ++F+KLGS+K+ +K      EK KKT SI EFLKP EGETY+ PGGRGRG
Sbjct  273  QPLSSKKTNRDIFIKLGSDKDKRKGALEKEEKSKKTISIREFLKPMEGETYFNPGGRGRG  332

Query  312  rghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK*GIKPFLPSSQFKISSGFMFLYYQ  136
            RG    RGGY G   ++    SI D G   TLG + G    LP +   I+  F FL  Q
Sbjct  333  RGGRGSRGGYRGGAANNAPGASIGDRGHLATLGHEWG----LPGAVSHIAVIFSFLGNQ  387



>ref|XP_002511578.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF50247.1| RNA binding protein, putative [Ricinus communis]
Length=295

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 5/107 (5%)
 Frame = -1

Query  759  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPldepevkepedkeLTLDE  580
            TDEIA   EE     VN+G      EK  G+ +A D KK+SP +EPE K+PEDKE+TL+E
Sbjct  187  TDEIAQVTEE----AVNEGEKNMGDEKPVGEGEAVDGKKESPTNEPEEKQPEDKEMTLEE  242

Query  579  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  439
            YEK+LEEKRKA+ A++ EERKV   KEF SM  L++KK  D++F+KL
Sbjct  243  YEKVLEEKRKALQATKAEERKVDT-KEFASMQQLSSKKGGDDIFIKL  288



>emb|CDY43474.1| BnaC08g10790D [Brassica napus]
Length=420

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 109/164 (66%), Gaps = 7/164 (4%)
 Frame = -1

Query  687  FEKQHGQEDAGDAKKDSPldepevkepedkeLTLDEYEKLLEEKRKAILASRPEERKVCL  508
             EK  G E A DAKK++  +  E KEPEDKE+TLDEYEK+LEEK+K++ +    ERK   
Sbjct  149  IEKSAGDEVAADAKKENTAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKFDT  208

Query  507  DKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpg  328
             K FESM  L+NKK++DE+F+KL S+K+ +K +  EK KK  SINEFLKPAEGE +YR G
Sbjct  209  -KVFESMQQLSNKKSNDEIFIKLDSDKDKRKDDKEEKAKKAVSINEFLKPAEGENHYRGG  267

Query  327  grgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLG  214
            GRG GRG G G    GG +   F+        +I D  QFP+LG
Sbjct  268  GRGGGRGRGRGGRDRGGVSGGVFDGYRSEAASAIGDTAQFPSLG  311



>gb|ABD65145.1| nuclear RNA binding protein, putative [Brassica oleracea]
 emb|CDY09622.1| BnaC07g34390D [Brassica napus]
Length=353

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk  415
            TL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L+NKK N+DEVF+KLG+EK+ + 
Sbjct  209  TLEEYEKVLEEKRKALQATKIEERKVDT-KVFETMQQLSNKKSNNDEVFIKLGTEKDKRP  267

Query  414  keagekvkktKSINEFLKPA  355
             E  EK KK+ SINEFLKPA
Sbjct  268  VEKEEKTKKSLSINEFLKPA  287



>emb|CDX90469.1| BnaA03g43120D [Brassica napus]
Length=353

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk  415
            TL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L+NKK N+DEVF+KLG+EK+ + 
Sbjct  209  TLEEYEKVLEEKRKALQATKIEERKVDT-KVFETMQQLSNKKSNNDEVFIKLGTEKDKRP  267

Query  414  keagekvkktKSINEFLKPA  355
             E  EK KK+ SINEFLKPA
Sbjct  268  VEKEEKTKKSLSINEFLKPA  287



>ref|XP_001785274.1| predicted protein [Physcomitrella patens]
 gb|EDQ49926.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 3/85 (4%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkk  412
            TL+EYEK+L EKRKA+  ++  ERKV  DKEFE M L+ NKK ++++F+KLG +KE  K+
Sbjct  250  TLEEYEKVLAEKRKALEDAKAAERKVEADKEFEKMQLVDNKKREEDIFIKLGQDKEKSKR  309

Query  411  eagekvkktK---SINEFLKPAEGE  346
            EA EK +K++   SINEFLKPAEGE
Sbjct  310  EAAEKEEKSRKPVSINEFLKPAEGE  334



>ref|XP_009136852.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
Length=353

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = -1

Query  591  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk  415
            TL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L+NKK N+DEVF+KLG+EK+ + 
Sbjct  209  TLEEYEKVLEEKRKALQATKIEERKVDT-KVFETMQQLSNKKSNNDEVFIKLGTEKDKRP  267

Query  414  keagekvkktKSINEFLKPA  355
             E  EK KK+ SINEFLKPA
Sbjct  268  VEKEEKTKKSLSINEFLKPA  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470