BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002O09

Length=653
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                248   1e-73   Solanum lycopersicum
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           248   3e-73   Solanum tuberosum [potatoes]
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                242   3e-71   Nicotiana sylvestris
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                238   2e-69   Nicotiana tomentosiformis
gb|ABK96588.1|  unknown                                                 223   3e-69   Populus trichocarpa x Populus deltoides
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                231   5e-67   Sesamum indicum [beniseed]
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                227   9e-66   Sesamum indicum [beniseed]
ref|XP_006381615.1|  subtilase family protein                           224   2e-64   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                221   3e-63   Populus euphratica
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      220   4e-63   Ricinus communis
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         218   2e-62   Jatropha curcas
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                213   2e-60   Prunus mume [ume]
gb|EYU25845.1|  hypothetical protein MIMGU_mgv1a013289mg                200   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                212   3e-60   Eucalyptus grandis [rose gum]
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             212   4e-60   Prunus persica
dbj|BAD94244.1|  serine protease like protein                           201   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090170.1|  Subtilisin-like protease                           209   4e-59   Morus notabilis
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                207   2e-58   Eucalyptus grandis [rose gum]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                207   2e-58   Eucalyptus grandis [rose gum]
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                207   3e-58   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     207   4e-58   Eucalyptus grandis [rose gum]
emb|CDY18042.1|  BnaC07g04280D                                          206   5e-58   Brassica napus [oilseed rape]
emb|CDY33400.1|  BnaA07g04390D                                          204   1e-57   Brassica napus [oilseed rape]
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     204   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             204   1e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                204   2e-57   Brassica rapa
ref|NP_565330.1|  Subtilase-like protein                                204   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                203   6e-57   Vitis vinifera
ref|XP_002885806.1|  predicted protein                                  202   7e-57   Arabidopsis lyrata subsp. lyrata
gb|KHN12283.1|  Subtilisin-like protease                                197   1e-56   Glycine soja [wild soybean]
gb|KHN06066.1|  Subtilisin-like protease                                200   1e-56   Glycine soja [wild soybean]
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                202   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                202   1e-56   Nicotiana sylvestris
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                202   2e-56   Nicotiana tomentosiformis
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                201   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                201   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           200   5e-56   Cicer arietinum [garbanzo]
gb|KGN66306.1|  hypothetical protein Csa_1G597040                       197   6e-56   Cucumis sativus [cucumbers]
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   200   6e-56   Citrus sinensis [apfelsine]
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             200   7e-56   
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    199   1e-55   Citrus sinensis [apfelsine]
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    199   1e-55   Arabis alpina [alpine rockcress]
ref|XP_003595292.1|  Subtilisin-like protease                           199   2e-55   Medicago truncatula
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                199   2e-55   
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           198   2e-55   Glycine max [soybeans]
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                198   3e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           198   3e-55   
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    197   5e-55   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             197   6e-55   Phaseolus vulgaris [French bean]
gb|AHA84190.1|  subtilisin-like protease                                197   1e-54   Phaseolus vulgaris [French bean]
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                196   1e-54   
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                196   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             196   2e-54   Capsella rubella
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           196   2e-54   Solanum tuberosum [potatoes]
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                196   2e-54   Malus domestica [apple tree]
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                195   5e-54   Cucumis melo [Oriental melon]
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                194   7e-54   Phoenix dactylifera
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                192   2e-53   
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                190   2e-52   Erythranthe guttata [common monkey flower]
gb|EPS65938.1|  hypothetical protein M569_08836                         188   7e-52   Genlisea aurea
ref|XP_007012625.1|  Subtilase family protein                           188   1e-51   
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    188   1e-51   
gb|KHG16003.1|  Subtilisin-like protease                                187   1e-51   Gossypium arboreum [tree cotton]
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                187   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                187   2e-51   
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    187   2e-51   Elaeis guineensis
gb|KJB82990.1|  hypothetical protein B456_013G223900                    186   3e-51   Gossypium raimondii
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                187   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                185   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease                182   9e-50   Fragaria vesca subsp. vesca
gb|KJB27210.1|  hypothetical protein B456_004G284900                    182   1e-49   Gossypium raimondii
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           179   1e-48   Glycine max [soybeans]
gb|KHN07895.1|  Subtilisin-like protease                                174   1e-47   Glycine soja [wild soybean]
ref|XP_003609994.1|  Subtilisin-like protease                           176   3e-47   
gb|AES92191.2|  subtilisin-like serine protease                         175   3e-47   Medicago truncatula
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           174   9e-47   Cicer arietinum [garbanzo]
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                174   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002519362.1|  conserved hypothetical protein                     162   6e-46   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                171   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                169   5e-45   Eucalyptus grandis [rose gum]
emb|CAN71376.1|  hypothetical protein VITISV_001491                     169   7e-45   Vitis vinifera
gb|KHN17728.1|  Subtilisin-like protease                                158   5e-44   Glycine soja [wild soybean]
dbj|BAJ89916.1|  predicted protein                                      164   6e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP32432.1|  hypothetical protein JCGZ_13357                         162   1e-41   Jatropha curcas
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             159   2e-41   Phaseolus vulgaris [French bean]
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1     157   1e-40   Brachypodium distachyon [annual false brome]
ref|NP_001064523.2|  Os10g0394200                                       147   6e-40   
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like           150   1e-39   Setaria italica
gb|EMT16255.1|  Subtilisin-like protease                                151   1e-39   
dbj|BAD36156.1|  putative serine protease                               154   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like           152   3e-39   
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190          146   1e-38   Sorghum bicolor [broomcorn]
gb|AGT17100.1|  serine protease                                         151   1e-38   Saccharum hybrid cultivar R570
gb|ACL52505.1|  unknown                                                 148   2e-38   Zea mays [maize]
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           151   2e-38   Setaria italica
gb|ACF79126.1|  unknown                                                 148   3e-38   Zea mays [maize]
tpg|DAA61658.1|  TPA: putative subtilase family protein                 148   3e-38   
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          150   3e-38   Sorghum bicolor [broomcorn]
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     146   9e-38   Zea mays [maize]
gb|EMS60034.1|  Subtilisin-like protease                                147   1e-37   Triticum urartu
dbj|BAK06243.1|  predicted protein                                      148   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA50071.1|  TPA: putative subtilase family protein                 148   3e-37   
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor     148   3e-37   Zea mays [maize]
gb|EEE50901.1|  hypothetical protein OsJ_31407                          146   1e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EAY78354.1|  hypothetical protein OsI_33442                          146   1e-36   Oryza sativa Indica Group [Indian rice]
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      146   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           142   1e-35   
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          144   1e-35   Amborella trichopoda
gb|EMT22975.1|  Subtilisin-like protease                                139   5e-35   
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease                136   6e-33   Brachypodium distachyon [annual false brome]
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             135   1e-32   Phaseolus vulgaris [French bean]
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    133   4e-32   
gb|KHN04600.1|  Subtilisin-like protease                                133   4e-32   Glycine soja [wild soybean]
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    133   5e-32   Glycine max [soybeans]
gb|EYU29564.1|  hypothetical protein MIMGU_mgv1a023796mg                132   7e-32   Erythranthe guttata [common monkey flower]
gb|KJB70156.1|  hypothetical protein B456_011G061400                    132   2e-31   Gossypium raimondii
gb|EYU29364.1|  hypothetical protein MIMGU_mgv1a022867mg                130   2e-31   Erythranthe guttata [common monkey flower]
gb|EYU29358.1|  hypothetical protein MIMGU_mgv1a024271mg                127   4e-31   Erythranthe guttata [common monkey flower]
gb|EPS61652.1|  hypothetical protein M569_13143                         130   5e-31   Genlisea aurea
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    130   6e-31   Glycine max [soybeans]
gb|EYU29552.1|  hypothetical protein MIMGU_mgv1a0178121mg               123   7e-31   Erythranthe guttata [common monkey flower]
gb|KHN04108.1|  Subtilisin-like protease                                129   1e-30   Glycine soja [wild soybean]
gb|KHN13888.1|  Subtilisin-like protease                                129   1e-30   Glycine soja [wild soybean]
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    129   1e-30   Glycine max [soybeans]
gb|KHN27220.1|  Subtilisin-like protease                                129   1e-30   Glycine soja [wild soybean]
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    129   2e-30   Cucumis melo [Oriental melon]
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           127   5e-30   Cicer arietinum [garbanzo]
gb|EYU28960.1|  hypothetical protein MIMGU_mgv1a018215mg                127   5e-30   Erythranthe guttata [common monkey flower]
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           127   5e-30   Cucumis sativus [cucumbers]
ref|XP_007051971.1|  Subtilase family protein                           127   9e-30   
gb|EYU29555.1|  hypothetical protein MIMGU_mgv1a022042mg                126   1e-29   Erythranthe guttata [common monkey flower]
gb|EYU31528.1|  hypothetical protein MIMGU_mgv1a0212142mg               124   1e-29   Erythranthe guttata [common monkey flower]
gb|EYU28963.1|  hypothetical protein MIMGU_mgv1a023216mg                123   1e-29   Erythranthe guttata [common monkey flower]
emb|CDP20511.1|  unnamed protein product                                125   2e-29   Coffea canephora [robusta coffee]
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             125   3e-29   Musa acuminata [banana]
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    125   3e-29   Elaeis guineensis
gb|EMS68171.1|  Subtilisin-like protease                                122   4e-29   Triticum urartu
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                125   5e-29   Populus euphratica
ref|XP_004308418.2|  PREDICTED: subtilisin-like protease                124   5e-29   Fragaria vesca subsp. vesca
ref|XP_003554304.1|  PREDICTED: subtilisin-like protease SDD1-like      124   8e-29   Glycine max [soybeans]
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             124   1e-28   Phaseolus vulgaris [French bean]
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease                124   1e-28   Cucumis melo [Oriental melon]
ref|XP_007051969.1|  Subtilase family protein isoform 1                 124   1e-28   
gb|EYU29357.1|  hypothetical protein MIMGU_mgv1a021077mg                123   1e-28   Erythranthe guttata [common monkey flower]
gb|KHN10783.1|  Subtilisin-like protease SDD1                           123   1e-28   Glycine soja [wild soybean]
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like           123   2e-28   Cucumis sativus [cucumbers]
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like      123   2e-28   Glycine max [soybeans]
gb|ACJ26761.1|  subtilisin-like protein                                 116   2e-28   Nicotiana benthamiana
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                123   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                122   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002320086.2|  subtilase family protein                           122   2e-28   Populus trichocarpa [western balsam poplar]
emb|CAN81091.1|  hypothetical protein VITISV_040911                     120   3e-28   Vitis vinifera
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    122   4e-28   
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like           122   4e-28   
gb|KHN13887.1|  Subtilisin-like protease                                121   5e-28   Glycine soja [wild soybean]
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           122   5e-28   Glycine max [soybeans]
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                122   5e-28   Cucumis melo [Oriental melon]
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                122   6e-28   Nicotiana tomentosiformis
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                     121   6e-28   Eucalyptus grandis [rose gum]
gb|EYU28634.1|  hypothetical protein MIMGU_mgv1a024623mg                121   6e-28   Erythranthe guttata [common monkey flower]
gb|EYU29554.1|  hypothetical protein MIMGU_mgv1a0256351mg               119   7e-28   Erythranthe guttata [common monkey flower]
gb|ACN28035.1|  unknown                                                 118   8e-28   Zea mays [maize]
gb|AFB32958.1|  hypothetical protein 0_744_01                           114   8e-28   Pinus mugo [mountain pine]
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease                121   1e-27   Fragaria vesca subsp. vesca
gb|AFG70679.1|  hypothetical protein 0_744_01                           113   2e-27   Pinus taeda
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1     120   2e-27   
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2     120   2e-27   
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             120   2e-27   
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease                120   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                120   2e-27   Solanum lycopersicum
gb|AFB32953.1|  hypothetical protein 0_744_01                           113   2e-27   Abies alba [abete-blanco]
gb|AFG70691.1|  hypothetical protein 0_744_01                           112   2e-27   Pinus taeda
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          120   2e-27   Amborella trichopoda
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease                120   2e-27   
gb|KDP25551.1|  hypothetical protein JCGZ_20707                         120   2e-27   Jatropha curcas
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           120   3e-27   Citrus sinensis [apfelsine]
gb|AFB32957.1|  hypothetical protein 0_744_01                           112   3e-27   Pinus mugo [mountain pine]
ref|XP_009411443.1|  PREDICTED: subtilisin-like protease                119   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI34784.3|  unnamed protein product                                117   3e-27   Vitis vinifera
gb|EAY90937.1|  hypothetical protein OsI_12551                          117   3e-27   Oryza sativa Indica Group [Indian rice]
emb|CDP09846.1|  unnamed protein product                                119   3e-27   Coffea canephora [robusta coffee]
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                119   4e-27   Prunus mume [ume]
ref|XP_003625390.1|  Subtilisin-like protease                           119   4e-27   
gb|AFB32959.1|  hypothetical protein 0_744_01                           112   4e-27   Pinus mugo [mountain pine]
ref|XP_006358406.1|  PREDICTED: subtilisin-like protease-like           119   4e-27   Solanum tuberosum [potatoes]
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           119   4e-27   Solanum tuberosum [potatoes]
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                119   5e-27   Prunus mume [ume]
ref|XP_006445191.1|  hypothetical protein CICLE_v10018512mg             120   6e-27   
ref|XP_002303551.2|  hypothetical protein POPTR_0003s11870g             119   6e-27   
ref|XP_007162604.1|  hypothetical protein PHAVU_001G165300g             119   6e-27   Phaseolus vulgaris [French bean]
gb|ACN27710.1|  unknown                                                 118   6e-27   Zea mays [maize]
tpg|DAA50265.1|  TPA: putative subtilase family protein                 118   7e-27   
emb|CDP10007.1|  unnamed protein product                                118   7e-27   Coffea canephora [robusta coffee]
ref|NP_001151549.1|  subtilisin-like protease precursor                 118   8e-27   
ref|XP_006358407.1|  PREDICTED: subtilisin-like protease-like           118   1e-26   Solanum tuberosum [potatoes]
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     118   1e-26   Nicotiana sylvestris
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     118   1e-26   Nicotiana sylvestris
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                118   1e-26   Nelumbo nucifera [Indian lotus]
gb|EYU28633.1|  hypothetical protein MIMGU_mgv1a023843mg                117   2e-26   Erythranthe guttata [common monkey flower]
gb|ABR17987.1|  unknown                                                 117   2e-26   Picea sitchensis
gb|AFB32956.1|  hypothetical protein 0_744_01                           110   2e-26   Pinus mugo [mountain pine]
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like      117   2e-26   
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                110   2e-26   Populus euphratica
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             109   3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_002509668.1|  Xylem serine proteinase 1 precursor, putative      117   3e-26   Ricinus communis
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   116   3e-26   Citrus sinensis [apfelsine]
gb|AEW07410.1|  hypothetical protein 0_744_01                           109   3e-26   Pinus radiata
ref|NP_001060094.1|  Os07g0578300                                       116   4e-26   
ref|NP_001050634.1|  Os03g0605300                                       116   4e-26   
gb|EAZ04458.1|  hypothetical protein OsI_26606                          116   4e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease                116   4e-26   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP11276.1|  unnamed protein product                                116   5e-26   Coffea canephora [robusta coffee]
gb|EYU33441.1|  hypothetical protein MIMGU_mgv1a022698mg                116   6e-26   Erythranthe guttata [common monkey flower]
ref|XP_011033844.1|  PREDICTED: subtilisin-like protease SDD1           116   6e-26   Populus euphratica
ref|XP_002275410.2|  PREDICTED: subtilisin-like protease SDD1           116   6e-26   Vitis vinifera
emb|CDP10008.1|  unnamed protein product                                117   6e-26   Coffea canephora [robusta coffee]
ref|XP_004958126.1|  PREDICTED: subtilisin-like protease-like           116   6e-26   Setaria italica
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                116   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007024651.1|  Subtilase family protein                           113   7e-26   
gb|AFB32955.1|  hypothetical protein 0_744_01                           108   7e-26   Larix decidua
gb|AES80028.2|  subtilisin-like serine protease                         115   8e-26   Medicago truncatula
emb|CBI34785.3|  unnamed protein product                                116   9e-26   Vitis vinifera
ref|XP_003623810.1|  Subtilisin-like protease                           115   9e-26   
ref|XP_011081168.1|  PREDICTED: subtilisin-like protease SDD1           115   1e-25   
ref|XP_002275429.1|  PREDICTED: subtilisin-like protease                115   1e-25   Vitis vinifera
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                115   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004244717.1|  PREDICTED: subtilisin-like protease                115   1e-25   Solanum lycopersicum
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                115   2e-25   Nicotiana sylvestris
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             115   2e-25   Prunus persica
ref|XP_010087293.1|  Subtilisin-like protease                           114   2e-25   
gb|EYU29557.1|  hypothetical protein MIMGU_mgv1a0023062mg               111   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1           114   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004166310.1|  PREDICTED: subtilisin-like protease SDD1-like      114   2e-25   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           114   2e-25   Solanum tuberosum [potatoes]
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                114   2e-25   Sesamum indicum [beniseed]
ref|XP_010091819.1|  Subtilisin-like protease SDD1                      114   2e-25   Morus notabilis
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           114   2e-25   Setaria italica
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                114   2e-25   Vitis vinifera
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                114   3e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|ADY38794.1|  serine protease                                         114   3e-25   Coffea arabica [arabica coffee]
gb|AES81608.2|  subtilisin-like serine protease                         114   3e-25   Medicago truncatula
gb|EYU29561.1|  hypothetical protein MIMGU_mgv1a018614mg                114   3e-25   Erythranthe guttata [common monkey flower]
gb|AFK33735.1|  unknown                                                 108   3e-25   Medicago truncatula
ref|XP_009375850.1|  PREDICTED: subtilisin-like protease                114   3e-25   Pyrus x bretschneideri [bai li]
gb|EMS49460.1|  Subtilisin-like protease SDD1                           114   3e-25   Triticum urartu
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                110   4e-25   Cucumis melo [Oriental melon]
ref|XP_006358147.1|  PREDICTED: subtilisin-like protease SDD1-like      113   4e-25   Solanum tuberosum [potatoes]
ref|XP_003605881.1|  Subtilisin-like protease                           111   4e-25   
ref|XP_006418467.1|  hypothetical protein EUTSA_v10006878mg             114   4e-25   Eutrema salsugineum [saltwater cress]
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                106   4e-25   Populus euphratica
ref|XP_008447369.1|  PREDICTED: subtilisin-like protease SDD1           113   4e-25   Cucumis melo [Oriental melon]
gb|KGN58306.1|  hypothetical protein Csa_3G610820                       113   4e-25   Cucumis sativus [cucumbers]
gb|AFS34694.1|  subtilisin-like serine protease                         113   5e-25   Pisum sativum [garden pea]
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           113   5e-25   Solanum tuberosum [potatoes]
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                113   5e-25   Nelumbo nucifera [Indian lotus]
emb|CDY43568.1|  BnaC02g16650D                                          108   5e-25   Brassica napus [oilseed rape]
ref|XP_004152066.1|  PREDICTED: subtilisin-like protease SDD1-like      113   5e-25   
ref|XP_002275381.2|  PREDICTED: subtilisin-like protease SDD1           114   6e-25   
ref|XP_007051967.1|  Subtilase family protein                           113   6e-25   
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                113   6e-25   Nicotiana tomentosiformis
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                113   6e-25   Nicotiana tomentosiformis
gb|EMT24443.1|  Subtilisin-like protease                                113   6e-25   
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           113   6e-25   Solanum tuberosum [potatoes]
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     113   7e-25   Eucalyptus grandis [rose gum]
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                112   8e-25   Vitis vinifera
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like           111   8e-25   Cicer arietinum [garbanzo]
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                113   8e-25   Eucalyptus grandis [rose gum]
emb|CDO99977.1|  unnamed protein product                                112   8e-25   Coffea canephora [robusta coffee]
gb|EYU28961.1|  hypothetical protein MIMGU_mgv1a020058mg                112   8e-25   Erythranthe guttata [common monkey flower]
ref|XP_009760563.1|  PREDICTED: subtilisin-like protease                112   8e-25   Nicotiana sylvestris
gb|ABZ89187.1|  putative protein                                        112   9e-25   Coffea canephora [robusta coffee]
gb|EPS74284.1|  hypothetical protein M569_00464                         112   9e-25   Genlisea aurea
gb|KJB49367.1|  hypothetical protein B456_008G115500                    112   1e-24   Gossypium raimondii
gb|ABR18065.1|  unknown                                                 112   1e-24   Picea sitchensis
ref|XP_006358905.1|  PREDICTED: subtilisin-like protease SDD1-like      112   1e-24   Solanum tuberosum [potatoes]
ref|XP_003608462.1|  Subtilisin-like protease                           106   1e-24   Medicago truncatula
ref|XP_006446947.1|  hypothetical protein CICLE_v10014389mg             112   1e-24   
ref|XP_011081104.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    111   2e-24   
gb|EMT01939.1|  Subtilisin-like protease                                111   2e-24   
emb|CDY15145.1|  BnaC05g00240D                                          112   2e-24   
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease                112   2e-24   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                         111   2e-24   
ref|XP_003611185.1|  Subtilisin-like serine protease                    111   2e-24   
ref|XP_006477586.1|  PREDICTED: subtilisin-like protease SDD1-like      111   2e-24   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                111   2e-24   
gb|EYU33437.1|  hypothetical protein MIMGU_mgv1a001845mg                111   2e-24   
ref|XP_010108079.1|  Subtilisin-like protease SDD1                      107   3e-24   
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             111   3e-24   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like           108   3e-24   
emb|CBI37888.3|  unnamed protein product                                111   3e-24   
ref|XP_004300738.1|  PREDICTED: subtilisin-like protease SDD1           111   3e-24   
ref|XP_003636375.1|  Subtilisin-like protease                           111   3e-24   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                111   3e-24   
gb|EYU28956.1|  hypothetical protein MIMGU_mgv1a023117mg                110   3e-24   
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like           110   4e-24   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           110   4e-24   
gb|KDP25552.1|  hypothetical protein JCGZ_20708                         110   4e-24   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                110   4e-24   
gb|KHN41792.1|  Subtilisin-like protease                                110   4e-24   
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             107   4e-24   
gb|ADZ55305.1|  serine protease                                         110   4e-24   
gb|EYU29563.1|  hypothetical protein MIMGU_mgv1a022413mg                110   4e-24   
ref|XP_006369129.1|  subtilase family protein                           103   4e-24   
dbj|BAK08126.1|  predicted protein                                      110   4e-24   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                107   4e-24   
emb|CDY63869.1|  BnaCnng42760D                                          105   4e-24   
gb|KDO36038.1|  hypothetical protein CISIN_1g047896mg                   108   5e-24   
gb|ADE77855.1|  unknown                                                 107   5e-24   
gb|EYU39029.1|  hypothetical protein MIMGU_mgv1a019332mg                110   5e-24   
ref|XP_006468883.1|  PREDICTED: subtilisin-like protease-like           110   6e-24   
emb|CAN75239.1|  hypothetical protein VITISV_014205                     110   6e-24   
ref|XP_006440474.1|  hypothetical protein CICLE_v10023558mg             110   6e-24   
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    110   6e-24   
gb|KJB10059.1|  hypothetical protein B456_001G182200                    110   6e-24   
ref|XP_006347484.1|  PREDICTED: subtilisin-like protease SDD1-like      110   6e-24   
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                110   6e-24   
ref|XP_010111996.1|  Subtilisin-like protease                           110   6e-24   
gb|EYU29361.1|  hypothetical protein MIMGU_mgv1a026567mg                110   7e-24   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                105   7e-24   
ref|XP_010540256.1|  PREDICTED: subtilisin-like protease                110   7e-24   
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    110   7e-24   
gb|EYU33439.1|  hypothetical protein MIMGU_mgv1a026748mg                109   8e-24   
gb|ADE76648.1|  unknown                                                 107   8e-24   
emb|CDO96926.1|  unnamed protein product                                109   9e-24   
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1           109   9e-24   
ref|NP_001159342.1|  putative subtilase family protein precursor        109   9e-24   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...    109   9e-24   
gb|EPS72026.1|  serine protease                                         109   9e-24   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                109   1e-23   
ref|XP_009790649.1|  PREDICTED: subtilisin-like protease SDD1 iso...    109   1e-23   
gb|KFK42754.1|  hypothetical protein AALP_AA1G035200                    109   1e-23   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                109   1e-23   
ref|XP_009781099.1|  PREDICTED: subtilisin-like protease                109   1e-23   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             109   1e-23   
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease                109   1e-23   
ref|XP_006464862.1|  PREDICTED: subtilisin-like protease SDD1-like      109   1e-23   
ref|XP_009790650.1|  PREDICTED: subtilisin-like protease SDD1 iso...    109   1e-23   
ref|XP_006427879.1|  hypothetical protein CICLE_v10027438mg             109   1e-23   
ref|XP_004958127.1|  PREDICTED: subtilisin-like protease-like           109   1e-23   
emb|CDY67452.1|  BnaCnng55020D                                          109   1e-23   
ref|XP_009629568.1|  PREDICTED: subtilisin-like protease                109   1e-23   
emb|CDP09843.1|  unnamed protein product                                104   1e-23   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           108   2e-23   
ref|XP_003597117.1|  Subtilisin-like protease                           108   2e-23   
ref|XP_006352831.1|  PREDICTED: subtilisin-like protease SDD1-like      108   2e-23   
emb|CDY12840.1|  BnaC07g15930D                                          108   2e-23   
ref|XP_007050153.1|  Subtilase family protein isoform 1                 108   2e-23   
gb|EYU33438.1|  hypothetical protein MIMGU_mgv1a026511mg                108   2e-23   
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                108   2e-23   
gb|AES94159.2|  subtilisin-like serine protease                         108   2e-23   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                108   2e-23   
ref|XP_003611201.1|  Subtilisin-like serine protease                    108   2e-23   
gb|KJB43875.1|  hypothetical protein B456_007G221100                    104   2e-23   
ref|XP_009781097.1|  PREDICTED: subtilisin-like protease                108   2e-23   
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           101   2e-23   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                108   2e-23   
ref|XP_004147596.1|  PREDICTED: subtilisin-like protease SDD1-like      108   2e-23   
ref|XP_007051968.1|  Subtilase family protein                           108   2e-23   
gb|EPS74243.1|  subtilase family protein                                108   3e-23   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                108   3e-23   
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1           108   3e-23   
ref|XP_010931682.1|  PREDICTED: subtilisin-like protease                103   3e-23   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                108   3e-23   
emb|CBI34800.3|  unnamed protein product                                105   3e-23   
gb|EMS62253.1|  Subtilisin-like protease                                103   3e-23   
emb|CDY57437.1|  BnaAnng14520D                                          108   3e-23   
gb|KHN01421.1|  Subtilisin-like protease                                105   3e-23   
ref|XP_004954113.1|  PREDICTED: subtilisin-like protease-like           103   3e-23   
gb|AGT16121.1|  hypothetical protein SHCRBa_028_H13_F_280               108   4e-23   
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                108   4e-23   
ref|XP_006599275.1|  PREDICTED: subtilisin-like protease-like iso...    107   4e-23   
gb|KJB57037.1|  hypothetical protein B456_009G146000                    108   4e-23   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      107   4e-23   
ref|XP_008437181.1|  PREDICTED: subtilisin-like protease                107   4e-23   
ref|XP_009119746.1|  PREDICTED: subtilisin-like protease                107   4e-23   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                104   4e-23   
ref|XP_007156353.1|  hypothetical protein PHAVU_003G279300g             107   4e-23   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    107   4e-23   
gb|EYU29548.1|  hypothetical protein MIMGU_mgv1a0242761mg               104   4e-23   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           107   4e-23   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1           107   5e-23   
ref|XP_003547892.1|  PREDICTED: subtilisin-like protease-like iso...    107   5e-23   
gb|KHN38839.1|  Subtilisin-like protease                                107   5e-23   
ref|XP_007047459.1|  Subtilase family protein                           102   5e-23   
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             107   5e-23   
ref|XP_010108071.1|  Subtilisin-like protease SDD1                      107   5e-23   
ref|XP_002301847.2|  STOMATAL DENSITY AND DISTRIBUTION family pro...    107   5e-23   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           102   5e-23   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1           107   5e-23   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                107   5e-23   
gb|ADW11233.1|  subtilisin-like protease 2                              107   5e-23   
ref|XP_009604592.1|  PREDICTED: subtilisin-like protease                107   5e-23   
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                     107   6e-23   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                107   6e-23   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    102   6e-23   
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                107   6e-23   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                107   6e-23   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             107   6e-23   
gb|EYU39032.1|  hypothetical protein MIMGU_mgv1a023804mg                107   6e-23   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             107   6e-23   
ref|XP_010684867.1|  PREDICTED: subtilisin-like protease SDD1           107   6e-23   
ref|XP_003516513.1|  PREDICTED: subtilisin-like protease-like           107   6e-23   
gb|EMS59706.1|  Subtilisin-like protease                                105   6e-23   
gb|KHN28302.1|  Subtilisin-like protease                                107   7e-23   
gb|ACN26674.1|  unknown                                                 105   7e-23   
ref|XP_002892038.1|  predicted protein                                  107   7e-23   
ref|XP_007210332.1|  hypothetical protein PRUPE_ppa002068mg             107   7e-23   
gb|ACB87529.1|  subtilisin protease                                     103   7e-23   
gb|KHN44005.1|  Subtilisin-like protease                                101   7e-23   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             107   7e-23   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             107   8e-23   
ref|XP_008810058.1|  PREDICTED: subtilisin-like protease SDD1           107   8e-23   
ref|XP_010105482.1|  Subtilisin-like protease                           105   8e-23   
ref|XP_002526537.1|  Cucumisin precursor, putative                      107   8e-23   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             107   9e-23   
ref|XP_011024491.1|  PREDICTED: subtilisin-like protease SDD1           107   9e-23   
ref|XP_010483084.1|  PREDICTED: subtilisin-like protease SDD1           106   1e-22   
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             106   1e-22   
ref|XP_003611195.1|  Subtilisin-like serine protease                    106   1e-22   
ref|XP_010089708.1|  Subtilisin-like protease                           106   1e-22   
ref|XP_003581517.1|  PREDICTED: subtilisin-like protease                106   1e-22   
gb|KDO63673.1|  hypothetical protein CISIN_1g039265mg                   106   1e-22   
ref|XP_006446946.1|  hypothetical protein CICLE_v10017639mg             106   1e-22   
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g             106   1e-22   
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         106   1e-22   
ref|XP_006446945.1|  hypothetical protein CICLE_v10017946mg             106   1e-22   
ref|XP_011081166.1|  PREDICTED: subtilisin-like protease SDD1           107   1e-22   
dbj|BAK03601.1|  predicted protein                                      106   1e-22   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease                106   1e-22   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                106   1e-22   
gb|AFK43318.1|  unknown                                                 102   1e-22   
dbj|BAJ93872.1|  predicted protein                                      106   1e-22   
gb|KHG02130.1|  Subtilisin-like protease                                106   1e-22   
emb|CAA59963.1|  subtilisin-like protease                               106   1e-22   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             106   1e-22   
gb|EYU39037.1|  hypothetical protein MIMGU_mgv1a021904mg                106   1e-22   
ref|NP_001159284.1|  putative subtilase family protein precursor        106   1e-22   
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    106   2e-22   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    106   2e-22   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                106   2e-22   
gb|KJB49366.1|  hypothetical protein B456_008G115400                    106   2e-22   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           106   2e-22   
ref|XP_008679257.1|  PREDICTED: subtilisin-like protease                106   2e-22   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           106   2e-22   
gb|EYU39033.1|  hypothetical protein MIMGU_mgv1a001909mg                105   2e-22   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                106   2e-22   
ref|XP_010457444.1|  PREDICTED: subtilisin-like protease SDD1           106   2e-22   
ref|XP_007158429.1|  hypothetical protein PHAVU_002G152500g             105   2e-22   
ref|XP_002463079.1|  hypothetical protein SORBIDRAFT_02g037440          106   2e-22   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease                105   2e-22   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    105   2e-22   
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                105   2e-22   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    105   2e-22   
ref|XP_006446036.1|  hypothetical protein CICLE_v10018202mg             105   2e-22   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     105   2e-22   
ref|XP_010558849.1|  PREDICTED: subtilisin-like protease SDD1           105   2e-22   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease                100   2e-22   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     105   2e-22   
ref|XP_010457066.1|  PREDICTED: subtilisin-like protease isoform X1     105   2e-22   
ref|XP_010028715.1|  PREDICTED: subtilisin-like protease                105   2e-22   
ref|XP_009381912.1|  PREDICTED: subtilisin-like protease                106   2e-22   
gb|EAY87749.1|  hypothetical protein OsI_09164                          104   2e-22   
gb|EMT32146.1|  Subtilisin-like protease                                101   2e-22   
dbj|BAJ86110.1|  predicted protein                                      105   3e-22   
ref|XP_010090327.1|  Subtilisin-like protease                           105   3e-22   
dbj|BAJ96698.1|  predicted protein                                      105   3e-22   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease                105   3e-22   
ref|XP_004511627.1|  PREDICTED: subtilisin-like protease-like           105   3e-22   
ref|XP_004511628.1|  PREDICTED: subtilisin-like protease-like           105   3e-22   
gb|KHM99187.1|  Subtilisin-like protease                              99.4    3e-22   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                101   3e-22   
gb|ABD64827.1|  putative subtilisin serine protease of stomatal d...    105   3e-22   
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease                105   3e-22   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                105   3e-22   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                105   3e-22   
ref|XP_004515784.1|  PREDICTED: subtilisin-like protease SDD1-like      105   3e-22   
gb|KDP29636.1|  hypothetical protein JCGZ_18798                         105   3e-22   
gb|KHN39620.1|  Subtilisin-like protease                                104   3e-22   
ref|XP_002986601.1|  hypothetical protein SELMODRAFT_425502             104   3e-22   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                102   3e-22   
gb|KDP25556.1|  hypothetical protein JCGZ_20712                         105   3e-22   
gb|KHN09747.1|  Subtilisin-like protease SDD1                           105   3e-22   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                105   3e-22   
emb|CBI37197.3|  unnamed protein product                                105   3e-22   
ref|XP_002892197.1|  hypothetical protein ARALYDRAFT_470387             105   3e-22   
gb|KJB49368.1|  hypothetical protein B456_008G115600                    105   3e-22   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                105   3e-22   
ref|XP_008381935.1|  PREDICTED: subtilisin-like protease SDD1           105   4e-22   
gb|KJB25705.1|  hypothetical protein B456_004G205600                    105   4e-22   
ref|XP_009590434.1|  PREDICTED: subtilisin-like protease SDD1           105   4e-22   
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease                105   4e-22   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           100   4e-22   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           101   4e-22   
ref|XP_004242535.1|  PREDICTED: subtilisin-like protease SDD1           105   4e-22   
ref|NP_569048.1|  subtilisin-like protease                              105   4e-22   
ref|XP_009781098.1|  PREDICTED: subtilisin-like protease                105   4e-22   
ref|XP_004300737.2|  PREDICTED: subtilisin-like protease                105   4e-22   
gb|EYU40429.1|  hypothetical protein MIMGU_mgv1a001733mg                105   4e-22   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       105   4e-22   
gb|KHN45603.1|  Subtilisin-like protease                                102   4e-22   



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 140/183 (77%), Gaps = 10/183 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + TN P R   G  +STP         P      GLVYDI P +Y  FLCSLDY  + IQ
Sbjct  579  DTTNSPLRDAEGDQLSTPWAHGAGHVDPHKALSPGLVYDIRPKEYIKFLCSLDYEMEHIQ  638

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
            AIVK PN+TCAKK S+P Q+NYPSF+VLFGKSR+VR TR LTNVGAAG+ YEV I+APPS
Sbjct  639  AIVKRPNVTCAKKFSDPGQINYPSFAVLFGKSRVVRYTRTLTNVGAAGSTYEVVIDAPPS  698

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            VTVTVKP+KLVFK VG+RLRYTVTFVSKKGV T S   FGS+SWNNAQNQVRSP+++SW+
Sbjct  699  VTVTVKPSKLVFKKVGERLRYTVTFVSKKGVSTMSKTTFGSISWNNAQNQVRSPVSYSWS  758

Query  132  QLF  124
            QLF
Sbjct  759  QLF  761


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA GD+LS PWAHG+GHVDPHKALSPG
Sbjct  586  RDAEGDQLSTPWAHGAGHVDPHKALSPG  613



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 139/183 (76%), Gaps = 10/183 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + TN P R   G  +STP         P      GLVYDI P +Y  FLCSLDY    IQ
Sbjct  584  DTTNSPLRDAEGDQLSTPWAHGAGHVDPHKALSPGLVYDIRPEEYIKFLCSLDYEMDHIQ  643

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
            AIVK PN+TCAKK S+P Q+NYPSF+VLFGKSR+VR TR LTNVGAAG+ YEV I+APPS
Sbjct  644  AIVKRPNVTCAKKFSDPGQINYPSFAVLFGKSRVVRYTRTLTNVGAAGSTYEVVIDAPPS  703

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            VTVTVKP+KLVFK VG+RLRYTVTFVSKKGV T S   FGS+SWNNAQNQVRSP+++SW+
Sbjct  704  VTVTVKPSKLVFKRVGERLRYTVTFVSKKGVSTMSKTTFGSISWNNAQNQVRSPVSYSWS  763

Query  132  QLF  124
            QLF
Sbjct  764  QLF  766


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA GD+LS PWAHG+GHVDPHKALSPG
Sbjct  591  RDAEGDQLSTPWAHGAGHVDPHKALSPG  618



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 138/183 (75%), Gaps = 10/183 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + TN P R   G  +STP         P      GL+YDI P DY  FLCSLDY    IQ
Sbjct  581  DTTNSPLRDAEGGQLSTPWAHGSGHVDPHKALSPGLIYDITPEDYIKFLCSLDYELNHIQ  640

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
            AIVK PN+TC KK ++P Q+NYPSFSVLFGKSR+VR TR +TNVGAAG++YEV ++APPS
Sbjct  641  AIVKRPNVTCTKKFADPGQINYPSFSVLFGKSRVVRYTRAVTNVGAAGSVYEVTVDAPPS  700

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            VTVTVKP+KLVFK VG+RLRYTVTFVSKKGV     +AFGS+SWNNAQNQVRSP+++SW+
Sbjct  701  VTVTVKPSKLVFKRVGERLRYTVTFVSKKGVNMMRKSAFGSISWNNAQNQVRSPVSYSWS  760

Query  132  QLF  124
            QL 
Sbjct  761  QLL  763


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G +LS PWAHGSGHVDPHKALSPG
Sbjct  588  RDAEGGQLSTPWAHGSGHVDPHKALSPG  615



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 136/183 (74%), Gaps = 10/183 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + TN P R   G  +STP         P      GL+YDI P DY  FLCSLDY    IQ
Sbjct  581  DTTNSPLRDAEGGQLSTPFAHGSGHVDPHKALSPGLIYDITPEDYIKFLCSLDYELNHIQ  640

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
            AIVK PN+TCAKK ++P Q+NYPSFSVLFGKSR+VR TR +TNV AAG++YEV ++APPS
Sbjct  641  AIVKRPNVTCAKKFADPGQINYPSFSVLFGKSRVVRYTRAVTNVAAAGSVYEVVVDAPPS  700

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            V VTVKP+KLVFK VG+RLRYTVTFVS KGV     +AFGS+SWNNAQNQVRSP+++SW+
Sbjct  701  VLVTVKPSKLVFKRVGERLRYTVTFVSNKGVNMMRKSAFGSISWNNAQNQVRSPVSYSWS  760

Query  132  QLF  124
            QL 
Sbjct  761  QLL  763


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G +LS P+AHGSGHVDPHKALSPG
Sbjct  588  RDAEGGQLSTPFAHGSGHVDPHKALSPG  615



>gb|ABK96588.1| unknown [Populus trichocarpa x Populus deltoides]
Length=218

 Score =   223 bits (568),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 134/182 (74%), Gaps = 10/182 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + TN P +   G A+S P         P+     GLVYDI+  +Y  FLCSLDYT + +Q
Sbjct  37   DNTNSPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISADEYVAFLCSLDYTIEHVQ  96

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
            AIVK PNITC++K +NP  LNYPSFSV+F  +R+VR TRELTNVGAAG++YEVA+  P +
Sbjct  97   AIVKRPNITCSRKFNNPGNLNYPSFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQA  156

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            V VTVKP+KLVFKNVGD+LRYTVTFV++KG      + FG++ W NAQ+QVRSP+AFSWT
Sbjct  157  VQVTVKPSKLVFKNVGDKLRYTVTFVARKGASLTGRSEFGAIVWRNAQHQVRSPVAFSWT  216

Query  132  QL  127
            QL
Sbjct  217  QL  218


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            +DA G  LSNPWAHGSGHVDP KALSPG
Sbjct  44   QDAAGGALSNPWAHGSGHVDPQKALSPG  71



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 137/184 (74%), Gaps = 11/184 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            TL+  N P R     ++STP        +P      GLVYD  P DY  FLCSL YT + 
Sbjct  576  TLDNANSPLRDAADYSLSTPWAHGAGHVNPHKALSPGLVYDATPEDYVAFLCSLRYTVEM  635

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAP  319
            IQAI K PNITCA+K  +P QLNYPSFSVLFGKSRIV+ +RELTNVGAAG++Y V++EAP
Sbjct  636  IQAIAKRPNITCARKFRDPGQLNYPSFSVLFGKSRIVKYSRELTNVGAAGSVYLVSVEAP  695

Query  318  PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFS  139
            P+V V+VKP+KLVFKNVGD+ RYTVTF SKK  V P + AFGS++W NAQ+QV+SP+AFS
Sbjct  696  PTVAVSVKPSKLVFKNVGDKQRYTVTFTSKKS-VNPVSHAFGSITWKNAQDQVKSPVAFS  754

Query  138  WTQL  127
            WTQL
Sbjct  755  WTQL  758



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 136/183 (74%), Gaps = 11/183 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            TL+ TN P +     ++STP         P+     GLVYD  P DY  FLCSLDYT + 
Sbjct  561  TLDNTNSPLKDAADYSISTPWAHGAGHVDPQKALSPGLVYDAKPEDYIAFLCSLDYTMEM  620

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAP  319
            IQAIVK PN+TCA K  +P QLNYPSFSV+FGKSR+VR TR LTNVGAAG++Y V++EAP
Sbjct  621  IQAIVKHPNVTCAAKFRDPGQLNYPSFSVVFGKSRVVRYTRRLTNVGAAGSVYRVSVEAP  680

Query  318  PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFS  139
            P+V V+VKP+ LVF+NVGDR RYTVTFVS+KG V P +  FGS++W N Q+QVRSP+AFS
Sbjct  681  PNVVVSVKPSNLVFRNVGDRQRYTVTFVSQKG-VDPLHNGFGSITWKNEQHQVRSPVAFS  739

Query  138  WTQ  130
            W++
Sbjct  740  WSR  742



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 134/182 (74%), Gaps = 10/182 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + TN P +   G A+S P         P+     GLVYDI+  +Y  FLCSLDYT + +Q
Sbjct  587  DNTNSPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISADEYVAFLCSLDYTIEHVQ  646

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
            AIVK PNITC++K +NP  LNYPSFSV+F  +R+VR TRELTNVGAAG++YEVA+  P +
Sbjct  647  AIVKRPNITCSRKFNNPGNLNYPSFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQA  706

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            V VTVKP+KLVFKNVGD+LRYTVTFV++KG      + FG++ W NAQ+QVRSP+AFSWT
Sbjct  707  VQVTVKPSKLVFKNVGDKLRYTVTFVARKGASLTGRSEFGAIVWRNAQHQVRSPVAFSWT  766

Query  132  QL  127
            QL
Sbjct  767  QL  768


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            +DA G  LSNPWAHGSGHVDP KALSPG
Sbjct  594  QDAAGGALSNPWAHGSGHVDPQKALSPG  621



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 133/182 (73%), Gaps = 11/182 (6%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + TN P +   G A+S P         P+     GLVYDI+  DY  FLCSLDYT + +Q
Sbjct  587  DNTNSPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISTDDYVAFLCSLDYTIEHVQ  646

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
            AIVK PNITC++K  NP  LNYPSFSV+F  +R+VR TRELTNVGAAG++YEVA+  P +
Sbjct  647  AIVKRPNITCSRKF-NPGNLNYPSFSVVFTNNRVVRYTRELTNVGAAGSIYEVAVTGPQA  705

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            V VTVKP+KLVFKN+GD+LRYTVTFV++KG      + FG++ W NAQ+QVRSP+AFSWT
Sbjct  706  VQVTVKPSKLVFKNIGDKLRYTVTFVARKGASLTGRSEFGAIMWRNAQHQVRSPVAFSWT  765

Query  132  QL  127
            QL
Sbjct  766  QL  767


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            +DA G  LSNPWAHGSGHVDP KALSPG
Sbjct  594  QDAAGGALSNPWAHGSGHVDPQKALSPG  621



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYD++  DY  FLCSL YT   +Q IVK PN+TCA+K S+P +LN
Sbjct  607  GSGHVDPHKAMSPGLVYDVSTEDYVAFLCSLGYTIDHVQLIVKRPNVTCARKFSDPGELN  666

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSV+FG  R+VR TRELTNVG AG++YEV + AP +V V+VKPTKLVF+NVGD+LRY
Sbjct  667  YPSFSVVFGNKRVVRYTRELTNVGEAGSIYEVEVTAPSTVGVSVKPTKLVFRNVGDKLRY  726

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            TVTFV+KKG+   +   FGS+ W NA++QVRSP+AF+WTQL 
Sbjct  727  TVTFVAKKGIRKAARNGFGSIVWRNAEHQVRSPVAFAWTQLL  768


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 4/32 (13%)
 Frame = -2

Query  652  RDAGGDE----LSNPWAHGSGHVDPHKALSPG  569
            RDAG       LSNPWAHGSGHVDPHKA+SPG
Sbjct  589  RDAGSTTIPGTLSNPWAHGSGHVDPHKAMSPG  620



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  +Y  FLCSL YT   +QAIVK PN+TC+KK  +P +LN
Sbjct  604  GSGHVDPHKALTPGLVYDISTQEYEAFLCSLGYTIDHVQAIVKRPNVTCSKKFRDPGELN  663

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSV+F   R+VR TRELTNVG AG++YEVA+  P +V VTVKPTKLVFKNVGD+LRY
Sbjct  664  YPSFSVVFASKRVVRYTRELTNVGEAGSIYEVAVNGPSTVGVTVKPTKLVFKNVGDKLRY  723

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            TVTFV+KKG    + + FGS+ W NAQ+QVRSPIAF+WT L 
Sbjct  724  TVTFVAKKGANQDARSEFGSIVWRNAQHQVRSPIAFTWTHLL  765


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 3/31 (10%)
 Frame = -2

Query  652  RDAGGD---ELSNPWAHGSGHVDPHKALSPG  569
            RDAG D     SNPWAHGSGHVDPHKAL+PG
Sbjct  587  RDAGSDVAGAFSNPWAHGSGHVDPHKALTPG  617



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  DY  FLCSLDYT + +QAIVK PN+TC++K S+P QLN
Sbjct  601  GSGHVEPQKALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKKPNVTCSRKYSDPGQLN  660

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSV+FGK R+VR +RE TNVGAAG++Y VA+  P  V + VKPT+LVFKNVG++ +Y
Sbjct  661  YPSFSVVFGKKRVVRYSREFTNVGAAGSIYRVAVTGPQMVRIAVKPTRLVFKNVGEKQKY  720

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            TVTFV+ KG    + + FGS+ W N Q+QV+SPIAF+WTQL 
Sbjct  721  TVTFVANKGADKTARSEFGSIVWQNPQHQVKSPIAFAWTQLI  762



>gb|EYU25845.1| hypothetical protein MIMGU_mgv1a013289mg [Erythranthe guttata]
Length=225

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 125/188 (66%), Gaps = 16/188 (9%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++  N P R     ++STP         P      GLVYD  P DY  FLCSLDYT   
Sbjct  35   TVDNANSPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPDDYVSFLCSLDYTDDA  94

Query  498  IQAIVKAPNITCA--KKLSNPAQLNYPSFSVLFG----KSRIVRQTRELTNVGAAGTLYE  337
            +Q I + PN TC+  ++  +P QLNYPSFSV+FG     SR+VR TRELTNVG AG+ Y 
Sbjct  95   VQLIARRPNATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRYTRELTNVGPAGSAYV  154

Query  336  VAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  157
              IEAPP+V  TVKP+KLVF NVGD+LRYTVTFVSKK V     + FGS++W NAQ+QVR
Sbjct  155  AEIEAPPTVVATVKPSKLVFGNVGDKLRYTVTFVSKKDVDYSLTSGFGSITWKNAQHQVR  214

Query  156  SPIAFSWT  133
            SP++FSWT
Sbjct  215  SPVSFSWT  222


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    LS PWAHG+GHVDPHKALSPG
Sbjct  44   RDAADYSLSTPWAHGAGHVDPHKALSPG  71



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  DY  FLCSLDYT  Q++A+ K PN+TC++K ++P QLN
Sbjct  607  GSGHVDPEKALSPGLVYDISTDDYVAFLCSLDYTIDQVRAVAKRPNVTCSRKFADPGQLN  666

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  RIVR TR+LTNVGAAG++Y V +  PP+V VTVKP KLVF  VGDR  Y
Sbjct  667  YPSFSVLFGSKRIVRYTRQLTNVGAAGSVYAVTVMGPPAVEVTVKPPKLVFAKVGDRRSY  726

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFVSKKG+     + FGS+ W+NAQN+VRSP+A++WTQ+
Sbjct  727  TVTFVSKKGMNQTVRSDFGSIVWSNAQNEVRSPVAYAWTQI  767



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  DY  FLCSLDYT + +QAIVK PN+TC++K S+P QLN
Sbjct  601  GSGHVEPQKALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKKPNVTCSRKYSDPGQLN  660

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSV+FG  R+VR +RELTNVGAAG++Y VA+  P  V + VKPT+LVFKNVG++ +Y
Sbjct  661  YPSFSVVFGNKRVVRYSRELTNVGAAGSIYRVAVTGPQMVRIAVKPTRLVFKNVGEKQKY  720

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            TVTFV+ KG    + + FGS+ W N Q+QV+SPIAF+WTQL 
Sbjct  721  TVTFVANKGADKTARSEFGSIVWANPQHQVKSPIAFAWTQLI  762



>dbj|BAD94244.1| serine protease like protein [Arabidopsis thaliana]
Length=334

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P       ++S P         P+     GLVYDI+  +Y  FLCSLDYT   I
Sbjct  152  LDNTNAPLHDAADNSLSNPYAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHI  211

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK P++ C+KK S+P QLNYPSFSVLFG  R+VR TR++TNVGAA ++Y+V +   P
Sbjct  212  VAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTRKVTNVGAASSVYKVTVNGAP  271

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV ++VKP+KL FK+VG++ RYTVTFVSKKGV   + A FGS++W+N Q++VRSP+AFSW
Sbjct  272  SVGISVKPSKLSFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAFSW  331

Query  135  TQL  127
             + 
Sbjct  332  NRF  334



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 126/182 (69%), Gaps = 10/182 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + T  P R   G  +STP         P+     GLVYDI+  +Y  FLCSLDYTT  IQ
Sbjct  580  DNTKSPLRDAEGDQVSTPWAHGAGHVDPQKALSPGLVYDISVDEYINFLCSLDYTTDHIQ  639

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
             IVK  N TC+KK S+P  LNYPSFSVLF   R+VR TR LTNVGAA ++Y VA+ APP+
Sbjct  640  TIVKHRNFTCSKKFSDPGALNYPSFSVLFANKRVVRYTRRLTNVGAAASVYTVAVNAPPT  699

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            V VTVKP KL FK+VG+RLRYTVTFV+ +G    S + FGS+ W+NA++QVRSP AF+WT
Sbjct  700  VKVTVKPAKLAFKSVGERLRYTVTFVASRGAARTSRSEFGSIVWSNAEHQVRSPAAFAWT  759

Query  132  QL  127
            QL
Sbjct  760  QL  761


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA GD++S PWAHG+GHVDP KALSPG
Sbjct  587  RDAEGDQVSTPWAHGAGHVDPQKALSPG  614



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 129/183 (70%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ T  P R   G  +STP         P+     GLVYD+   DY  FLCSLDYT   +
Sbjct  594  LDNTRSPLRDAAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHV  653

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
            + IVK PN+TC++K S+P +LNYPSFSV+F   ++VR TRELTNVGAAG++Y V++  P 
Sbjct  654  KTIVKRPNVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPS  713

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +V VTVKP KL+F  VGD++RYTVTFVSKKG    + + FGS+ W+NAQN+VRSP+A++W
Sbjct  714  TVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAW  773

Query  135  TQL  127
            T+L
Sbjct  774  TKL  776


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G  +S PWAHGSGHVDP KALSPG
Sbjct  602  RDAAGGTVSTPWAHGSGHVDPQKALSPG  629



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 129/183 (70%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ T  P R   G  +STP         P+     GLVYD+   DY  FLCSLDYT   +
Sbjct  597  LDNTRSPLRDAAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHV  656

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
            + IVK PN+TC++K S+P +LNYPSFSV+F   ++VR TRELTNVGAAG++Y V++  P 
Sbjct  657  KTIVKRPNVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPS  716

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +V VTVKP KL+F  VGD++RYTVTFVSKKG    + + FGS+ W+NAQN+VRSP+A++W
Sbjct  717  TVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAW  776

Query  135  TQL  127
            T+L
Sbjct  777  TKL  779


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G  +S PWAHGSGHVDP KALSPG
Sbjct  605  RDAAGGTVSTPWAHGSGHVDPQKALSPG  632



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 128/182 (70%), Gaps = 10/182 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ T  P R   G   STP         P+     GLVYD+   DY  FLCSLDYT   +
Sbjct  593  LDNTGSPLRDAAGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHV  652

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
            +AIVK PN+TC++K S+P +LNYPSFSV+F   ++VR TRELTNVGAAG++Y V++  P 
Sbjct  653  KAIVKRPNVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPS  712

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +V VTVKP KL+F  VGD++RYTVTFVSKKG    + + FGS+ W+NAQN+VRSP+A++W
Sbjct  713  TVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAW  772

Query  135  TQ  130
            T+
Sbjct  773  TK  774


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G   S PWAHGSGHVDP KALSPG
Sbjct  601  RDAAGGTFSTPWAHGSGHVDPQKALSPG  628



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 128/182 (70%), Gaps = 10/182 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ T  P R   G   STP         P+     GLVYD+   DY  FLCSLDYT   +
Sbjct  593  LDNTGSPLRDAAGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHV  652

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
            +AIVK PN+TC++K S+P +LNYPSFSV+F   ++VR TRELTNVGAAG++Y V++  P 
Sbjct  653  KAIVKRPNVTCSRKFSDPGELNYPSFSVVFNDKKVVRYTRELTNVGAAGSMYNVSVTGPS  712

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +V VTVKP KL+F  VGD++RYTVTFVSKKG    + + FGS+ W+NAQN+VRSP+A++W
Sbjct  713  TVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVWSNAQNKVRSPVAYAW  772

Query  135  TQ  130
            T+
Sbjct  773  TK  774


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G   S PWAHGSGHVDP KALSPG
Sbjct  601  RDAAGGTFSTPWAHGSGHVDPQKALSPG  628



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTPT-----RPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P R     ++S P         P+     GLVYDI+  +Y  FLCSLDYT   I
Sbjct  555  LDNTNSPLRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHI  614

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK P++ C+ K SNP QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   P
Sbjct  615  VAIVKRPSVNCSNKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANSVYKVVVNGAP  674

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV ++VKP+KL F++VG++ RYTVTFVSKKGV   + A FGS++W+N Q+QVRSP+AFSW
Sbjct  675  SVGISVKPSKLAFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVAFSW  734

Query  135  TQL  127
             + 
Sbjct  735  NRF  737



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTPT-----RPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P R     ++S P         P+     GLVYDI+  +Y  FLCSLDYT   I
Sbjct  569  LDNTNSPLRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHI  628

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK P++ C+KK SNP QLNYPSFSVLFG  R+VR TRE+TNVGA  ++Y+V +   P
Sbjct  629  VAIVKRPSVNCSKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAPNSVYKVVVNGAP  688

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV ++VKP+KL F++VG++ RYTVTFVSKKGV   + A FGS++W+N Q+QVRSP+AFSW
Sbjct  689  SVGISVKPSKLSFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVAFSW  748

Query  135  TQL  127
             + 
Sbjct  749  NRF  751



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 130/183 (71%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-TRPSPR---------GLVYDIAPTDYTMFLCSLDYTTQQI  496
            ++ TN P R     ++S P T  S           GLVYDI+  +Y  FLCSLDYT   I
Sbjct  590  VDNTNLPLRDAADNSLSNPWTHGSGHVDPQKAMSPGLVYDISTEEYIRFLCSLDYTVDHI  649

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
            QAIVK P++ C++K S+P QLNYPSFSVLFG  R+ R TRELTNVG  G++Y+VA++ P 
Sbjct  650  QAIVKRPSVNCSRKFSDPGQLNYPSFSVLFGDKRVARYTRELTNVGTPGSIYKVAVDGPA  709

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV VTVKPT+LVF  VG++ RYTVTF +K+G+   +++ FGS++W+N+++ VRSP+ FSW
Sbjct  710  SVAVTVKPTRLVFGAVGEKKRYTVTFSAKRGMSLATSSEFGSITWSNSEHSVRSPVVFSW  769

Query  135  TQL  127
            T+L
Sbjct  770  TRL  772


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA  + LSNPW HGSGHVDP KA+SPG
Sbjct  598  RDAADNSLSNPWTHGSGHVDPQKAMSPG  625



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 125/184 (68%), Gaps = 10/184 (5%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTPT----------RPSPRGLVYDIAPTDYTMFLCSLDYTTQQ  499
            TL+ TN P R     ++S P           +    GLVYDI+  +Y  FLCSLDYT   
Sbjct  579  TLDNTNSPLRDAADNSLSNPHVHGSGHVDPLKALTPGLVYDISTEEYIKFLCSLDYTVDH  638

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAP  319
            I AIVK P++ C KK SNP QLNYPSFSVLFG  R+VR TRE+TNVGAA  +Y+V +   
Sbjct  639  IVAIVKRPSVNCLKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANAVYKVVVSGA  698

Query  318  PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFS  139
            PSV ++VKP+KL F+ VG++ RYTVTFVSKKGV   + A +GS++W N Q++VRSP+AFS
Sbjct  699  PSVGISVKPSKLAFRKVGEKKRYTVTFVSKKGVSLTNKAEYGSITWTNTQHEVRSPVAFS  758

Query  138  WTQL  127
            W + 
Sbjct  759  WNRF  762



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTPT-----RPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P R     ++S P         P+     GLVYDI+  +Y  FLCSLDYT   I
Sbjct  581  LDNTNSPLRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHI  640

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK P++ C+KK SNP QLNYPSFSVLFG  R+VR TRE+TNVGA  ++Y+V +   P
Sbjct  641  VAIVKRPSVNCSKKFSNPGQLNYPSFSVLFGGKRVVRYTREVTNVGAPNSVYKVVVNGAP  700

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV ++VKP+KL F++VG++ RYTVTFVSKKGV   + A FGS++W+N Q+QVRSP+AFSW
Sbjct  701  SVGISVKPSKLSFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITWSNPQHQVRSPVAFSW  760

Query  135  TQL  127
             + 
Sbjct  761  NRF  763



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P       ++S P         P+     GLVYDI+  +Y  FLCSLDYT   I
Sbjct  572  LDNTNAPLHDAADNSLSNPYAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHI  631

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK P++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   P
Sbjct  632  VAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVTVNGAP  691

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV ++VKP+KL FK+VG++ RYTVTFVSKKGV   + A FGS++W+N Q++VRSP+AFSW
Sbjct  692  SVGISVKPSKLSFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAFSW  751

Query  135  TQL  127
             + 
Sbjct  752  NRF  754



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  DY  FLCSLDYT + ++AIVK  NITC++K S+P +LN
Sbjct  598  GSGHVDPQKALSPGLVYDISTQDYVAFLCSLDYTIEHVRAIVKRQNITCSRKFSDPGELN  657

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG    VR TRELTNVGAA ++Y+VA+  PPSV V V+P+ LVFKNVG++ RY
Sbjct  658  YPSFSVLFGSKGFVRYTRELTNVGAADSVYQVAVTGPPSVGVVVRPSTLVFKNVGEKKRY  717

Query  249  TVTFVSKKGVVTP---SNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFV+KKG       + +AFGS+ W+N Q+QV+SP+A++WTQL
Sbjct  718  TVTFVAKKGKKVQNRMTRSAFGSIVWSNTQHQVKSPVAYAWTQL  761



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTPT-----RPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P       ++S P         P+     GLVYDI+  +Y  FLCSLDYT   I
Sbjct  570  LDNTNAPLHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHI  629

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK P++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGA  ++Y+V +   P
Sbjct  630  VAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAENSVYKVTVNGAP  689

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV ++VKP+KL F++VG++ RYTVTFVSKKGV   + A FGS++W+N Q++VRSP+AFSW
Sbjct  690  SVAISVKPSKLAFRSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWSNPQHEVRSPVAFSW  749

Query  135  TQL  127
             + 
Sbjct  750  NRF  752



>gb|KHN12283.1| Subtilisin-like protease, partial [Glycine soja]
Length=438

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYD  P+DY  FLCSL+YT ++IQ I K   + C K+ S+P QLN
Sbjct  278  GAGHVNPHKALSPGLVYDATPSDYIKFLCSLEYTPERIQLITKRSGVNCTKRFSDPGQLN  337

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  R+VR TR LTNVG AG++Y V ++AP +VTVTVKP  LVF  VG+R RY
Sbjct  338  YPSFSVLFGGKRVVRYTRVLTNVGEAGSVYNVTVDAPSTVTVTVKPVALVFGKVGERQRY  397

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            T TFVSK GV       FGS+ W+NAQ+QVRSP+AFSWT L
Sbjct  398  TATFVSKNGVGDSVRYGFGSILWSNAQHQVRSPVAFSWTLL  438


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G   SNPWAHG+GHV+PHKALSPG
Sbjct  264  RDAAGGAFSNPWAHGAGHVNPHKALSPG  291



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 121/182 (66%), Gaps = 10/182 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + T FP R   G A S P        +P      GLVYD    DY  FLCSL+YT + IQ
Sbjct  417  DNTKFPLRDAAGGAFSNPWAHGACHMNPHKALSPGLVYDAIAWDYVKFLCSLEYTPEHIQ  476

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
             I K   + C KK S+P QLNYPSFS+LFG  R+VR TR L NVG  G++Y V ++AP +
Sbjct  477  LITKRHGVNCTKKFSDPGQLNYPSFSILFGGKRVVRYTRVLINVGETGSIYNVTVDAPST  536

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            +T+ VKPT+LVF+ VG+R RYTVTFVSK+GV   +   FGS+ W+NAQ+QVRSP+AFSWT
Sbjct  537  MTIKVKPTRLVFEKVGERQRYTVTFVSKRGVGDSARYGFGSIMWSNAQHQVRSPVAFSWT  596

Query  132  QL  127
             L
Sbjct  597  LL  598



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  +Y  FLCSL+YT   I AIVK P++ C+KK S+P QLN
Sbjct  594  GSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRPSVNCSKKFSDPGQLN  653

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   PSV ++VKPTKL FK VG++ RY
Sbjct  654  YPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGAPSVGISVKPTKLAFKRVGEKKRY  713

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFVSKKGV   + A FGS++W N Q++VRSP+AFSW + 
Sbjct  714  TVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFSWNRF  754



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI   D+  FLCSLDY   QIQAIVK  N TCA K ++  Q+N
Sbjct  599  GSGHVNPQKALSPGLVYDIRIQDHIKFLCSLDYPMDQIQAIVKRVNFTCANKFADAGQIN  658

Query  429  YPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            YPSFSVLFG   +R+VR TRE+TNVGAA ++YEVAI+AP SVT TVKP KLVFK VG++L
Sbjct  659  YPSFSVLFGINSTRVVRYTREVTNVGAAESVYEVAIDAPSSVTATVKPPKLVFKKVGEKL  718

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             YTVTFVSKKGV T +  AFG +SW NA+NQVRSP+AFSW
Sbjct  719  HYTVTFVSKKGVKTGN--AFGWISWENAENQVRSPVAFSW  756



>ref|XP_009590702.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=778

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 4/171 (2%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC  463
            E++ F +    G     P +    GL+YDI   D+  FLCSL Y   QIQAIVK  N TC
Sbjct  605  EDSIFSSPLAHGSGHVNPQKALSPGLIYDIRIQDHIKFLCSLHYPMDQIQAIVKRVNFTC  664

Query  462  AKKLSNPAQLNYPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  289
            A K ++  Q+NYPSFSVLFG   +R+VR TRE+TNVGAAG++YEVAI+ P SVTVTVKP 
Sbjct  665  ANKFADAGQINYPSFSVLFGVNSTRVVRYTREVTNVGAAGSVYEVAIDGPSSVTVTVKPP  724

Query  288  KLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            KLVFK VG++L YTVTFVSKKG+ T +  AFG +SW NA+NQVRSP+A+SW
Sbjct  725  KLVFKKVGEKLHYTVTFVSKKGIKTGN--AFGWISWKNAENQVRSPVAYSW  773



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 126/184 (68%), Gaps = 12/184 (7%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTPTRP-----------SPRGLVYDIAPTDYTMFLCSLDYTTQQ  499
            L+ TN P       ++S P              SP GLVYDI+  +Y  FLCSL+YT   
Sbjct  573  LDNTNSPLHDAADNSLSNPHAHGSGHVDPLKALSP-GLVYDISTEEYIRFLCSLEYTVDH  631

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAP  319
            I AIVK P++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   
Sbjct  632  IVAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGA  691

Query  318  PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFS  139
            PSV V+VKP KL FK+VG++ RYTVTFVSKKGV   + A FGS++W N Q++VRSP+AFS
Sbjct  692  PSVGVSVKPLKLAFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFS  751

Query  138  WTQL  127
            W + 
Sbjct  752  WNRF  755



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 126/183 (69%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTPT-----RPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P       ++S P         P+     GLVYDI+  +Y  FLCSL+YT   I
Sbjct  574  LDNTNSPLHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHI  633

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK P++ C+KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   P
Sbjct  634  VAIVKRPSVNCSKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAASSVYKVMVNGAP  693

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV ++VKP KL FK+VG++ RYTVTFVSKKGV   + A FGS++W N Q++VRSP+AFSW
Sbjct  694  SVGISVKPLKLAFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFSW  753

Query  135  TQL  127
             + 
Sbjct  754  NRF  756



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 127/185 (69%), Gaps = 11/185 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T + +  P R   G++ STP        +P+     GLVYD +  DY  FLCSL+Y  +Q
Sbjct  590  THDNSKSPLRDAAGKSFSTPWAHGAGHVNPQKAFSPGLVYDASTKDYITFLCSLNYNPEQ  649

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAP  319
            IQ IVK P++ C  K +NP QLNYPSFS++F   R+VR TR LTNVG AG++Y V ++ P
Sbjct  650  IQLIVKRPDVNCTNKFANPGQLNYPSFSIMFSSKRVVRYTRILTNVGEAGSVYNVVVDGP  709

Query  318  PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAF  142
              V +TVKP++LVF+ VGDR RYTVTFVSKKGV T S    FGS+ W+N Q+QVRSPIAF
Sbjct  710  SWVDITVKPSRLVFEKVGDRKRYTVTFVSKKGVDTSSVRNGFGSILWSNTQHQVRSPIAF  769

Query  141  SWTQL  127
            +WT+L
Sbjct  770  AWTEL  774



>gb|KGN66306.1| hypothetical protein Csa_1G597040 [Cucumis sativus]
Length=566

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 117/161 (73%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GL+YDI+  DY  FLCSLDY    +QAIVK  NITC++K ++P QLN
Sbjct  406  GAGHVDPHKALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRSNITCSRKFADPGQLN  465

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSV+FG  R+VR TR +TNVGAAG++Y+VA  APP V VTVKP+KLVF  VG+R RY
Sbjct  466  YPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPPVVKVTVKPSKLVFTKVGERKRY  525

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFV+ +     +   FGS+ W+N Q+QVRSP++F+WT+L
Sbjct  526  TVTFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAWTRL  566


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G   SNPWAHG+GHVDPHKALSPG
Sbjct  392  RDAAGGGFSNPWAHGAGHVDPHKALSPG  419



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYD +  DY  FLCSL YT + +QAIVK PNITC +K + P +LN
Sbjct  603  GSGHVNPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKRPNITCTRKFNTPGELN  662

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  R+VR TRELTNVG A +LY V  + P +V ++V+P +L+F+ VG++ RY
Sbjct  663  YPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTADGPSTVGISVRPKRLLFRTVGEKKRY  722

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            TVTFV+K G      AAFGS+ W NAQ+QVRSP+AFSWTQL 
Sbjct  723  TVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSWTQLM  764



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYD +  DY  FLCSL YT + +QAIVK PNITC +K + P +LN
Sbjct  622  GSGHVNPQKAISPGLVYDASTEDYVAFLCSLGYTIEHVQAIVKRPNITCTRKFNTPGELN  681

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  R+VR TRELTNVG A +LY V  + P +V ++V+P +L+F+ VG++ RY
Sbjct  682  YPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTADGPSTVGISVRPKRLLFRTVGEKKRY  741

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            TVTFV+K G      AAFGS+ W NAQ+QVRSP+AFSWTQL 
Sbjct  742  TVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSWTQLM  783



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 0/162 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYD +  DY  FLCSL YT + ++AIVK PNITC +K + P +LN
Sbjct  603  GSGHVNPQKAISPGLVYDASTEDYIAFLCSLGYTIEHVKAIVKRPNITCTRKFNTPGELN  662

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  R+VR TRELTNVG A +LY V ++ P +V ++V+P +L+F+ VG++ RY
Sbjct  663  YPSFSVLFGDQRVVRYTRELTNVGPARSLYNVTVDGPSTVGISVRPKRLLFRTVGEKKRY  722

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            TVTFV+K G      AAFGS+ W NAQ+QVRSP+AFSWTQL 
Sbjct  723  TVTFVAKNGDQKMGGAAFGSIVWGNAQHQVRSPVAFSWTQLM  764



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 126/183 (69%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P R     ++S P         P+     GLVYDI+  +Y  FLCSLDYT   I
Sbjct  572  LDNTNSPLRDAADNSLSNPWAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHI  631

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK P++ C+KK ++P QLNYPSFSV+FG  R+VR TRE+TNVGAA ++Y+V +    
Sbjct  632  VAIVKRPSVNCSKKFADPGQLNYPSFSVVFGGKRVVRYTREVTNVGAASSVYKVTVNGAA  691

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV ++VKP KL F+ VG++ RYTVTFVSKKGV   + A FGS++W+N Q++VRSP+AFSW
Sbjct  692  SVGISVKPAKLAFRRVGEKKRYTVTFVSKKGVSLTNKAEFGSITWSNPQHEVRSPVAFSW  751

Query  135  TQL  127
             + 
Sbjct  752  NRF  754


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA  + LSNPWAHGSGHVDP KALSPG
Sbjct  580  RDAADNSLSNPWAHGSGHVDPQKALSPG  607



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 123/173 (71%), Gaps = 1/173 (1%)
 Frame = -3

Query  639  ETNFPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  460
            + +F T    G     P +    GLVYD +  DY  FLCSL+Y ++QIQ IVK P++ C 
Sbjct  606  DGSFSTPLAHGAGHVNPQKALSPGLVYDASTKDYITFLCSLNYNSEQIQLIVKRPSVNCT  665

Query  459  KKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  280
            KK +NP QLNYPSFSV+F   R+VR TR +TNVG AG++Y V ++ P SV +TVKP++LV
Sbjct  666  KKFANPGQLNYPSFSVVFSSKRVVRYTRIVTNVGEAGSVYNVVVDVPSSVGITVKPSRLV  725

Query  279  FKNVGDRLRYTVTFVSKKGV-VTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            F+ VG+R RYTVTFVSKKG   +   + FGS+ W+NAQ+QVRSPIAF+WT+L 
Sbjct  726  FEKVGERKRYTVTFVSKKGADASKVRSGFGSILWSNAQHQVRSPIAFAWTELL  778



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 120/164 (73%), Gaps = 2/164 (1%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P++    GLVYDIA  DY  FLCSL+YT + +QAIVK PN+TCA+K S+P QLN
Sbjct  600  GSGHVDPSKALSPGLVYDIATEDYIAFLCSLEYTNEHVQAIVKRPNVTCARKYSDPGQLN  659

Query  429  YPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            YPSFSV+F   K R+V  TRELTNVG AG++Y VA+ +P  V   VKPT+LVF NVG++ 
Sbjct  660  YPSFSVMFWNKKKRVVSYTRELTNVGPAGSVYRVAVTSPSMVRTIVKPTRLVFNNVGEKQ  719

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            +YTVTFV+ +G    S + FGS+ W+N Q+QV+SP+AF+WTQL 
Sbjct  720  KYTVTFVASQGAEKTSRSEFGSIMWSNPQHQVKSPVAFAWTQLI  763



>ref|XP_003533787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYD  P+DY  FLCSL+YT ++IQ I K   + C K+ S+P QLN
Sbjct  610  GAGHVNPHKALSPGLVYDATPSDYIKFLCSLEYTPERIQLITKRSGVNCTKRFSDPGQLN  669

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  R+VR TR LTNVG AG++Y V ++AP +VTVTVKP  LVF  VG+R RY
Sbjct  670  YPSFSVLFGGKRVVRYTRVLTNVGEAGSVYNVTVDAPSTVTVTVKPAALVFGKVGERQRY  729

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            T TFVSK GV       FGS+ W+NAQ+QVRSP+AFSWT L
Sbjct  730  TATFVSKNGVGDSVRYGFGSIMWSNAQHQVRSPVAFSWTLL  770


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G   SNPWAHG+GHV+PHKALSPG
Sbjct  596  RDAAGGAFSNPWAHGAGHVNPHKALSPG  623



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQ  436
            + G     P +    GLVYDI+  DY  FLCSLDYT    Q I K PNITC++KLS+P Q
Sbjct  611  VHGAGHVDPHKAISPGLVYDISVDDYIAFLCSLDYTPLHRQIIAKRPNITCSRKLSDPGQ  670

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSFS+ FGKSRIVR TRELTNVGAA TLY+V ++AP SV V V+P++L+F+++G++ 
Sbjct  671  LNYPSFSIQFGKSRIVRYTRELTNVGAARTLYQVQVDAPRSVGVKVRPSRLLFRSIGEKK  730

Query  255  RYTVTFVSKKGVV-TPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            +YTVTFV++KG    P+  AFGS+ W++  NQVRSP++F+WT L 
Sbjct  731  KYTVTFVARKGKTPPPTRTAFGSLLWSSKTNQVRSPVSFTWTTLL  775


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    LSNPW HG+GHVDPHKA+SPG
Sbjct  599  RDAADGSLSNPWVHGAGHVDPHKAISPG  626



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 117/161 (73%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GL+YDI+  DY  FLCSLDY    +QAIVK  NITC++K ++P QLN
Sbjct  603  GAGHVDPHKALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRSNITCSRKFADPGQLN  662

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSV+FG  R+VR TR +TNVGAAG++Y+VA  APP V VTVKP+KLVF  VG+R RY
Sbjct  663  YPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPPVVKVTVKPSKLVFTKVGERKRY  722

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFV+ +     +   FGS+ W+N Q+QVRSP++F+WT+L
Sbjct  723  TVTFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAWTRL  763


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G   SNPWAHG+GHVDPHKALSPG
Sbjct  589  RDAAGGGFSNPWAHGAGHVDPHKALSPG  616



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 13/182 (7%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            ++ TN P R   G +++TP         PR     GLVYDI   DY  FLCSLDYT Q I
Sbjct  590  IDNTNSPLRDSAGGSLATPFAFGAGHVDPRKALSPGLVYDITTDDYIAFLCSLDYTIQHI  649

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEA  322
            Q IVK PN+TC+++ SNP  LNYPSFSV+F K   ++V+  RELTNVG+AG++Y V I  
Sbjct  650  QVIVKRPNVTCSRRFSNPGDLNYPSFSVIFEKKSRKVVKYRRELTNVGSAGSVYSVKITG  709

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  142
            P +++VTVKP KL+FK+VG +L+Y+V F SKKG   P NAAFG ++W+N Q++VRSP+A+
Sbjct  710  PENISVTVKPAKLIFKHVGQKLKYSVIFASKKG-GNPKNAAFGWITWSNKQHKVRSPVAY  768

Query  141  SW  136
            +W
Sbjct  769  TW  770



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 120/182 (66%), Gaps = 10/182 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP----------TRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + T  P R   G A STP           R    GLVYD + TDY  FLCSLDYT + IQ
Sbjct  580  DNTKSPLRDAAGGAFSTPWAHGAGHVNPHRALSPGLVYDASITDYIKFLCSLDYTPEHIQ  639

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
             IVK   + C +K S+P QLNYPSFS+ FG  R+VR TR LTNVG AG++Y+V ++AP +
Sbjct  640  LIVKRHAVNCTRKFSDPGQLNYPSFSIHFGGKRVVRYTRTLTNVGEAGSVYDVTVDAPST  699

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            V VTV+P +LVF  +G+R RYTVTFVSKK         FGS+ W+NAQ+QVRSP+AFSWT
Sbjct  700  VEVTVRPARLVFGKLGERKRYTVTFVSKKSGGDSGRYGFGSIMWSNAQHQVRSPVAFSWT  759

Query  132  QL  127
             L
Sbjct  760  LL  761



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 120/182 (66%), Gaps = 10/182 (5%)
 Frame = -3

Query  642  EETNFPTRGLTGRAMSTP----------TRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQ  493
            + T  P R   G A STP           R    GLVYD + TDY  FLCSLDYT + IQ
Sbjct  579  DNTKSPLRDAAGGAFSTPWAHGAGHVNPHRALSPGLVYDASITDYIKFLCSLDYTPEHIQ  638

Query  492  AIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPS  313
             IVK   + C +K S+P QLNYPSFS+ FG  R+VR TR LTNVG AG++Y+V ++AP +
Sbjct  639  LIVKRHAVNCTRKFSDPGQLNYPSFSIHFGGKRVVRYTRTLTNVGEAGSVYDVTVDAPST  698

Query  312  VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            V VTV+P +LVF  +G+R RYTVTFVSKK         FGS+ W+NAQ+QVRSP+AFSWT
Sbjct  699  VEVTVRPARLVFGKLGERKRYTVTFVSKKSGGDSGRYGFGSIMWSNAQHQVRSPVAFSWT  758

Query  132  QL  127
             L
Sbjct  759  LL  760



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI   D+  FLCSL+YT  QIQ+IV+  N TCAKK ++  Q+N
Sbjct  602  GSGHVNPQKAFSPGLVYDIRIQDHIKFLCSLNYTIDQIQSIVRRLNFTCAKKFADVGQIN  661

Query  429  YPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            YPSFSVLF     R+VR TRE+TNVGAA ++YEVAI+APPSVTVTVKPTKLVFK VG++L
Sbjct  662  YPSFSVLFEINSKRVVRYTREVTNVGAASSVYEVAIDAPPSVTVTVKPTKLVFKKVGEKL  721

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             YTVTFVS K  V P N AFG +SW NA+++VRSP+A+SW
Sbjct  722  HYTVTFVSMKD-VKPGN-AFGWISWKNAKHEVRSPVAYSW  759



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 124/188 (66%), Gaps = 16/188 (9%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++  N P R     ++STP         P      GLVYD  P DY  FLCSLDYT   
Sbjct  580  TVDNANSPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPDDYVSFLCSLDYTDDA  639

Query  498  IQAIVKAPNITCA--KKLSNPAQLNYPSFSVLFG----KSRIVRQTRELTNVGAAGTLYE  337
            +Q I + PN TC+  ++  +P QLNYPSFSV+FG     SR+VR TRELTNVG AG+ Y 
Sbjct  640  VQLIARRPNATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRYTRELTNVGPAGSAYV  699

Query  336  VAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVR  157
              +E PP+V  TVKP+KLVF NVG++LRYTVTFVSKK V     + FGS++W NAQ+QVR
Sbjct  700  AELEVPPTVGATVKPSKLVFGNVGEKLRYTVTFVSKKDVDYSLTSGFGSITWKNAQHQVR  759

Query  156  SPIAFSWT  133
            SP++FSWT
Sbjct  760  SPVSFSWT  767


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    LS PWAHG+GHVDPHKALSPG
Sbjct  589  RDAADYSLSTPWAHGAGHVDPHKALSPG  616



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 124/183 (68%), Gaps = 10/183 (5%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTPT-----RPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P       ++S P         P+     GLVYDI+  +Y  FLCSL+YT   I
Sbjct  575  LDNTNSPLHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHI  634

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
             AIVK  ++ C KK S+P QLNYPSFSVLFG  R+VR TRE+TNVGAA ++Y+V +   P
Sbjct  635  VAIVKRSSVNCTKKFSDPGQLNYPSFSVLFGGKRVVRYTREVTNVGAANSVYKVMVNGAP  694

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +V ++VKP+KL FK VG++ RYTVTFVSKKGV   + A FGS++W N Q++VRSP+AFSW
Sbjct  695  TVEISVKPSKLTFKRVGEKKRYTVTFVSKKGVSMTNKAEFGSITWINPQHEVRSPVAFSW  754

Query  135  TQL  127
             + 
Sbjct  755  NRF  757



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 121/162 (75%), Gaps = 4/162 (2%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQ  436
            + G     P +    GLVY+I   D+  FLCSL+YT  QIQ+IVK  N TCA K ++  Q
Sbjct  600  VHGSGHVNPQKAFSPGLVYNIRIHDHIKFLCSLNYTIDQIQSIVKRLNFTCANKFADAGQ  659

Query  435  LNYPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            +NYPSFSVLF     R+VR TRE+TNVGAA ++YEVA +APPSVTVTVKPTKLVFK VG+
Sbjct  660  INYPSFSVLFEINSKRVVRYTREVTNVGAASSVYEVATDAPPSVTVTVKPTKLVFKKVGE  719

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L YTVTFVSKK  V P N AFG +SWNNA+++VRSP+A+SW
Sbjct  720  KLHYTVTFVSKKD-VKPGN-AFGWISWNNAKHEVRSPVAYSW  759



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P++    GLVYDIA  DY  FLCSL+YT + +QAIVK PN+TCA+K S+P QLN
Sbjct  600  GSGHIDPSKALSPGLVYDIATEDYIAFLCSLEYTKEHVQAIVKRPNVTCARKYSDPGQLN  659

Query  429  YPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            YPSFSV+F   K R+V  TRELTNVG AG++Y VA+ +P  V   VKPT+LVF NVG++ 
Sbjct  660  YPSFSVVFWNKKKRVVSYTRELTNVGPAGSVYRVAVTSPSMVRTIVKPTRLVFNNVGEKQ  719

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            +Y VTFV+ +G    S + FGS+ W+N Q+QV+SP+AF+WTQL 
Sbjct  720  KYRVTFVASRGAEKTSRSEFGSIMWSNPQHQVKSPVAFAWTQLI  763



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GL+YDI+  DY  FLCSLDY    +QAIVK  NITC++K ++P QLN
Sbjct  605  GAGHVDPHKALSPGLLYDISTNDYIAFLCSLDYGIDHVQAIVKRSNITCSRKFADPGQLN  664

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSV+FG  R+VR TR +TNVGAAG++Y+VA  AP  V VTVKP+KLVF  VG+R RY
Sbjct  665  YPSFSVVFGSKRVVRYTRIVTNVGAAGSVYDVATTAPSVVKVTVKPSKLVFTKVGERKRY  724

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFV+ +     +   FGS+ W+N Q+QVRSP++F+WT+L
Sbjct  725  TVTFVASRDAAQTTRFGFGSIVWSNDQHQVRSPVSFAWTRL  765


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G   SNPWAHG+GHVDPHKALSPG
Sbjct  591  RDAAGGGFSNPWAHGAGHVDPHKALSPG  618



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 120/162 (74%), Gaps = 3/162 (2%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQ  436
            + G     P +    GLVYDIA  DYT FLCSLDY+T  I AI ++PN TC+++LS+P  
Sbjct  604  IYGSGYVDPQKALSPGLVYDIAAEDYTAFLCSLDYSTNHILAISQSPNTTCSRRLSDPGN  663

Query  435  LNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYPSFSV+FG+   RIVR +RELTNVG +G++Y +    PPSV+VTV+PTKLVFK VG+
Sbjct  664  LNYPSFSVIFGRKSRRIVRYSRELTNVGLSGSVYNLTYSGPPSVSVTVRPTKLVFKQVGE  723

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L+YTVTF SKK    P++ AFG +SW N Q+QVRSPI++ W
Sbjct  724  KLKYTVTFTSKK-QGNPTDMAFGWISWKNEQHQVRSPISYMW  764



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 123/187 (66%), Gaps = 12/187 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLT----------GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQ  499
            T + TN P R             G     P++    GLVYD    DY  FLCSL+YT + 
Sbjct  577  THDNTNSPLRDAADGTLSNPWAHGSGHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEH  636

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIE  325
            +QAIVK PN+TCA+K S+P QLNYPSFS++FG    R+VR TRELTNVGAAG++Y  ++ 
Sbjct  637  VQAIVKRPNVTCARKYSDPGQLNYPSFSIVFGSKNKRVVRYTRELTNVGAAGSVYRASVT  696

Query  324  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            +P +V   VKPT+LVF NVG++ +YTVTFV+  G    + + FGS+ W N Q+QV+SP+ 
Sbjct  697  SPSTVRTIVKPTRLVFNNVGEKQKYTVTFVALPGAXKTARSEFGSIVWANPQHQVKSPVT  756

Query  144  FSWTQLF  124
            F+WTQL 
Sbjct  757  FAWTQLI  763


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    LSNPWAHGSGHVDP KALSPG
Sbjct  586  RDAADGTLSNPWAHGSGHVDPSKALSPG  613



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 121/184 (66%), Gaps = 10/184 (5%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T +  N P R     ++STP         P      GLVYD  P DY  FLCSL YT + 
Sbjct  582  THDNANSPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPEDYVSFLCSLGYTKEM  641

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAP  319
            +Q + K PNITC+K+  +P QLNYPSFSV+F K+ +VR +RELTNVG AG  Y V+++AP
Sbjct  642  VQIVAKHPNITCSKRFHDPGQLNYPSFSVMFRKTGVVRYSRELTNVGPAGLTYRVSVDAP  701

Query  318  PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFS  139
            P+V V+V P+ LVFKNVGD+ R+ VTFV KK V       FGS+ W+NA ++V SP+A+S
Sbjct  702  PNVEVSVSPSTLVFKNVGDKRRFRVTFVWKKEVGPVVRHGFGSIVWSNALHRVSSPVAYS  761

Query  138  WTQL  127
            WTQL
Sbjct  762  WTQL  765


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    LS PWAHG+GHVDPHKALSPG
Sbjct  591  RDAADYSLSTPWAHGAGHVDPHKALSPG  618



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 125/186 (67%), Gaps = 15/186 (8%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP----------TRPSPRGLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN P R  +  ++STP           R    GLVYD +P DY  FLCSLDY+ + 
Sbjct  553  TVDNTNAPLRDASDYSISTPFAHGAGHVDPHRALSPGLVYDASPADYVAFLCSLDYSDEM  612

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAG--TLYEVAIE  325
            +Q IV   N TC++K ++P QLNYPSFSV+FGKSR+VR TRELTNV   G   +Y  ++E
Sbjct  613  LQMIVS--NATCSRKFADPGQLNYPSFSVVFGKSRVVRYTRELTNVDPRGGSVIYRASVE  670

Query  324  APPS-VTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  148
            APP  V  TVKP+ L F+N GD+ RYTVTFVS++  V P   AFGSV W N+++QV+SP+
Sbjct  671  APPELVAATVKPSILEFRNAGDKRRYTVTFVSRRQNVKPMKNAFGSVVWKNSEHQVKSPV  730

Query  147  AFSWTQ  130
            AFSW +
Sbjct  731  AFSWER  736



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  +Y  FLCSL YT   ++ IVK PN+TC+ K  +P +LN
Sbjct  599  GAGHVDPQKALSPGLVYDISTEEYISFLCSLGYTIDHVKTIVKRPNVTCSTKFKDPGELN  658

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  R+VR TRELTNVG + ++Y+V +  P +V ++V+PT L+F++ G++ RY
Sbjct  659  YPSFSVLFGDKRVVRYTRELTNVGPSRSIYKVTVNGPSTVGISVRPTTLIFRSAGEKKRY  718

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFV+K+G    + + FGS+ W+NAQNQV+SP++FSWT L
Sbjct  719  TVTFVAKRGTSPMARSEFGSIVWSNAQNQVKSPVSFSWTLL  759


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    LSNPWAHG+GHVDP KALSPG
Sbjct  585  RDAADGSLSNPWAHGAGHVDPQKALSPG  612



>ref|XP_010917484.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=767

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 115/160 (72%), Gaps = 3/160 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDIA  DY  FLCSLDY+   IQAI ++PN TC++KLS+P  LN
Sbjct  606  GSGYVNPQKALSPGLVYDIATEDYIGFLCSLDYSADHIQAISQSPNTTCSRKLSDPGNLN  665

Query  429  YPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            YPSFSV+FG    R VR +RELTNVG AG++Y +    PPSV+VTV+P KLVFK VG++L
Sbjct  666  YPSFSVVFGGKSRRPVRYSRELTNVGLAGSVYNLTYSGPPSVSVTVRPKKLVFKQVGEKL  725

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +YTV F SKK    P++ AFG +SWNN Q+QV+SPI++ W
Sbjct  726  KYTVIFTSKK-EGNPTDVAFGWISWNNEQHQVQSPISYMW  764



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  639  ETNFPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  460
            + +   R   G     P +    GL+YDI+  +Y  FLCSL YT   ++ IVK PN+TC+
Sbjct  590  DGSLSNRWAHGAGHVDPQKALSPGLIYDISTDEYITFLCSLGYTVDHVKTIVKRPNVTCS  649

Query  459  KKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLV  280
            KK  +P +LNYPSFSV+FG  R+VR TRELTNVG A ++Y+V +  P +V ++V+P  L+
Sbjct  650  KKFKDPGELNYPSFSVMFGGKRVVRYTRELTNVGPARSMYKVTVNGPSTVGISVRPKTLI  709

Query  279  FKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            F+ VG++ RYTVTFV+K+G    +   FGS+ W NAQNQV+SP++FSW+ +
Sbjct  710  FRTVGEKKRYTVTFVAKRGTSPMAKPEFGSIVWGNAQNQVKSPVSFSWSLM  760



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 120/185 (65%), Gaps = 12/185 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T + T  P R   G  +STP         P      GLVYD  P DY  FLCSLDY+  Q
Sbjct  576  TSDNTKSPLRDAAGGDISTPWAHGSGHVDPHKALNPGLVYDATPDDYITFLCSLDYSIDQ  635

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEA  322
            ++AI K  NITC+++ ++P +LNYPSFSVLFG K R+VR TRELTNVG  G++Y VAI  
Sbjct  636  VKAITKRQNITCSRRFADPGELNYPSFSVLFGTKKRVVRYTRELTNVGPTGSVYNVAIGG  695

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV-TPSNAAFGSVSWNNAQNQVRSPIA  145
            P SV VTVKPTKLVFK VG+  +YTVTFV+KKG+      A FG + W N Q QVRSP++
Sbjct  696  PSSVGVTVKPTKLVFKEVGEMKKYTVTFVAKKGLSRMLGTAEFGWIVWRNEQYQVRSPVS  755

Query  144  FSWTQ  130
            + W  
Sbjct  756  YEWLH  760


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 2/75 (3%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPGPGLRHCPN*LYHVLVLPRLYYSANPGHCQGTK  473
            RDA G ++S PWAHGSGHVDPHKAL+PG      P+   ++  L  L YS +       +
Sbjct  585  RDAAGGDISTPWAHGSGHVDPHKALNPGLVYDATPD--DYITFLCSLDYSIDQVKAITKR  642

Query  472  HHLCQETIQSRPAQL  428
             ++      + P +L
Sbjct  643  QNITCSRRFADPGEL  657



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P++    GLVYD    DY  FLCSL+YT + +QAIVK PN+TC +K S+P QLN
Sbjct  600  GSGHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEHVQAIVKRPNVTCERKYSDPGQLN  659

Query  429  YPSFSVLFG--KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            YPSFS+ FG    R+VR TRELTNVGAAG++Y  ++ +P +V   VKPT+LVF NVG++ 
Sbjct  660  YPSFSIAFGSKNKRVVRYTRELTNVGAAGSVYRASVTSPSTVRTVVKPTRLVFNNVGEKQ  719

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            +YTVTF++  G    + + FGS+ W N Q+ V+SP+AF+WTQL 
Sbjct  720  KYTVTFMALPGAEKTARSEFGSIVWANPQHLVKSPVAFAWTQLI  763



>ref|XP_010937330.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=772

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 125/182 (69%), Gaps = 13/182 (7%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            +++TN P R   G +++TP         PR     GL+YDI   DY  FLCSLDYT Q I
Sbjct  590  IDDTNSPLRDSAGGSVATPFAFGAGHVDPRKALSPGLIYDITTEDYIAFLCSLDYTIQHI  649

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEA  322
            Q IVK PN+TC++  SNP +LNYPSFSV+F K    +V+  RELTNVG+AG++Y V I  
Sbjct  650  QVIVKRPNVTCSRSFSNPGELNYPSFSVVFKKKSRNVVKYIRELTNVGSAGSVYNVRIRG  709

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  142
            P +V+VTVKP KL+FK+VG +L+Y++ F SK G    +  AFG ++W+N Q++VRSP+A+
Sbjct  710  PENVSVTVKPAKLIFKHVGQKLKYSIIFASKNGGHLKTT-AFGWITWSNKQHEVRSPVAY  768

Query  141  SW  136
            +W
Sbjct  769  TW  770



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 114/161 (71%), Gaps = 0/161 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  +Y  FLCSL YT   ++ IVK PNITC+ K  +P +LN
Sbjct  600  GAGHVDPQKALSPGLVYDISTEEYITFLCSLGYTVDHVKTIVKRPNITCSTKFKDPGELN  659

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSVLFG  R+VR TRELTNVG A ++Y+V +  P +V ++V+P  L+F++VG++ RY
Sbjct  660  YPSFSVLFGGKRVVRYTRELTNVGPARSIYKVTVNGPSTVGISVRPKTLIFRSVGEKKRY  719

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFV+K+G    +   FGS+ W NAQNQV+SP++FSW+ +
Sbjct  720  TVTFVAKRGTSPMAKPEFGSIVWGNAQNQVKSPVSFSWSLM  760


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    LSNPWAHG+GHVDP KALSPG
Sbjct  586  RDAADGSLSNPWAHGAGHVDPQKALSPG  613



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 125/187 (67%), Gaps = 14/187 (7%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T + T  P R   G A+S P         P+     GLVYD  P DY  FLCSLDY+  Q
Sbjct  586  TRDNTKSPLRDAAGGAISNPWAHGSGHVDPQKALSPGLVYDATPEDYIAFLCSLDYSIAQ  645

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEA  322
            IQ I K PNITC+++ ++P  LNYPSFSVLF  ++R+VR TRELTNVG AG++Y+V++  
Sbjct  646  IQMITKRPNITCSRRFADPGHLNYPSFSVLFSAETRMVRYTRELTNVGPAGSVYDVSVSG  705

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKK---GVVTPSNAAFGSVSWNNAQNQVRSP  151
            P SV +TVKP +LVF+ VG++ +Y+V FV++K   G       AFG +SW+NAQ+QVRSP
Sbjct  706  PASVGITVKPRRLVFREVGEKQKYSVMFVARKEGTGGRRVGTTAFGWLSWSNAQHQVRSP  765

Query  150  IAFSWTQ  130
            I++ W+ 
Sbjct  766  ISYEWSH  772


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G  +SNPWAHGSGHVDP KALSPG
Sbjct  595  RDAAGGAISNPWAHGSGHVDPQKALSPG  622



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 130/183 (71%), Gaps = 11/183 (6%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P R     ++S P         P+     GLVYDI+  +Y  FLCSLDYT   I
Sbjct  584  LDNTNSPLRDAADNSLSNPWAHGSGHVDPKKALSPGLVYDISTEEYIRFLCSLDYTLNHI  643

Query  495  QAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPP  316
            QAI+K PN+ C++K S+P QLNYPSFSVLF   R+VR TRELTNVGA G++Y+V ++   
Sbjct  644  QAIIKRPNVNCSRKFSDPGQLNYPSFSVLFRDKRVVRYTRELTNVGAPGSVYKVTVDVSV  703

Query  315  SVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            SV+VTV+P +LVF+  G++ RYTVTF +K+G V+ + A FGS++W+N+Q+QVRSP+AFSW
Sbjct  704  SVSVTVRPKRLVFRTAGEKKRYTVTFSAKRG-VSGATAEFGSITWSNSQHQVRSPVAFSW  762

Query  135  TQL  127
            T+ 
Sbjct  763  TRF  765


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA  + LSNPWAHGSGHVDP KALSPG
Sbjct  592  RDAADNSLSNPWAHGSGHVDPKKALSPG  619



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 111/161 (69%), Gaps = 1/161 (1%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P+R    GLVYDI+  +Y  FLCSL YT QQ+Q+I K+ N+TCA+K S+P QLN
Sbjct  606  GSGHVDPSRAVSPGLVYDISSVEYVAFLCSLGYTIQQVQSIAKS-NVTCARKYSDPGQLN  664

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFSV+FG  R+VR TRELTNVG A +LY+V +  PP V   VKP+ L F  VG++ +Y
Sbjct  665  YPSFSVVFGNKRVVRYTRELTNVGTARSLYKVIVSGPPGVRTIVKPSSLFFATVGEKKKY  724

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            TVTFVS K     S A FGS+ W N  + V+SP+AF+WT L
Sbjct  725  TVTFVSAKSGSRTSRAEFGSIVWANTLHLVKSPVAFAWTLL  765


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 3/74 (4%)
 Frame = -2

Query  649  DAGGDELSNPWAHGSGHVDPHKALSPGPGLRHCPN*LYHVLVLPRLYYSANPGHCQGTKH  470
            DA G + SNPWAHGSGHVDP +A+S  PGL +  + + +V  L  L Y+          +
Sbjct  593  DAAGGQFSNPWAHGSGHVDPSRAVS--PGLVYDISSVEYVAFLCSLGYTIQQVQSIAKSN  650

Query  469  HLCQETIQSRPAQL  428
              C     S P QL
Sbjct  651  VTCARK-YSDPGQL  663



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 1/164 (1%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQ  436
            + G     P +    GL+YDI    Y  FLCSL YT  Q++ IVK PNITC+K+  +P +
Sbjct  599  VHGAGHVDPQKALSPGLIYDITTKQYISFLCSLGYTIDQVKTIVKRPNITCSKRFKDPGE  658

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSFSVLFG  R+VR TRELTNVG A ++Y+VA++ P SV ++V+P  LVF+++G++ 
Sbjct  659  LNYPSFSVLFGDKRVVRYTRELTNVGPARSIYKVAVDGPSSVGISVRPRTLVFRHIGEKK  718

Query  255  RYTVTFVSK-KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            RYTV+FV+K K   +   + +GS+ W NAQ+QV+SP++FSWT L
Sbjct  719  RYTVSFVAKRKRRGSTVRSEYGSIVWGNAQHQVKSPVSFSWTFL  762



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 121/183 (66%), Gaps = 11/183 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGR-AMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQ  502
            T + T  P R  TG  ++STP        +P+     GL+YD +  DY  FLCSL+YT  
Sbjct  567  TYDNTESPLRDATGEESLSTPWAYGAGHVNPQKALSPGLLYDASTQDYIYFLCSLNYTLD  626

Query  501  QIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEA  322
             ++ +VK P+  C+KK ++P  LNYPSFSV+FG +++VR TR LTNVG  G+ Y+VA+ A
Sbjct  627  HLRLLVKHPDANCSKKFADPGDLNYPSFSVVFGSNKVVRYTRTLTNVGEPGSAYDVAVSA  686

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  142
            P +V +TV P KL F  VG+R  YTVTFVS + V   + + FGS+ W+N Q+QVRSP+AF
Sbjct  687  PSTVDITVNPNKLEFGEVGERQTYTVTFVSNRSVNDSATSGFGSIMWSNEQHQVRSPVAF  746

Query  141  SWT  133
            +WT
Sbjct  747  TWT  749



>gb|KHN07895.1| Subtilisin-like protease [Glycine soja]
Length=519

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 119/183 (65%), Gaps = 11/183 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGR-AMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQ  502
            T + T  P R  TG  ++STP        +P+     GL+YD +  DY  FLCSL+YT  
Sbjct  335  TYDNTESPLRDATGEESLSTPWAYGAGHVNPQKALSPGLLYDASTQDYIYFLCSLNYTLD  394

Query  501  QIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEA  322
             ++ +VK P+  C+KK ++P  LNYPSFSV+FG +++VR TR LTNVG  G+ Y VA+ A
Sbjct  395  HLRLLVKHPDANCSKKFADPGDLNYPSFSVVFGSNKVVRYTRTLTNVGEPGSAYNVAVSA  454

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  142
            P +V +TV P KL F  VG+R  YTVTFVS + V   + + FGS+ W+N Q+ VRSP+AF
Sbjct  455  PSTVDITVNPNKLEFGEVGERQTYTVTFVSNRSVNDSATSGFGSIMWSNEQHLVRSPVAF  514

Query  141  SWT  133
            +WT
Sbjct  515  TWT  517



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 12/186 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            TL+ T  P R   G A+STP        +P+     GLVYD    DY  FLCSL+Y+   
Sbjct  571  TLDNTESPLRDAMGEALSTPWAYGSGHVNPQKALSPGLVYDADIEDYIAFLCSLNYSLDH  630

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEA  322
            ++ IVK PN+ C+  LS P  LNYPSFSV+FG  S +V+  R LTNVG A ++Y+VA+  
Sbjct  631  VKLIVKRPNVNCSTYLSGPGDLNYPSFSVVFGNNSGVVQYKRTLTNVGEAESVYDVAVSG  690

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIA  145
            P +V + V PTKLVF+ VG+R  Y V F+S K +V  S  + FGS++W+N Q+QVRSPIA
Sbjct  691  PSTVGIIVNPTKLVFEQVGERQTYMVKFISNKDIVDDSVTSEFGSITWSNKQHQVRSPIA  750

Query  144  FSWTQL  127
            F+WT L
Sbjct  751  FTWTIL  756



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 12/186 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            TL+ T  P R   G A+STP        +P+     GLVYD    DY  FLCSL+Y+   
Sbjct  571  TLDNTESPLRDAMGEALSTPWAYGSGHVNPQKALSPGLVYDADIEDYIAFLCSLNYSLDH  630

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEA  322
            ++ IVK PN+ C+  LS P  LNYPSFSV+FG  S +V+  R LTNVG A ++Y+VA+  
Sbjct  631  VKLIVKRPNVNCSTYLSGPGDLNYPSFSVVFGNNSGVVQYKRTLTNVGEAESVYDVAVSG  690

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIA  145
            P +V + V PTKLVF+ VG+R  Y V F+S K +V  S  + FGS++W+N Q+QVRSPIA
Sbjct  691  PSTVGIIVNPTKLVFEQVGERQTYMVKFISNKDIVDDSVTSEFGSITWSNKQHQVRSPIA  750

Query  144  FSWTQL  127
            F+WT L
Sbjct  751  FTWTIL  756



>ref|XP_004507999.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=753

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 121/186 (65%), Gaps = 12/186 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T + T  P R  TG A+S P        SP+     GL+YD    DY  FLCSL+YT   
Sbjct  568  TRDNTESPLRDATGEALSIPWAYGSGHVSPQKALSPGLLYDTDTQDYIAFLCSLNYTLDH  627

Query  498  IQAIVKAPNITCAKK-LSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEA  322
            +Q IVK  ++ C+K   ++P  LNYPSFSV+FG + +V+ TR LTNVG A ++Y+V +  
Sbjct  628  VQLIVKRHDVNCSKYYFADPGDLNYPSFSVVFGNNSVVQYTRRLTNVGEAKSVYDVVVSG  687

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIA  145
            P +V +TVKPT+LVF+ VG+R  YTVTF+S K  V  S    FGS++W+N ++QVRSP+A
Sbjct  688  PSTVGITVKPTRLVFEQVGERQTYTVTFISNKDTVDDSVTYEFGSITWSNKRHQVRSPVA  747

Query  144  FSWTQL  127
            F+WT L
Sbjct  748  FTWTNL  753



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 120/182 (66%), Gaps = 13/182 (7%)
 Frame = -3

Query  645  LEETNFPTRGLTGRAMSTP----------TRPSPRGLVYDIAPTDYTMFLCSLDYTTQQI  496
            L+ TN P R   G + +TP           R    GLVYDI   DY  FLCSL+YT   I
Sbjct  585  LDNTNSPLRDAAGGSYATPFAYGAGHVDPQRALSPGLVYDITADDYIAFLCSLNYTIPHI  644

Query  495  QAIVKAPNIT-CAKKLSNPAQLNYPSFSVLFGKS-RIVRQTRELTNVGAAGTLYEVAIEA  322
            QAI K PN+T C+++ S+P  LNYPSFSV+FGK  R+V+  RELTNVG+A + YE  +  
Sbjct  645  QAITKRPNVTTCSRRFSDPGNLNYPSFSVVFGKKWRVVKYRRELTNVGSASSTYEAKVSG  704

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  142
            P  V VTVKP KL+FK+V  +L+Y+VTF SK+   + +  AFG ++W+N Q++VRSP+A+
Sbjct  705  PGGVAVTVKPAKLMFKHVNQKLKYSVTFASKERGRS-AGTAFGWITWSNKQHKVRSPVAY  763

Query  141  SW  136
            +W
Sbjct  764  TW  765



>ref|XP_002519362.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42979.1| conserved hypothetical protein [Ricinus communis]
Length=208

 Score =   162 bits (411),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 105/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P R    GLVYDI+P DY  FLCSL+Y            N+TC +K S+  +LN
Sbjct  58   GSGHVDPKRALSPGLVYDISPQDYVTFLCSLNYDL----------NLTCPRKFSDLGELN  107

Query  429  YPSFSVLFGK-SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            YPSFSVLFGK +  VR +RELTNVG A   Y VA+ AP  V VTV P KLVFK VG++LR
Sbjct  108  YPSFSVLFGKKTTAVRYSRELTNVGTARATYRVAVTAPSEVAVTVAPAKLVFKKVGEKLR  167

Query  252  YTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSWT  133
            YT TF +K+    P+  AAFGS+ W+NA+ +V SP+AF+WT
Sbjct  168  YTATFAAKRNAKKPAGGAAFGSIVWSNAKYKVSSPVAFAWT  208



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 107/160 (67%), Gaps = 3/160 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GL+YDI   DY  FLCSL+Y+T  IQAI K+ N TC+++L NP  LN
Sbjct  609  GSGHVDPQKALSPGLIYDIGTGDYLAFLCSLEYSTDHIQAISKSTNKTCSRRLPNPGNLN  668

Query  429  YPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            YPSFSV+FG+   R V+  R LTNVG  G++Y V +  PP V VTVKPTKL+F  VG +L
Sbjct  669  YPSFSVVFGRRSRRFVKYNRVLTNVGVPGSVYNVKVGGPPGVKVTVKPTKLIFNQVGQKL  728

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            RY VTF S K    P + AFG ++W++ Q+QVRSP+++ W
Sbjct  729  RYKVTFTSTK-AGDPVDMAFGWITWSSEQHQVRSPVSYRW  767



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 118/176 (67%), Gaps = 17/176 (10%)
 Frame = -3

Query  615  LTGRAMSTPTRP--------SPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  475
            +T  A  TPT P         PR     GLVYD+   DY  F+CSL+YT +Q+Q+ V+  
Sbjct  583  ITDAADGTPTSPWDLGAGHIDPRKALSPGLVYDLTADDYIAFVCSLNYTIKQVQSTVRRT  642

Query  474  NITCAKKLSNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTV  298
            N+TC+ KLS+P QLNYPSFSVLF  +R +VR +RELTNVG AG++Y+VA++AP +V V V
Sbjct  643  NVTCSTKLSDPGQLNYPSFSVLFRPNRKVVRYSRELTNVGDAGSVYKVAVQAPSTVAVRV  702

Query  297  KPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
            KP +LVF  VG++ RYTVTFV++           GS++W N Q++VRSP+ F W +
Sbjct  703  KPRRLVFGKVGEKQRYTVTFVARN---QTDETHGGSITWKNRQHRVRSPVGFLWGE  755



>emb|CAN71376.1| hypothetical protein VITISV_001491 [Vitis vinifera]
Length=734

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = -3

Query  540  YTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNV  361
            Y  FLCSLDYT + ++AIVK  NITC++K S+P +LNYPSFSVLFG    VR TRELTNV
Sbjct  594  YVAFLCSLDYTIEHVRAIVKRQNITCSRKFSDPGELNYPSFSVLFGSKXFVRYTRELTNV  653

Query  360  GAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTP---SNAAFGS  190
            GAA ++Y+VA+  PPSV V V P+ LVFKNVG++ RYTVTFV+KKG       + +AFGS
Sbjct  654  GAAXSVYQVAVTGPPSVGVVVXPSTLVFKNVGEKXRYTVTFVAKKGKKVQNRMTRSAFGS  713

Query  189  VSWNNAQNQVRSPIAFSWTQL  127
            + W+N Q+QV+SP+A++WTQL
Sbjct  714  IVWSNTQHQVKSPVAYAWTQL  734



>gb|KHN17728.1| Subtilisin-like protease [Glycine soja]
Length=224

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 107/159 (67%), Gaps = 0/159 (0%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVY+ +  DY  FLCSL+YT   ++ +VK P+  C+KK ++PA+LN
Sbjct  64   GAGHVNPQKALSPGLVYEASTQDYIAFLCSLNYTLDHLRLVVKDPDANCSKKFADPAELN  123

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFS++FG ++++R TR LTNVG  G++Y++ +  P +V VTV P +L F+ +G+   Y
Sbjct  124  YPSFSLVFGSNKLLRYTRTLTNVGEPGSVYDLVLSVPSTVHVTVNPRRLQFRQLGESQTY  183

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            TVTF+S + +     + FG++ W N  +QVR+P+AF+WT
Sbjct  184  TVTFLSNRTLNDSVTSDFGTIMWTNQLHQVRTPLAFTWT  222



>dbj|BAJ89916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 112/163 (69%), Gaps = 7/163 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTT-QQIQAIVKAPNITCAKKLSNPAQL  433
            G     P +    GLVYD +  DY  FLC++   + +Q+QA+  APN TC +KLS+P  L
Sbjct  610  GSGHVDPVKALSPGLVYDTSIDDYVAFLCTVGGASPRQVQAVTGAPNATCQRKLSSPGDL  669

Query  432  NYPSFSVLFG--KSRI-VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSFSV+FG  KSR  VR  RELTNVGAAG++Y   +  PPS+ V+VKP +LVFK  GD
Sbjct  670  NYPSFSVVFGLRKSRTTVRYHRELTNVGAAGSVYAAKVTGPPSIVVSVKPARLVFKKAGD  729

Query  261  RLRYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +LRYTV F S  +G   P++AAFG ++W++ +  VRSPI+++W
Sbjct  730  KLRYTVAFKSTAQG--GPTDAAFGWLTWSSGEQDVRSPISYTW  770



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 0/159 (0%)
 Frame = -3

Query  609   GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
             G     P +    GL+YDI+  +Y  FLCSL++  + ++ I + P +TC+K+  +  +LN
Sbjct  845   GSGHIDPRKAFSPGLIYDISKEEYIKFLCSLNFPLEIVREITENPFLTCSKRFDDLGELN  904

Query  429   YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
             YPSFSVLFG    V+ TR LTNVG A + YEV + APP++TVTVKP KLVFKNVG++  Y
Sbjct  905   YPSFSVLFGNKTTVQYTRTLTNVGTAKSTYEVKVTAPPALTVTVKPRKLVFKNVGEKHSY  964

Query  249   TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
              VTF + K        AFGS++W +AQ++V SP+AF+WT
Sbjct  965   RVTFAAIKNRKPVGGVAFGSITWIDAQHKVSSPVAFTWT  1003


 Score =   127 bits (320),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GL+YDI+  +YT FLCSLDY  + I+ I   P ++C+ +  +  +LNYPSFSVLFG   +
Sbjct  579  GLIYDISKKEYTKFLCSLDYPLEFIRTITLNPKVSCSSRFDDLGELNYPSFSVLFGNKTM  638

Query  390  VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            V+ +R+LTN GAA + YEV + APP+VTVTVKP  LVFKNVG++ +
Sbjct  639  VQYSRKLTNAGAANSAYEVIVAAPPAVTVTVKPRNLVFKNVGEKHK  684


 Score = 42.4 bits (98),  Expect(2) = 2e-33, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RD+     SNPWA+GSGH+D  KA SPG
Sbjct  552  RDSATGSSSNPWAYGSGHIDSRKAFSPG  579



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 115/183 (63%), Gaps = 11/183 (6%)
 Frame = -3

Query  648  TLEETNFPTRGLTGR-AMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQ  502
            T + T  P R  TG  A+STP        +P+     GLVYD +  DY  FLCSL+YT  
Sbjct  577  THDNTESPLRDATGEEALSTPWAYGAGHVNPQKALSPGLVYDASTQDYIAFLCSLNYTLD  636

Query  501  QIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEA  322
             ++ +VK  +  C+ K ++P  LNYPSFSV+FG +++V+ TR LTNVG A ++Y+V +  
Sbjct  637  HLRLVVKHSDANCSTKFADPGDLNYPSFSVVFGSNKVVQYTRTLTNVGKAASVYDVVVST  696

Query  321  PPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  142
            P +V +TV P ++ F  VG+   Y VTFVS + V     + FGS+ W+N +++VRSP+AF
Sbjct  697  PSTVEITVNPNRVSFAEVGECQTYKVTFVSNRSVSDSVASEFGSIMWSNEEHEVRSPVAF  756

Query  141  SWT  133
            +WT
Sbjct  757  TWT  759



>ref|XP_010238670.1| PREDICTED: subtilisin-like protease isoform X1 [Brachypodium 
distachyon]
Length=769

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 103/151 (68%), Gaps = 7/151 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--  397
            GLVYDI+  DY +FLCSLDY+   I+ + K  NI+C +K S P  LNYPSFSV+F     
Sbjct  622  GLVYDISTNDYVVFLCSLDYSVSHIRVVTKMSNISCPQK-SRPGDLNYPSFSVVFRNKPK  680

Query  396  RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV  217
             +VR  RELTNVG A ++Y V + +P SV+V V P KLVFK +G +LRY VTF SK  VV
Sbjct  681  HVVRYRRELTNVGPAMSVYNVKVSSPASVSVKVSPEKLVFKKLGQKLRYYVTFTSK--VV  738

Query  216  TPSNAA--FGSVSWNNAQNQVRSPIAFSWTQ  130
             P+ A   FG +SW N Q+ VRSP+AF+WT 
Sbjct  739  DPNRAKPDFGWISWVNNQHVVRSPVAFTWTM  769



>ref|NP_001064523.2| Os10g0394200 [Oryza sativa Japonica Group]
 dbj|BAF26437.2| Os10g0394200, partial [Oryza sativa Japonica Group]
Length=230

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 110/185 (59%), Gaps = 18/185 (10%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN   R   G  ++TP         P+     GL+YDI+  DY  FLCSL+YTT  
Sbjct  48   TVDNTNSSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPH  107

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIE  325
            IQ I K  NITC +K   P  LNYPSFSV+F K    ++R  RE+TNVG A ++Y V + 
Sbjct  108  IQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVS  166

Query  324  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSP  151
             P SV+V V P KLVF  VG + RY V F S    V  SNA   FG +SW ++Q+ VRSP
Sbjct  167  GPASVSVKVTPAKLVFNKVGQKQRYYVIFAS---TVDASNAKPDFGWISWMSSQHVVRSP  223

Query  150  IAFSW  136
            IA++W
Sbjct  224  IAYTW  228



>ref|XP_004983113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=766

 Score =   150 bits (378),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--  397
            GLVYDI+  DY  FLCSLDY+   IQ I K  N +C KK   P  LNYPSFSV+F +   
Sbjct  620  GLVYDISTNDYVAFLCSLDYSAPHIQVITKMSNFSCPKKF-RPGDLNYPSFSVVFKQKSK  678

Query  396  RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV  217
            R++R  RE+TNVG A ++Y V + +P SV+VTV PTKL FK VG + RY VTF SK G  
Sbjct  679  RVMRFRREVTNVGPATSVYNVKVTSPASVSVTVTPTKLTFKKVGQKQRYYVTFASKAG-Q  737

Query  216  TPSNAAFGSVSWNNAQNQVRSPIAFSW  136
              +   FG +SW N  + VRSP+A++W
Sbjct  738  GQAKPDFGWISWANDDHVVRSPVAYTW  764


 Score = 40.4 bits (93),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    L+N +A+G+GHVDP KALSPG
Sbjct  593  RDAADGSLANVFAYGAGHVDPQKALSPG  620



>gb|EMT16255.1| Subtilisin-like protease [Aegilops tauschii]
Length=761

 Score =   151 bits (382),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 96/151 (64%), Gaps = 3/151 (2%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--  397
            GLVYDI+  DY  FLCSLDY+   I+ I K  N++C  + S P  LNYPSFSV+F K   
Sbjct  541  GLVYDISTNDYVAFLCSLDYSATHIRVITKMSNVSCPPR-SRPGDLNYPSFSVVFRKKPR  599

Query  396  RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV  217
             +VR  RELTNVG A  +Y+V +  P SV VTV P KLVFK VG + RY VTF SK    
Sbjct  600  HVVRYRRELTNVGPAMAVYDVKVSGPASVGVTVTPAKLVFKKVGQKQRYYVTFESKAAGA  659

Query  216  TPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
              +   FG +SW + ++ VRSP+A++W   F
Sbjct  660  GRAKPDFGWISWASDEHVVRSPVAYTWKMCF  690


 Score = 38.9 bits (89),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA G   + P+  G+GHVDP KALSPG
Sbjct  514  RDAAGSSPATPFGFGAGHVDPQKALSPG  541


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 11/93 (12%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN   R   G + +TP         P+     GLVYDI+  DY  FLCSLDY+   
Sbjct  400  TMDNTNSSLRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTNDYVAFLCSLDYSATH  459

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGK  400
            I+ I K  N++C  + S P  LNYPSFSV+F K
Sbjct  460  IRVITKMSNVSCPPR-SRPGDLNYPSFSVVFRK  491



>dbj|BAD36156.1| putative serine protease [Oryza sativa Japonica Group]
 gb|EAZ09256.1| hypothetical protein OsI_31529 [Oryza sativa Indica Group]
 gb|EAZ44882.1| hypothetical protein OsJ_29522 [Oryza sativa Japonica Group]
Length=770

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 103/164 (63%), Gaps = 7/164 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYD +  DY  FLCS+  +  Q+QAI  APN+TC +KLS+P  LN
Sbjct  606  GAGHVDPVKALSPGLVYDTSVDDYVAFLCSVGTSPPQVQAITAAPNVTCQRKLSSPGDLN  665

Query  429  YPSFSVLFGKSRI------VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNV  268
            YPSFSV+FG+         V+  RELTNVG   ++Y   +  P  + V VKP +L FK  
Sbjct  666  YPSFSVVFGRRSSSSRSTTVKYRRELTNVGDGRSVYTARVTGPSDIAVAVKPARLAFKKA  725

Query  267  GDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            GD+LRYTVTF S      P++AAFG ++W+N ++ VRSPI+++W
Sbjct  726  GDKLRYTVTFKSTT-PGGPTDAAFGWLTWSNGEHDVRSPISYTW  768



>ref|XP_006661279.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=635

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 109/165 (66%), Gaps = 10/165 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYD +  DY  FLCS+  + QQ+QAI  APN+TC +KLS+P  LN
Sbjct  472  GAGHVDPVKALSPGLVYDASVDDYVAFLCSVGTSPQQVQAITAAPNVTCQRKLSSPGDLN  531

Query  429  YPSFSVLFGK--SR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            YPSFSV+FG+  SR  V+  RELTNVG   G++Y V +  P  + V VKP +L FK  GD
Sbjct  532  YPSFSVVFGRRSSRSSVKYRRELTNVGGDGGSVYTVRVTGPSDIAVAVKPARLAFKAAGD  591

Query  261  RLRYTVTFVSK--KGVVTPSNAAFGSVSWNN-AQNQVRSPIAFSW  136
            +LRYTVTF S   +G   P ++AFG ++W++  ++ VRSPI+++W
Sbjct  592  KLRYTVTFKSATPRG---PMDSAFGWLTWSDGGEHDVRSPISYTW  633



>ref|XP_002467295.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
 gb|EER94293.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
Length=767

 Score =   146 bits (369),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFG-KSR  394
            GLVYDI+  DY  FLCSL+Y+   IQ I K  N++C KK   P  LNYPSFSV+F  KS+
Sbjct  621  GLVYDISTNDYAAFLCSLNYSAPHIQVITKTSNVSCPKKF-RPGDLNYPSFSVVFNQKSK  679

Query  393  IV-RQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV  217
             V R  RELTNVG A ++Y V + +P SV VTV P KL FK  G +LRY VTF SK G  
Sbjct  680  PVQRFRRELTNVGPATSVYNVKVISPESVAVTVTPAKLTFKKAGQKLRYHVTFASKAG-Q  738

Query  216  TPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            + +   FG +SW N ++ VRSP+A++W
Sbjct  739  SHAKPDFGWISWVNDEHVVRSPVAYTW  765


 Score = 40.4 bits (93),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            RDA    L+N +A+G+GHVDP KALSPG
Sbjct  594  RDAADGSLANAFAYGAGHVDPQKALSPG  621



>gb|AGT17100.1| serine protease [Saccharum hybrid cultivar R570]
Length=750

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 8/154 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKKLSNPAQLNYPSFSVLFGK--  400
            GLVYD +  DY  FLC++    +QIQAI  A PN+TC +KLS+P  LNYPSFSV+FG+  
Sbjct  594  GLVYDNSVDDYVAFLCTVGVAPRQIQAITAAGPNVTCTRKLSSPGDLNYPSFSVVFGQRS  653

Query  399  SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--K  229
            SR  V+  RELTNVG AG  Y V +  P  ++V+VKP +L F+  GD+LRYTVTF S   
Sbjct  654  SRSTVKYRRELTNVGNAGDTYTVKVTGPSDISVSVKPARLQFRRAGDKLRYTVTFRSANA  713

Query  228  KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            +G + P  AAFG ++W++ ++ VRSPI+++W  +
Sbjct  714  RGRMDP--AAFGWLTWSSDEHDVRSPISYTWGDV  745



>gb|ACL52505.1| unknown [Zea mays]
Length=421

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 102/167 (61%), Gaps = 12/167 (7%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P R    GLVYDI+  DY  FLCSL+Y+   +Q I KA N++C A   S P  L
Sbjct  256  GAGHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKASNVSCGAPNKSRPGDL  315

Query  432  NYPSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKN  271
            NYPSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P SV VTV P +L F+ 
Sbjct  316  NYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPESVAVTVTPARLTFRQ  375

Query  270  VGDRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             G +LRY VTF S  ++G   P    FG +SW N ++ VRSP+A++W
Sbjct  376  AGQKLRYYVTFASRARQGHAKPD---FGWISWVNDEHVVRSPVAYTW  419



>ref|XP_004956934.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 108/164 (66%), Gaps = 8/164 (5%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKKLSNPAQL  433
            G     P R    GLVYD    DY  FLC++  + +Q+QA+  A PN+TC +KLS+P  L
Sbjct  610  GAGHVDPVRALSPGLVYDATVDDYVAFLCTVGVSPRQVQAVAAAGPNVTCTRKLSSPGDL  669

Query  432  NYPSFSVLFGK--SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSFSV+FG+  SR  V+  RELTNVG  G  Y V +  P  V V+VKP  L F+  GD
Sbjct  670  NYPSFSVVFGRRSSRSTVKYRRELTNVGDTGATYTVKVTGPSDVGVSVKPAMLQFRRPGD  729

Query  261  RLRYTVTFVSK--KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +LRYTVTF SK  KG + P  AAFG ++W++ +++VRSPI+++W
Sbjct  730  KLRYTVTFRSKSAKGPMDP--AAFGWLTWSSDEHEVRSPISYTW  771



>gb|ACF79126.1| unknown [Zea mays]
 tpg|DAA61657.1| TPA: putative subtilase family protein [Zea mays]
Length=766

 Score =   148 bits (374),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCAKKLSNPAQLNYPSFSVLFGK--  400
            GLVYD +  DY  FLC++    +QIQAI  + PN+TC +KLS+P  LNYPSFSV+F +  
Sbjct  616  GLVYDASVDDYVAFLCTVGVAPRQIQAITAEGPNVTCTRKLSSPGDLNYPSFSVVFDRRS  675

Query  399  SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--K  229
            SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP +L F+  GD+LRYTVTF S   
Sbjct  676  SRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANA  735

Query  228  KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +G + P  AAFG ++W++ ++ VRSPI+++W
Sbjct  736  RGPMDP--AAFGWLTWSSGEHDVRSPISYTW  764


 Score = 37.7 bits (86),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = -2

Query  649  DAGGDELSNPWAHGSGHVDPHKALSPG  569
            DA  +  + PWA G+GHVDP  ALSPG
Sbjct  590  DAATNTTATPWAFGAGHVDPVSALSPG  616



>tpg|DAA61658.1| TPA: putative subtilase family protein [Zea mays]
Length=548

 Score =   148 bits (373),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCAKKLSNPAQLNYPSFSVLFGK--  400
            GLVYD +  DY  FLC++    +QIQAI  + PN+TC +KLS+P  LNYPSFSV+F +  
Sbjct  398  GLVYDASVDDYVAFLCTVGVAPRQIQAITAEGPNVTCTRKLSSPGDLNYPSFSVVFDRRS  457

Query  399  SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--K  229
            SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP +L F+  GD+LRYTVTF S   
Sbjct  458  SRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANA  517

Query  228  KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +G + P  AAFG ++W++ ++ VRSPI+++W
Sbjct  518  RGPMDP--AAFGWLTWSSGEHDVRSPISYTW  546


 Score = 38.1 bits (87),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = -2

Query  649  DAGGDELSNPWAHGSGHVDPHKALSPG  569
            DA  +  + PWA G+GHVDP  ALSPG
Sbjct  372  DAATNTTATPWAFGAGHVDPVSALSPG  398



>ref|XP_002460273.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
 gb|EER96794.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
Length=774

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 106/151 (70%), Gaps = 8/151 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKKLSNPAQLNYPSFSVLFGK--  400
            GLVYD +  DY  FLC++    +QIQAI  A PN+TC +KLS+P  LNYPSFSV+FG+  
Sbjct  624  GLVYDASVDDYVAFLCAVGVAPRQIQAITAAGPNVTCTRKLSSPGDLNYPSFSVVFGRRS  683

Query  399  SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--K  229
            SR  V+  RELTNVG AG  Y V +  P  ++V+VKP +L F+  GD+LRYTVTF S   
Sbjct  684  SRSTVKYRRELTNVGNAGDTYTVKVTGPSDISVSVKPARLQFRRAGDKLRYTVTFRSANA  743

Query  228  KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +G + P  AAFG ++W++ ++ VRSPI+++W
Sbjct  744  RGPMDP--AAFGWLTWSSDEHVVRSPISYTW  772



>ref|NP_001130775.1| uncharacterized protein LOC100191879 precursor [Zea mays]
 gb|ACG30165.1| subtilisin-like protease precursor [Zea mays]
Length=766

 Score =   146 bits (369),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 104/151 (69%), Gaps = 8/151 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAI-VKAPNITCAKKLSNPAQLNYPSFSVLFGK--  400
            GLVYD +  DY  FLC++    +QIQ I  + PN+TC +KLS+P  LNYPSFSV+F +  
Sbjct  616  GLVYDASVDDYVAFLCTVGVAPRQIQVITAEGPNVTCTRKLSSPGDLNYPSFSVVFDRRS  675

Query  399  SR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVS--K  229
            SR  V+  R+LTNVG+AG  Y V +  P  ++V VKP +L F+  GD+LRYTVTF S   
Sbjct  676  SRSTVKYRRDLTNVGSAGDTYTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANA  735

Query  228  KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +G + P  AAFG ++W++ ++ VRSPI+++W
Sbjct  736  RGPMDP--AAFGWLTWSSGEHDVRSPISYTW  764


 Score = 37.7 bits (86),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = -2

Query  649  DAGGDELSNPWAHGSGHVDPHKALSPG  569
            DA  +  + PWA G+GHVDP  ALSPG
Sbjct  590  DAATNTTATPWAFGAGHVDPVSALSPG  616



>gb|EMS60034.1| Subtilisin-like protease [Triticum urartu]
Length=478

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 108/183 (59%), Gaps = 13/183 (7%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN   R   G + +TP         P+     GLVYDI+ +DY  FLCSLDY+   
Sbjct  295  TMDNTNSSLRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTSDYVAFLCSLDYSAAH  354

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIE  325
            I+ I K  N++C  + S P  LNYPSFSV+F K    +VR  RELTNVG A  +Y+V + 
Sbjct  355  IRVITKMANVSCPPR-SRPGDLNYPSFSVVFRKKPRHVVRYRRELTNVGPAMAVYDVKVS  413

Query  324  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
             P S  VTV P +LVFK VG + RY VTF SK      +   FG +SW + ++ VRSP+A
Sbjct  414  GPASAGVTVTPARLVFKKVGQKQRYYVTFESKAAGPGRAKPDFGWISWASDEHVVRSPVA  473

Query  144  FSW  136
            ++W
Sbjct  474  YTW  476



>dbj|BAK06243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 107/183 (58%), Gaps = 13/183 (7%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN   R   G + +TP         P+     GLVYDI+  DY  FLCSLDY+   
Sbjct  586  TMDNTNSSLRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTNDYAAFLCSLDYSATH  645

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIE  325
            I+ I K  N++C  + S P  LNYPSFSV+F K     VR  RELTNVG A  +Y+V + 
Sbjct  646  IRVITKMSNVSCPPR-SRPGDLNYPSFSVVFRKKARHAVRYRRELTNVGPAMAVYDVKVS  704

Query  324  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
             P SV VTV P KLVFK VG + RY VTF SK      +   FG +SW + ++ VRSP+A
Sbjct  705  GPASVGVTVTPAKLVFKKVGQKQRYYVTFESKAAGAGRAKPDFGWISWVSDEHVVRSPVA  764

Query  144  FSW  136
            ++W
Sbjct  765  YTW  767



>tpg|DAA50071.1| TPA: putative subtilase family protein [Zea mays]
Length=773

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 102/167 (61%), Gaps = 12/167 (7%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P R    GLVYDI+  DY  FLCSL+Y+   +Q I KA N++C A   S P  L
Sbjct  608  GAGHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKASNVSCGAPNKSRPGDL  667

Query  432  NYPSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKN  271
            NYPSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P SV VTV P +L F+ 
Sbjct  668  NYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPESVAVTVTPARLTFRQ  727

Query  270  VGDRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             G +LRY VTF S  ++G   P    FG +SW N ++ VRSP+A++W
Sbjct  728  AGQKLRYYVTFASRARQGHAKPD---FGWISWVNDEHVVRSPVAYTW  771



>ref|NP_001145743.1| uncharacterized protein LOC100279250 precursor [Zea mays]
 gb|ACN33223.1| unknown [Zea mays]
Length=773

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 102/167 (61%), Gaps = 12/167 (7%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P R    GLVYDI+  DY  FLCSL+Y+   +Q I KA N++C A   S P  L
Sbjct  608  GAGHVDPQRALSPGLVYDISTHDYAAFLCSLNYSAPHVQVITKASNVSCGAPNKSRPGDL  667

Query  432  NYPSFSVLFGKSR------IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKN  271
            NYPSFSV+FG+ R       +R  RELTNVG A ++Y+V +  P SV VTV P +L F+ 
Sbjct  668  NYPSFSVVFGQKRKTKPAAALRFRRELTNVGPAASVYDVKVVGPESVAVTVTPARLTFRQ  727

Query  270  VGDRLRYTVTFVS--KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             G +LRY VTF S  ++G   P    FG +SW N ++ VRSP+A++W
Sbjct  728  AGQKLRYYVTFASRARQGHAKPD---FGWISWVNDEHVVRSPVAYTW  771



>gb|EEE50901.1| hypothetical protein OsJ_31407 [Oryza sativa Japonica Group]
Length=758

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 110/185 (59%), Gaps = 18/185 (10%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN   R   G  ++TP         P+     GL+YDI+  DY  FLCSL+YTT  
Sbjct  576  TVDNTNSSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPH  635

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIE  325
            IQ I K  NITC +K   P  LNYPSFSV+F K    ++R  RE+TNVG A ++Y V + 
Sbjct  636  IQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVS  694

Query  324  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSP  151
             P SV+V V P KLVF  VG + RY V F S    V  SNA   FG +SW ++Q+ VRSP
Sbjct  695  GPASVSVKVTPAKLVFNKVGQKQRYYVIFAS---TVDASNAKPDFGWISWMSSQHVVRSP  751

Query  150  IAFSW  136
            IA++W
Sbjct  752  IAYTW  756



>gb|EAY78354.1| hypothetical protein OsI_33442 [Oryza sativa Indica Group]
Length=773

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 110/185 (59%), Gaps = 18/185 (10%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN   R   G  ++TP         P+     GL+YDI+  DY  FLCSL+YTT  
Sbjct  591  TVDNTNSSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPH  650

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIE  325
            IQ I K  NITC +K   P  LNYPSFSV+F K    ++R  RE+TNVG A ++Y V + 
Sbjct  651  IQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVS  709

Query  324  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSP  151
             P SV+V V P KLVF  VG + RY V F S    V  SNA   FG +SW ++Q+ VRSP
Sbjct  710  GPASVSVKVTPAKLVFNKVGQKQRYYVIFAS---TVDASNAKPDFGWISWMSSQHVVRSP  766

Query  150  IAFSW  136
            IA++W
Sbjct  767  IAYTW  771



>gb|AAM22744.1|AC092388_28 putative cucumisin-like serine protease [Oryza sativa Japonica 
Group]
 gb|AAP53584.1| Subtilisin N-terminal Region family protein, expressed [Oryza 
sativa Japonica Group]
Length=773

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 110/185 (59%), Gaps = 18/185 (10%)
 Frame = -3

Query  648  TLEETNFPTRGLTGRAMSTP-----TRPSPR-----GLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN   R   G  ++TP         P+     GL+YDI+  DY  FLCSL+YTT  
Sbjct  591  TVDNTNSSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVSFLCSLNYTTPH  650

Query  498  IQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIE  325
            IQ I K  NITC +K   P  LNYPSFSV+F K    ++R  RE+TNVG A ++Y V + 
Sbjct  651  IQVITKMSNITCPRKF-RPGDLNYPSFSVVFKKKSKHVMRFRREVTNVGPAMSVYNVKVS  709

Query  324  APPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAA--FGSVSWNNAQNQVRSP  151
             P SV+V V P KLVF  VG + RY V F S    V  SNA   FG +SW ++Q+ VRSP
Sbjct  710  GPASVSVKVTPAKLVFNKVGQKQRYYVIFAS---TVDASNAKPDFGWISWMSSQHVVRSP  766

Query  150  IAFSW  136
            IA++W
Sbjct  767  IAYTW  771



>ref|XP_006662325.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=535

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 103/163 (63%), Gaps = 9/163 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P +    GLVYDI+  DY  FLCSL+Y+T  IQ I K  NITC +K   P  LN
Sbjct  375  GAGHVDPQKALSPGLVYDISTKDYVSFLCSLNYSTPHIQVITKMSNITCPRKF-RPGDLN  433

Query  429  YPSFSVLFGKS--RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            YPSFSV+F K+   ++R  RE+TNVG A ++Y V + +P SV+V V P+++VF  VG + 
Sbjct  434  YPSFSVVFKKNSRHVMRFRREVTNVGPAMSVYNVKVTSPASVSVKVTPSRIVFNRVGQKQ  493

Query  255  RYTVTFVSK---KGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            RY VTF +K    G V P    FG +SW + ++ VRSP+A++W
Sbjct  494  RYYVTFAAKVDDTGSVKPD---FGWISWLSNEHVVRSPVAYTW  533



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNYPSFSVLF-GKS  397
            GL+YD++ +DY  FLCSL+Y+  Q++ + K  N +C + K+ +   LNYPSFSV+F G  
Sbjct  632  GLIYDLSTSDYLDFLCSLNYSDTQVRIVSKHSNFSCPRDKVLDTGNLNYPSFSVIFRGYE  691

Query  396  RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV  217
            ++VR +R LTNVG   ++Y V++ AP  V +TVKP +LVFK VG++  YTV F SK    
Sbjct  692  KVVRYSRVLTNVGEPSSVYTVSVSAPEGVGITVKPQRLVFKGVGNKQGYTVEFASKIKTS  751

Query  216  TPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             P +  FG + W+N +++VRSPIAFSW
Sbjct  752  GPMD--FGWILWSNQKHKVRSPIAFSW  776



>gb|EMT22975.1| Subtilisin-like protease [Aegilops tauschii]
Length=432

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 106/160 (66%), Gaps = 7/160 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTT-QQIQAIVKAPNITCAKKLSNPAQL  433
            G     P +    GLVYD +  DY  FLC++   + +Q+QAI  APN TC +KLS+P  L
Sbjct  202  GSGHVDPVKALSPGLVYDTSVDDYVAFLCTVGGASPRQVQAITGAPNATCQRKLSSPGDL  261

Query  432  NYPSFSVLFG--KSR-IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSFSV+FG  KSR  VR  RELTNVGAAG +Y   +  PPS+ V+VKP +LVFK  GD
Sbjct  262  NYPSFSVVFGLRKSRSTVRYHRELTNVGAAGAVYAAKVTGPPSIAVSVKPARLVFKKAGD  321

Query  261  RLRYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            +LRYTV F S  +G   P +AAFG ++W++    VRSPI+
Sbjct  322  KLRYTVAFKSTAEG--GPMDAAFGWLTWSSGGQDVRSPIS  359



>ref|XP_010238218.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=805

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 109/171 (64%), Gaps = 15/171 (9%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTT--QQIQAIVKA----PNITCAKKLS  448
            G     P +    GLVYD +  DY  FLC++   +  +QIQAI  +     N TC +KLS
Sbjct  635  GSGHVDPVKALSPGLVYDTSIDDYVAFLCTVGGASSPRQIQAITGSRTAKGNATCQRKLS  694

Query  447  NPAQLNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEA-PPSVTVTVKPTKLV  280
            +P  LNYPSFSV++        V+  RELTNVGAAG++Y V +   P SV+V VKP +LV
Sbjct  695  SPGDLNYPSFSVVYPLRKSHSTVKYRRELTNVGAAGSVYTVKVTGGPSSVSVAVKPARLV  754

Query  279  FKNVGDRLRYTVTF-VSKKGVVTPSNAAFGSVSWNNA--QNQVRSPIAFSW  136
            FK  GD+L+YTV F  S +G   P++AAFG ++W++A  ++ VRSPI+++W
Sbjct  755  FKKAGDKLKYTVAFKSSAQGA--PTDAAFGWLTWSSADGEHDVRSPISYTW  803



>ref|XP_007134944.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
 gb|ESW06938.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
Length=764

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 97/162 (60%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQL  433
            G     P R S  GLVYDI   DY  +LCSL YT+ QI A++   N  CAKK +     L
Sbjct  603  GSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-ALLSKGNFKCAKKSALRAGDL  661

Query  432  NYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLFG S +   VR  R +TNVG     Y V +E P  V+V V+PT + F+  G+
Sbjct  662  NYPSFAVLFGTSALNASVRYKRIVTNVGNPKISYAVKVEEPKGVSVRVEPTNISFRKTGE  721

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y V+FVS +      +++FGS++W + +  VRSPIA +W
Sbjct  722  KLSYKVSFVSNENTTVSGSSSFGSITWVSGKYAVRSPIAVTW  763



>ref|XP_006583358.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=734

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 97/162 (60%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQL  433
            G     P R S  GLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   L
Sbjct  573  GSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGDL  631

Query  432  NYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLFG S     V   R +TNVG   + Y V +E P  V+V+V+P  + F+ +GD
Sbjct  632  NYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGD  691

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y VTFVS        +++FGS++W + +  VRSPIA +W
Sbjct  692  KLSYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIAVTW  733



>gb|KHN04600.1| Subtilisin-like protease [Glycine soja]
Length=734

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 97/162 (60%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQL  433
            G     P R S  GLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   L
Sbjct  573  GSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGDL  631

Query  432  NYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLFG S     V   R +TNVG   + Y V +E P  V+V+V+P  + F+ +GD
Sbjct  632  NYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGD  691

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y VTFVS        +++FGS++W + +  VRSPIA +W
Sbjct  692  KLSYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIAVTW  733



>ref|XP_003528890.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=763

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 97/162 (60%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQL  433
            G     P R S  GLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   L
Sbjct  602  GSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGDL  660

Query  432  NYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLFG S     V   R +TNVG   + Y V +E P  V+V+V+P  + F+ +GD
Sbjct  661  NYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGD  720

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y VTFVS        +++FGS++W + +  VRSPIA +W
Sbjct  721  KLSYKVTFVSYGRTAIAGSSSFGSLTWVSDKYTVRSPIAVTW  762



>gb|EYU29564.1| hypothetical protein MIMGU_mgv1a023796mg [Erythranthe guttata]
Length=738

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 99/157 (63%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GLVYDI P DY  +LC L+YT Q++  IV A  + C+K+ + P AQL
Sbjct  581  GSGHVNPSRANDPGLVYDIMPDDYIPYLCGLNYTNQEVGIIV-ARKVDCSKEKTIPEAQL  639

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  
Sbjct  640  NYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIGSPDGVNVKVEPKKLVFPKLGDKSS  698

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y+VTF  + KGV+  S   F  + W+ A+  VRSPIA
Sbjct  699  YSVTFTRTNKGVMNSSTQGF--IRWHTAEYSVRSPIA  733



>gb|KJB70156.1| hypothetical protein B456_011G061400 [Gossypium raimondii]
Length=764

 Score =   132 bits (331),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 99/165 (60%), Gaps = 5/165 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKLSNPAQ  436
            G     P R    GLVYD   +DY  FLCS+ Y +++I+  V+ PN +  CA KL+ P  
Sbjct  593  GAGHVDPNRALNPGLVYDTDSSDYIAFLCSIGYDSKRIEVFVREPNSSDVCATKLATPGD  652

Query  435  LNYPSFSVLFGKS-RIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYPSFSV+F  +  +V+  R++ NVG +AG +YE  + APP V ++V P+KL F  V  
Sbjct  653  LNYPSFSVVFNSNDHVVKYRRKVKNVGTSAGAVYEAKVNAPPGVKISVSPSKLEFSAVNQ  712

Query  261  RLRYTVTFVSKK-GVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
             L Y V+F S   G+ +  +  FGS+ W++  + VRSPIA  W Q
Sbjct  713  TLSYEVSFASDSLGLSSVESQGFGSIEWSDGVHLVRSPIAVRWIQ  757



>gb|EYU29364.1| hypothetical protein MIMGU_mgv1a022867mg [Erythranthe guttata]
Length=672

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 97/157 (62%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R    GLVYDI P DY  ++C L+YT QQ+  IV   N+ C+K+ S P AQL
Sbjct  515  GSGHVNPSRADDPGLVYDILPDDYIPYVCGLNYTNQQVGIIV-GRNVDCSKEKSIPEAQL  573

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P +LVF  +GD+  
Sbjct  574  NYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIVSPDGVIVKVEPKQLVFPKLGDKSS  632

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y VTF  + KG +  +   F  + W+NA+  VRSPIA
Sbjct  633  YNVTFTRTTKGAMNGTTQGF--IRWHNAEYSVRSPIA  667



>gb|EYU29358.1| hypothetical protein MIMGU_mgv1a024271mg [Erythranthe guttata]
Length=354

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +   LVYDI P DY  +LC L+YT Q++  IV +  + C+K+ S P AQL
Sbjct  197  GSGHVNPSRANDPRLVYDIMPDDYIPYLCGLNYTNQEVGIIVGS-KVDCSKEKSIPEAQL  255

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  
Sbjct  256  NYPSFSIIFG-STPQTYTRTLTNVGKANSSYDVEIVSPDGVNVKVEPKKLVFPKLGDKSS  314

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y+VTF  + KGV+  S   F  + W++A+  VRSPIA
Sbjct  315  YSVTFTRTTKGVMNSSTQGF--IRWHSAKYSVRSPIA  349



>gb|EPS61652.1| hypothetical protein M569_13143, partial [Genlisea aurea]
Length=738

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 100/184 (54%), Gaps = 13/184 (7%)
 Frame = -3

Query  648  TLEETNFPTRG----------LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQ  499
            T++ TN P             + G     P +    GLVYD   TDY  FLC  +YT + 
Sbjct  555  TIDNTNSPIEDSVDSSVATPFVLGAGHVDPAKAVSPGLVYDANVTDYVSFLCWSNYTAES  614

Query  498  IQAIVKAPNITC--AKKLSNPAQLNYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAI  328
            I  I    N+TC  A  + +P QLNYPSFSV+F    R V  TR +TNVG   + Y V++
Sbjct  615  ISTIAGGRNVTCPEANGVDDPGQLNYPSFSVVFVSGGRPVSYTRVVTNVGNGPSTYVVSV  674

Query  327  EAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  148
             AP + T+ V P +LVF   G +L+YT TF S +G    +  AFG++SW +   QV SP+
Sbjct  675  TAPSAATIVVIPKELVFGAKGQKLQYTSTFGSNRGANATAGNAFGAISWISNTTQVTSPV  734

Query  147  AFSW  136
            AF+W
Sbjct  735  AFTW  738



>ref|XP_006576383.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006576384.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=766

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 97/162 (60%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQL  433
            G     P R S  GLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   L
Sbjct  605  GSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGGL  663

Query  432  NYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLF    ++  V   R +TNVG   + Y V +E P  V+VTV+P  + F+ +GD
Sbjct  664  NYPSFAVLFDTSARNASVTYKRVVTNVGNPSSSYAVKVEEPKGVSVTVEPRNIGFRKIGD  723

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y V+FVS        +++FGS++W + +  VRSPIA +W
Sbjct  724  KLSYKVSFVSYGRTAVAGSSSFGSLTWVSGKYAVRSPIAVTW  765



>gb|EYU29552.1| hypothetical protein MIMGU_mgv1a0178121mg, partial [Erythranthe 
guttata]
Length=188

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 94/157 (60%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GLVYDI P DY  +LC L+Y  QQ+  I+    + C+K+ S P AQL
Sbjct  31   GSGHVNPSRANDPGLVYDILPDDYIPYLCGLNYPNQQV-GILVGRKVDCSKEKSIPEAQL  89

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  
Sbjct  90   NYPSFSIVFG-STPQTYTRMLTNVGKANSSYDVEIVSPDGVNVKVEPKKLVFPKLGDKSS  148

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y+VTF  + KG +  +   F  + W  A   VRSPIA
Sbjct  149  YSVTFTRTTKGAINSTTQGF--IRWYTADYSVRSPIA  183



>gb|KHN04108.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 95/162 (59%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQL  433
            G     P R S  GLVYDI   DY  +LCSL YT+ QI AI+   N  CAKK + +   L
Sbjct  577  GSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQI-AILSKGNFKCAKKSALHAGGL  635

Query  432  NYPSFSVLFGKS---RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLF  S     V   R +TNVG   + Y V +E P  V+V V+P  + F+ +GD
Sbjct  636  NYPSFAVLFDTSTRNASVTYKRVVTNVGNPSSSYAVKVEEPKGVSVIVEPRNISFRKIGD  695

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y V+FVS        +++FGS++W + +  VRSPIA +W
Sbjct  696  KLSYKVSFVSYGRTAVAGSSSFGSLTWVSGKYHVRSPIAVTW  737



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 94/161 (58%), Gaps = 3/161 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P   S  GLVYDI+  DY  +LCS++YT+ QI  + +   +   K L     LN
Sbjct  577  GSGHVNPVNASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKTLLQAGNLN  636

Query  429  YPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            YPSFSVLFG+S     V   R +TNVG   + Y V +E P  V+VTV+P KL F+ VG +
Sbjct  637  YPSFSVLFGRSASNASVTYRRVVTNVGNPQSAYAVKLEQPNGVSVTVEPRKLKFEKVGQK  696

Query  258  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            L Y VTF+S  G      ++FGS+ W + + +VRSP+A +W
Sbjct  697  LSYKVTFLSIGGARVAGTSSFGSLVWVSGKYKVRSPMAVTW  737



>ref|XP_006574858.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006574859.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=772

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 94/161 (58%), Gaps = 3/161 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P   S  GLVYDI+  DY  +LCS++YT+ QI  + +   +   K +     LN
Sbjct  611  GSGHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKAVLQAGDLN  670

Query  429  YPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            YPSF+VL GKS +   V   R +TNVG   + Y V +E P  V+VTV+P KL F+ VG +
Sbjct  671  YPSFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLEQPNGVSVTVEPRKLKFEKVGQK  730

Query  258  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            L Y VTF+S  G      ++FGS+ W + + QVRSP+A +W
Sbjct  731  LSYKVTFLSIGGARVAGTSSFGSLIWVSGRYQVRSPMAVTW  771



>gb|KHN27220.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 94/161 (58%), Gaps = 3/161 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P   S  GLVYDI+  DY  +LCS++YT+ QI  + +   +   K +     LN
Sbjct  580  GSGHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKAVLQAGDLN  639

Query  429  YPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            YPSF+VL GKS +   V   R +TNVG   + Y V +E P  V+VTV+P KL F+ VG +
Sbjct  640  YPSFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLEQPNGVSVTVEPRKLNFEKVGQK  699

Query  258  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            L Y VTF+S  G      ++FGS+ W + + QVRSP+A +W
Sbjct  700  LSYKVTFLSIGGARVAGTSSFGSLIWVSGRYQVRSPMAVTW  740



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 99/175 (57%), Gaps = 10/175 (6%)
 Frame = -3

Query  648  TLEETN-FPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN  472
            T EE+N F    + G     P +    GL+YD+ P DY  FLCS+ Y ++QI   VK  +
Sbjct  594  TSEESNPF----VHGAGHIDPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSS  649

Query  471  IT--CAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVT  301
             +  C  KLSNP  LNYPSFSV+F    +V+ TR +TNVG     +Y V +EAP  V ++
Sbjct  650  YSQLCEHKLSNPGNLNYPSFSVVFDDGEVVKYTRTVTNVGDETEVVYGVKVEAPQGVEIS  709

Query  300  VKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            V P KL F      L Y +TF    G     +A+FGS+ W++  + VRSPIA S+
Sbjct  710  VVPNKLEFNKEKTTLSYEITFTKINGF--KESASFGSIQWSDGIHNVRSPIAVSF  762



>ref|XP_004492670.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=785

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 97/162 (60%), Gaps = 6/162 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P   S  GLVYDI+  DY  + CSL++T+ QI AI+      C+ K      LN
Sbjct  625  GSGHVDPESASDPGLVYDISTNDYLNYFCSLNFTSSQI-AILSKSKFNCSMKQVQVGDLN  683

Query  429  YPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            YPSFSV+F   GKS  V   R +TNVG + ++YEV +E P  V V+V+P KL F  +G +
Sbjct  684  YPSFSVIFSRTGKSASVTYKRVVTNVGKSESVYEVKVEQPNGVVVSVEPRKLKFDKLGQK  743

Query  258  LRYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            LRY VTF    KG V  S ++FGS+ W + + +VRSPIA +W
Sbjct  744  LRYKVTFFGIGKGRVIGS-SSFGSLIWVSDKYKVRSPIAVTW  784



>gb|EYU28960.1| hypothetical protein MIMGU_mgv1a018215mg, partial [Erythranthe 
guttata]
Length=715

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 98/157 (62%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GLVYDI P DY  +LC L+YT Q+I  IV    + C+++ S P AQL
Sbjct  558  GSGHVNPSRANNPGLVYDIMPDDYIPYLCGLNYTNQEIGIIV-GRKVDCSEEKSIPEAQL  616

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y V I +P  V V V+P KLVF  +GD+  
Sbjct  617  NYPSFSIIFG-STPQTYTRTLTNVGKANSSYVVEIASPDGVIVKVEPQKLVFPKLGDKSS  675

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y+VTF  + KGV+  +N   G + W+ A+  VRSPIA
Sbjct  676  YSVTFTRTNKGVM--NNTTQGFIRWHTAEYSVRSPIA  710



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 98/175 (56%), Gaps = 10/175 (6%)
 Frame = -3

Query  648  TLEETN-FPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN  472
            T EE+N F    + G     P +    GL+YD+ P DY  FLCS+ Y ++QI   VK  +
Sbjct  594  TSEESNPF----VHGAGHINPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSS  649

Query  471  I--TCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVT  301
                C  KL+NP  LNYPSFSV+F +  +V+ TR +TNVG     +YEV +EAP  V ++
Sbjct  650  YFQLCEHKLTNPGNLNYPSFSVVFDEEEVVKYTRTVTNVGDETEVVYEVKVEAPQGVVIS  709

Query  300  VKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            V P KL F        Y +TF    G     +A+FGS+ W +  + VRSPIA S+
Sbjct  710  VVPNKLEFNKEKTTQSYEITFTKINGF--KESASFGSIQWGDGIHSVRSPIAVSF  762



>ref|XP_007051971.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96128.1| Subtilase family protein [Theobroma cacao]
Length=768

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 91/161 (57%), Gaps = 5/161 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P R S  GL+YDI+P DY  +LCSL Y   QI   V   N TC K  +  P  L
Sbjct  609  GSGHVDPERASDPGLIYDISPKDYIYYLCSLKYNASQISLFVD--NFTCPKHAIMQPGDL  666

Query  432  NYPSFSVLFGKSRI--VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            NYPSF+V F  S    V   R +TNVG   + Y+V +E P  V+V VKP  L FK +G +
Sbjct  667  NYPSFAVNFKSSAAENVTYKRTVTNVGTPKSTYKVLVEEPKGVSVIVKPEILTFKMLGKK  726

Query  258  LRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            L Y VTF+  K     + ++FGS+ W + + +VRSPIA SW
Sbjct  727  LSYKVTFIGLKRTKPVAASSFGSLVWVSGKYRVRSPIAASW  767



>gb|EYU29555.1| hypothetical protein MIMGU_mgv1a022042mg [Erythranthe guttata]
Length=720

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 94/157 (60%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R    GLVYDI P DY  ++C L+YT QQ+  IV   N+ C+K+ S P AQL
Sbjct  563  GSGHVNPSRADDPGLVYDILPDDYIPYVCGLNYTNQQVGIIV-GRNVDCSKEKSIPEAQL  621

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y+V I +P  VTV V+P KLVF  +GD+  
Sbjct  622  NYPSFSIIFGSSPQT-YTRTLTNVGKANSSYDVEIVSPNGVTVKVEPKKLVFPKLGDKSS  680

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y VTF  + KG +      F  + W  A   VRSPI+
Sbjct  681  YNVTFTRTTKGAMNSITQGF--IRWYTADYSVRSPIS  715



>gb|EYU31528.1| hypothetical protein MIMGU_mgv1a0212142mg, partial [Erythranthe 
guttata]
Length=435

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 95/157 (61%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GLVYDI P DY  +LC L+Y  Q++  +V    + C+K+ S P AQL
Sbjct  278  GSGHVNPSRANDPGLVYDILPDDYLQYLCGLNYPNQEVSILV-GRKVDCSKEKSIPEAQL  336

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  
Sbjct  337  NYPSFSIVFG-STPQTYTRTLTNVGKANSSYDVEIVSPDGVNVKVEPKKLVFPKLGDKSS  395

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y+VTF  + KG +  +   F  + W +A   VRSPIA
Sbjct  396  YSVTFTRTTKGAINSTTQGF--IRWYSADYSVRSPIA  430



>gb|EYU28963.1| hypothetical protein MIMGU_mgv1a023216mg [Erythranthe guttata]
Length=341

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 95/147 (65%), Gaps = 7/147 (5%)
 Frame = -3

Query  579  SPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNYPSFSVLFG  403
             PR LVYDI P DY  +LC L+YT Q++  IV +  + C+K+ S P AQLNYPSFS++FG
Sbjct  195  DPR-LVYDIMPDDYIPYLCGLNYTNQEVGIIVGS-KVDCSKEKSIPEAQLNYPSFSIIFG  252

Query  402  KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-SKK  226
             S     TR L NVG A + Y+V I +P  V V V+P KLVF  +GD+  Y+VTF  + K
Sbjct  253  -STPQTYTRTLANVGKANSSYDVEIVSPDGVNVKVEPKKLVFPKLGDKSSYSVTFTRTTK  311

Query  225  GVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            GV+  S   F  + W++A+  VRSPIA
Sbjct  312  GVMNSSTQGF--IRWHSAKYSVRSPIA  336



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 104/178 (58%), Gaps = 11/178 (6%)
 Frame = -3

Query  648  TLEETN-FPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK---  481
            T EE+N F    + G     P R    GLVYD+  +DY  FLC++ Y+  +I   V+   
Sbjct  595  TGEESNPF----VHGSGHVDPNRALNPGLVYDLGTSDYVAFLCAVGYSPGRIAVFVRDGP  650

Query  480  APNITCAKKLSNPAQLNYPSFSVLFG-KSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVT  307
             P    A+ +  P  LNYPSFSV+F   + +V+ TR + NVG+ A  +YEV + APPSV 
Sbjct  651  VPVDCGAQGMGTPGDLNYPSFSVVFSPGNSVVKYTRVVKNVGSNAEAVYEVKVNAPPSVE  710

Query  306  VTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPS-NAAFGSVSWNNAQNQVRSPIAFSW  136
            VTV P++LVF    D L Y V+F +  G++  +   AFGS+ W++ ++ VRSPIA  W
Sbjct  711  VTVSPSQLVFSQGNDTLSYEVSFTTASGILVGALKPAFGSLEWSDGEHLVRSPIAVVW  768



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 93/149 (62%), Gaps = 7/149 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNYPSFSVLFG-KS  397
            GLVYD+   DY  FLC+L+YT  QI  + +  N TC + K    + LNYPSF+V F   S
Sbjct  613  GLVYDLTTEDYLDFLCALNYTPLQIARLSRLTNYTCDRQKAYEVSDLNYPSFAVAFATAS  672

Query  396  RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVV  217
              V+ TR LTNVGA GT Y+  + AP  V V V+PT L F  +G++  YTVTF +     
Sbjct  673  TTVKHTRTLTNVGAPGT-YKATVSAPEGVKVVVEPTALTFSALGEKKNYTVTFSTAS---  728

Query  216  TPSNA-AFGSVSWNNAQNQVRSPIAFSWT  133
             PS + AFG + W++AQ+ V SP+AFSWT
Sbjct  729  QPSGSTAFGRLEWSDAQHVVASPLAFSWT  757



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 90/166 (54%), Gaps = 4/166 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN-ITC-AKKLSNPAQ  436
            G     P +    GL+YD    DY  FLC++ Y+TQQI    +    + C A  L++P  
Sbjct  609  GAGHVDPNKALDPGLIYDSQVEDYLAFLCAIGYSTQQIALFTRDETTVNCSAMTLASPGD  668

Query  435  LNYPSFSVLFGK-SRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYP+FSV+F   S IV  +R + NVG     +YE  I  PP V VTV P+KLVF  V  
Sbjct  669  LNYPAFSVVFSSTSDIVTFSRVVRNVGGPDDAVYEAEISGPPGVNVTVAPSKLVFDAVDQ  728

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
             L Y +TF S        +  FG +SW++  + VRSPIA SW Q F
Sbjct  729  SLSYEITFASIADAAVAGSNGFGGISWSDGTHSVRSPIAVSWRQSF  774



>gb|EMS68171.1| Subtilisin-like protease [Triticum urartu]
Length=419

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 83/112 (74%), Gaps = 6/112 (5%)
 Frame = -3

Query  459  KKLSNPAQLNYPSFSVLFG--KSRI-VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPT  289
            +KL +P  LNYPSFSV+FG  KSR  V+  RELTNVGAAG++Y   +  PPS+ V+VKP 
Sbjct  308  RKLPSPGDLNYPSFSVVFGLRKSRTTVKYHRELTNVGAAGSVYAAKVTGPPSIVVSVKPA  367

Query  288  KLVFKNVGDRLRYTVTFVS-KKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +LVFK VGD+LRYTV F S  +G   P +AAFG ++W++ +  VRSPI+++W
Sbjct  368  RLVFKKVGDKLRYTVAFKSTAEG--GPMDAAFGWLTWSSGEQDVRSPISYTW  417



>ref|XP_011035007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=769

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 93/162 (57%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P R S  GL+YDI   DY  + CSLDYT+ QI A V   N+TC   K   P  L
Sbjct  608  GSGHVDPERASDPGLIYDITIEDYLNYFCSLDYTSSQI-AQVSRRNVTCPDNKALQPGDL  666

Query  432  NYPSFSVLF-GKSR--IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+V F G +R   V+  R LTNVG   + Y V +E P  V+V ++P  L F+ +G 
Sbjct  667  NYPSFAVNFEGNARNNRVKYKRTLTNVGTPSSTYAVKVEEPNGVSVILEPKSLSFEKLGQ  726

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y VTFVS  G     +++ GS+ W + +  VRSPIA +W
Sbjct  727  KLSYNVTFVSSGGKGREGSSSIGSLVWLSGKYSVRSPIAVTW  768



>ref|XP_004308418.2| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 98/165 (59%), Gaps = 10/165 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKA-PNITCAKK--LSNPA  439
            G   + P   +  GL+YDI   DY ++LCSL+YT+ QI        N TC     +  P 
Sbjct  611  GSGHADPESAADPGLIYDITTNDYLLYLCSLNYTSPQIALFSSGISNFTCPSNSTVLQPG  670

Query  438  QLNYPSFSVLF---GKSRIVRQTRELTNVGAAG-TLYEVAIEAPPSVTVTVKPTKLVFKN  271
             LNYPS SV+F   G+      TR +TNVGA   + Y V +EAP  V+VTV+P KLVFK 
Sbjct  671  NLNYPSLSVVFRRDGRKMSATYTRTVTNVGAINPSTYAVQVEAPIGVSVTVEPRKLVFKK  730

Query  270  VGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +G++L Y V+FV   G+   +N++FGS+ W + + +VRSPIA  W
Sbjct  731  MGEKLSYKVSFV---GMSATTNSSFGSLVWVSEKYRVRSPIAVIW  772



>ref|XP_003554304.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
 gb|KHN02462.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=768

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 100/168 (60%), Gaps = 12/168 (7%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK--KLSNPAQ  436
            G     P R    GLVYDI P DY   LCSL YT  +I +I    N++C    K++    
Sbjct  600  GAGHVNPQRALNPGLVYDIRPDDYITHLCSLGYTKSEIFSITHR-NVSCNGIIKMNRGFS  658

Query  435  LNYPSFSVLFGKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYPSFSV+F K  + R+  +R LTNVG+A ++Y V ++AP  V V VKP +LVFK V  
Sbjct  659  LNYPSFSVIF-KDEVRRKMFSRRLTNVGSANSIYSVEVKAPAGVKVIVKPKRLVFKQVNQ  717

Query  261  RLRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAFSW  136
             L Y V F+S+K V       N + GS++W ++QN   +VRSP+A +W
Sbjct  718  SLSYRVWFISRKKVKRGDGLVNHSEGSLTWVHSQNGSYRVRSPVAVTW  765



>ref|XP_007139243.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 ref|XP_007139244.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11237.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11238.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
Length=770

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 96/162 (59%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P   S  GLVYDI+  DY  + CS++YT+ QI A++      C+KK +     L
Sbjct  609  GSGHVNPVSASDPGLVYDISTKDYLNYFCSINYTSSQI-ALLSRRKFVCSKKAVLQAGDL  667

Query  432  NYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLFG+S     V   R +TNVG + + Y V +E P  V+V+V+P KL F+ +G 
Sbjct  668  NYPSFAVLFGRSAFNASVTYMRVVTNVGKSKSSYAVKVEQPNGVSVSVEPRKLKFEKLGQ  727

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y VTF +  G      ++FGS+ W + + +VRSPIA +W
Sbjct  728  KLSYNVTFFATGGPKVGGTSSFGSLIWVSDRYKVRSPIAITW  769



>ref|XP_008454762.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 91/163 (56%), Gaps = 6/163 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK--LSNPAQ  436
            G     P + S  GL+YDI P DY  +LCSL Y + QI A+V   N+TC+ K  +  P  
Sbjct  602  GSGHVDPEKASDPGLIYDITPQDYINYLCSLKYNSSQI-ALVSRGNLTCSSKRTVVKPGD  660

Query  435  LNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYPSFSV      K   +   R +TNVG   + Y V I  P  VTV VKP KL F ++G
Sbjct  661  LNYPSFSVFMKKKAKKVSITLKRTVTNVGITRSDYTVKINNPKGVTVIVKPEKLSFGSLG  720

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            ++L Y V+FVS  G       +FGS+ W + +  VRSPI  +W
Sbjct  721  EQLSYKVSFVSLGGKEALDKFSFGSLVWISGKYAVRSPIVVTW  763



>ref|XP_007051969.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX96126.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=773

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 91/166 (55%), Gaps = 7/166 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G   + P R S  GL+YDI+P DY  +LCSL YT  QI   V   N TC K  +  P  L
Sbjct  609  GSGHADPERASDPGLIYDISPKDYIYYLCSLKYTDSQISGFVY--NFTCPKDAIMQPGDL  666

Query  432  NYPSFSVLFGKSRIVRQT----RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            NYPSF V F  S     T    R +TNVG   + Y+V +E P  V+V V P  L F  +G
Sbjct  667  NYPSFVVNFKSSAAENITLTYHRTVTNVGTPKSTYDVLVEEPEGVSVVVTPKVLTFNMLG  726

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQL  127
            ++L Y VTF   K     + ++FGS+ W +   +VRSPIA SW ++
Sbjct  727  EKLSYKVTFTGLKRTKPVAASSFGSLVWVSGNYRVRSPIAASWLKM  772



>gb|EYU29357.1| hypothetical protein MIMGU_mgv1a021077mg [Erythranthe guttata]
Length=719

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 6/156 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GLVYDI P DY  +LC L+YT Q++  IVK   + C+KK S P AQL
Sbjct  562  GSGHVNPSRANDPGLVYDILPDDYIPYLCGLNYTNQEVGIIVKC-KVDCSKKKSIPEAQL  620

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y+V I +   V V V+P KLVF  +GD+  
Sbjct  621  NYPSFSIIFG-STPQTYTRTLTNVGKANSSYDVEIVSSHGVNVKVEPHKLVFPKLGDKSS  679

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPI  148
            Y+VTF  + K  +  +   F  + W  A + VRSPI
Sbjct  680  YSVTFTRTTKEAMNSTTQGF--IRWYTADHSVRSPI  713



>gb|KHN10783.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=693

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 98/167 (59%), Gaps = 10/167 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQ  436
            G     P R    GLVYDI P DY   LCSL YT  +I +I    N++C    K++    
Sbjct  525  GAGHVNPQRALNPGLVYDIRPDDYITHLCSLGYTKSEIFSITHR-NVSCNAIMKMNRGFS  583

Query  435  LNYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            LNYPSFSV+F G  R    +R LTNVG+A ++Y + ++AP  V V VKP +LVFK V   
Sbjct  584  LNYPSFSVIFKGGVRRKMFSRRLTNVGSANSIYSMEVKAPEGVKVIVKPKRLVFKQVNQS  643

Query  258  LRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAFSW  136
            L Y V F+S+K V       N A GS++W ++QN   +VRSP+A +W
Sbjct  644  LSYRVWFISRKRVKRGDDLVNYAEGSLTWVHSQNGSYRVRSPVAVTW  690



>ref|XP_004140440.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004167887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=766

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 91/163 (56%), Gaps = 6/163 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK--LSNPAQ  436
            G     P + S  GL+YDI P DY  +LCSL Y + QI A+V   N TC+ K  +  P  
Sbjct  604  GSGHVDPEKASDPGLIYDITPQDYINYLCSLKYNSTQI-ALVSRGNFTCSSKRTVVKPGD  662

Query  435  LNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYPSFSV      K   +   R +TNVG + + Y V I  P  +TV VKP KL F ++G
Sbjct  663  LNYPSFSVFMKKKAKKVSITLKRTVTNVGISRSDYTVKINNPKGITVIVKPEKLSFGSLG  722

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            ++L Y V FVS  G       +FGS+ W + +  VRSPIA +W
Sbjct  723  EQLSYQVRFVSLGGKEALDTFSFGSLVWISGKYAVRSPIAVTW  765



>ref|XP_003520616.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=768

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 98/167 (59%), Gaps = 10/167 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQ  436
            G     P R    GLVYDI P DY   LCSL YT  +I +I    N++C    K++    
Sbjct  600  GAGHVNPQRALNPGLVYDIRPDDYITHLCSLGYTKSEIFSITHR-NVSCNAIMKMNRGFS  658

Query  435  LNYPSFSVLF-GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            LNYPSFSV+F G  R    +R LTNVG+A ++Y + ++AP  V V VKP +LVFK V   
Sbjct  659  LNYPSFSVIFKGGVRRKMFSRRLTNVGSANSIYSMEVKAPEGVKVIVKPKRLVFKQVNQS  718

Query  258  LRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAFSW  136
            L Y V F+S+K V       N A GS++W ++QN   +VRSP+A +W
Sbjct  719  LSYRVWFISRKRVKRGDDLVNYAEGSLTWVHSQNGSYRVRSPVAVTW  765



>gb|ACJ26761.1| subtilisin-like protein [Nicotiana benthamiana]
Length=191

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 92/169 (54%), Gaps = 9/169 (5%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAKK-LSNPAQ  436
            G     P R    GL+YDI  +DY  FLCS+ Y    +    + +  + C+++ L+ P  
Sbjct  16   GSGHVDPNRALDPGLIYDIETSDYVNFLCSIGYDGDDVAVFARDSSRVNCSERSLATPGD  75

Query  435  LNYPSFSVLF-GKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYPSFSV+F G+S  +V+  R + NVG     +YEV + AP SV V V P KLVF    
Sbjct  76   LNYPSFSVVFTGESNGVVKYKRVVKNVGKNTDAVYEVKVNAPSSVEVNVSPAKLVFSEEK  135

Query  264  DRLRYTVTFVSKKG----VVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
              L Y ++  SKK     +V    +AFGS+ W++  + VRSPIA  W  
Sbjct  136  QSLSYEISLKSKKSGDLQMVKGIESAFGSIEWSDGIHNVRSPIAVRWRH  184



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 98/171 (57%), Gaps = 11/171 (6%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAK-KLSNP  442
            + G     P R    GLVYD+  TDY  FLC++ Y +++I    K A ++ C K     P
Sbjct  599  VHGAGHVDPNRAVDPGLVYDLDTTDYIAFLCTIGYDSRRISVFTKDASSVDCDKLGFKTP  658

Query  441  AQLNYPSFSVLF-GKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNV  268
              LNYPSFSV+F G+  +V+  R +TNVG+    +YEV + APP V V+V P+KLVF   
Sbjct  659  GNLNYPSFSVVFYGEESVVKYNRTVTNVGSEVDAVYEVRVGAPPGVEVSVSPSKLVFSET  718

Query  267  GDRLRYTVTFVSKKG------VVTPSNAAFGSVSWNNAQNQ-VRSPIAFSW  136
             D+L Y VTF S         +V  + ++FGS+ W++  +  VRSPIA  W
Sbjct  719  EDKLSYEVTFKSSSSASSGLEIVGSAKSSFGSIEWSDGGSHLVRSPIAAVW  769



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 96/162 (59%), Gaps = 7/162 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQL  433
            G     P +    GLVY++   DY  FLC+L+YT  QI  + +  N TC + K    + L
Sbjct  600  GAGHVDPPKALDPGLVYNLTNEDYLDFLCALNYTPLQIARLSRLTNYTCDRQKAYEVSDL  659

Query  432  NYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            NYPSF+V F   S  V+ TR LTNVGA GT Y+  + AP  V V V+PT L F  +G++ 
Sbjct  660  NYPSFAVAFATASTTVKHTRTLTNVGAPGT-YKATVSAPEDVKVVVEPTALTFAALGEKK  718

Query  255  RYTVTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSPIAFSWT  133
             YTVTF +      PS + AFG + W++AQ+ V SP+AFSWT
Sbjct  719  NYTVTFSTAS---QPSGSTAFGRLEWSDAQHVVASPLAFSWT  757



>ref|XP_002320086.2| subtilase family protein [Populus trichocarpa]
 gb|EEE98401.2| subtilase family protein [Populus trichocarpa]
Length=769

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 94/162 (58%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P   S  GL+YDI   DY  + CSL+YT+ QI A V   N+TC   K   P  L
Sbjct  608  GSGHVDPESASDPGLIYDITIEDYLNYFCSLNYTSSQI-AQVSRRNVTCPDNKALQPGDL  666

Query  432  NYPSFSVLF-GKSR--IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+V F G +R   V+  R LTNVG   + Y V +E P  V+V ++P  L F+ +G 
Sbjct  667  NYPSFAVNFEGNARNNRVKYKRTLTNVGTPWSTYAVKVEEPNGVSVILEPKSLSFEKLGQ  726

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y VTFVS +G     +++FGS+ W + +  VRSPIA +W
Sbjct  727  KLSYNVTFVSSRGKGREGSSSFGSLVWLSGKYSVRSPIAVTW  768



>emb|CAN81091.1| hypothetical protein VITISV_040911 [Vitis vinifera]
Length=430

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 95/163 (58%), Gaps = 5/163 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN--PAQ  436
            G     P + S  GL+YDI   DY  +LCS++YT+ QI  + +  + TC     +  P  
Sbjct  267  GSGHVNPEKASNPGLIYDITTEDYLNYLCSVNYTSSQIARVSRRISFTCPNDTVHLQPGD  326

Query  435  LNYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYPSF+VLF G ++  R T  R +TNVG   T Y   ++ P  V+V VKP  L FK + 
Sbjct  327  LNYPSFAVLFNGNAQKNRATYKRSVTNVGYPTTTYVAQVQEPEGVSVMVKPNVLKFKELN  386

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             +L Y V+FV+ +   T SN +FGS+ W + + +VRSPIA +W
Sbjct  387  QKLSYKVSFVASRKTSTSSNWSFGSLVWVSRKYRVRSPIAVTW  429



>ref|XP_004171629.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=769

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 91/162 (56%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK--LSNPAQ  436
            G     P + S  GL+YDIAP DY  +LCSL YT+ QI ++V     TC+ K   S P  
Sbjct  608  GSGHVDPEKASHPGLIYDIAPQDYITYLCSLKYTSTQI-SLVSRGKFTCSSKNTFSQPGD  666

Query  435  LNYPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL F  +G+
Sbjct  667  LNYPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRINNPKGIRIIVKPEKLNFVKLGE  726

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y V+F +     +    +FGS+ W++    VRSPIA +W
Sbjct  727  KLSYKVSFYALGKRESLDEFSFGSLVWHSGTYAVRSPIAVTW  768



>ref|XP_004140477.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=739

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 91/162 (56%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK--LSNPAQ  436
            G     P + S  GL+YDIAP DY  +LCSL YT+ QI ++V     TC+ K   S P  
Sbjct  578  GSGHVDPEKASHPGLIYDIAPQDYITYLCSLKYTSTQI-SLVSRGKFTCSSKNTFSQPGD  636

Query  435  LNYPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL F  +G+
Sbjct  637  LNYPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRINNPKGIRIIVKPEKLNFVKLGE  696

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y V+F +     +    +FGS+ W++    VRSPIA +W
Sbjct  697  KLSYKVSFYALGKRESLDEFSFGSLVWHSGTYAVRSPIAVTW  738



>gb|KHN13887.1| Subtilisin-like protease [Glycine soja]
Length=687

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 94/162 (58%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P      GLVYDI   DY  +LCSL+YT+ QI A++      C+KK +     L
Sbjct  526  GSGHVNPVSAFDPGLVYDIGTEDYLNYLCSLNYTSSQI-ALLSRGKFACSKKAVLQAGDL  584

Query  432  NYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLF +S +   V  TR +TNVG   + Y V ++ P  V+VTV+P  L F+ VG 
Sbjct  585  NYPSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVKQPDGVSVTVEPRVLKFEKVGQ  644

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y VTF++         ++FGS+ W + + QVRSPIA +W
Sbjct  645  KLSYKVTFLAVGKARVAGTSSFGSLIWVSGRYQVRSPIALTW  686



>ref|XP_003551824.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=767

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 94/162 (58%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P      GLVYDI   DY  +LCSL+YT+ QI A++      C+KK +     L
Sbjct  606  GSGHVNPVSAFDPGLVYDIGTEDYLNYLCSLNYTSSQI-ALLSRGKFACSKKAVLQAGDL  664

Query  432  NYPSFSVLFGKSRI---VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLF +S +   V  TR +TNVG   + Y V ++ P  V+VTV+P  L F+ VG 
Sbjct  665  NYPSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVKQPDGVSVTVEPRVLKFEKVGQ  724

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y VTF++         ++FGS+ W + + QVRSPIA +W
Sbjct  725  KLSYKVTFLAVGKARVAGTSSFGSLIWVSGRYQVRSPIALTW  766



>ref|XP_008454764.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008454765.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=768

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 92/162 (57%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS--NPAQ  436
            G     P + S  GLVYDIAP DY  +LCSL Y + QI A+V     TC+ K +   P  
Sbjct  607  GSGHVDPEKASDPGLVYDIAPQDYITYLCSLKYNSTQI-ALVSRGKFTCSSKRTFFQPGD  665

Query  435  LNYPSFSVLFGKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYPSFSV   K + V  T  R +TNVG   + Y V I  P  + + VKP KL F  +G+
Sbjct  666  LNYPSFSVFMKKGKNVNSTFKRTVTNVGIPRSDYTVRIYNPKGIRIIVKPEKLSFVKLGE  725

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y V+FV+     +  + +FGS+ W++    VRSPIA +W
Sbjct  726  KLSYKVSFVALGKRKSLDDFSFGSLVWHSGTYVVRSPIAVTW  767



>ref|XP_009611962.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009611971.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=767

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 99/162 (61%), Gaps = 6/162 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P + S  GL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  + +P  L
Sbjct  607  GSGHVDPEKASNPGLIYDISTEDYLHYICSLNYNSSQIALLLRK-NYTCPSHAIQSPGDL  665

Query  432  NYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLF  KSR + QT  R  TNVG   + Y V + AP  V+VTVKP  L F+  G 
Sbjct  666  NYPSFAVLFDSKSRNLIQTFKRSATNVGNPMSTYVVQVNAPSGVSVTVKPKILKFEKKGQ  725

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +LRY + FV+ +G  +  ++ FGS+ W +  + VRSPIA +W
Sbjct  726  KLRYKMRFVA-RGKRSAGDSTFGSLVWFSKIHIVRSPIAITW  766



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 97/175 (55%), Gaps = 41/175 (23%)
 Frame = -3

Query  615  LTGRAMSTPTRP--------SPR-----GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP  475
            +T  A  TPT P         PR     GLVYD+   DY  F+CSL+YT +Q+Q+ V+  
Sbjct  582  ITDAADGTPTSPWGLGAGHIDPRKALSPGLVYDLTADDYVAFVCSLNYTIKQVQSTVRRT  641

Query  474  NITCAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVK  295
            N                         ++VR +RE+TNVG AG++Y+VA++AP +V V VK
Sbjct  642  N-------------------------KVVRYSREVTNVGDAGSVYKVAVQAPSTVAVRVK  676

Query  294  PTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
            P +LVF  VG++ RYTVTFV++           GS++W N Q++VRSP+ F W +
Sbjct  677  PRRLVFGKVGEKQRYTVTFVARN---KTDETHGGSITWKNRQHRVRSPVGFLWGE  728



>gb|EYU28634.1| hypothetical protein MIMGU_mgv1a024623mg, partial [Erythranthe 
guttata]
Length=699

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 93/157 (59%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GLVYDI P DY  +LC L+Y  Q++  +V    + C+K+ S P AQL
Sbjct  542  GSGHVNPSRANDPGLVYDILPDDYLQYLCGLNYPNQEVSILV-GRKVDCSKEKSIPEAQL  600

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++ G S     TR LTNVG A + Y+V I +P  V V V+P KLVF  +GD+  
Sbjct  601  NYPSFSIVLG-STPQTYTRTLTNVGKANSSYDVKIVSPDGVNVKVEPKKLVFPKLGDKSS  659

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y+VTF  + KG +  +   F  + W  A   VRSPIA
Sbjct  660  YSVTFTRTTKGAINSTTQGF--IRWYTADYSVRSPIA  694



>gb|EYU29554.1| hypothetical protein MIMGU_mgv1a0256351mg, partial [Erythranthe 
guttata]
Length=434

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 92/150 (61%), Gaps = 6/150 (4%)
 Frame = -3

Query  588  TRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQLNYPSFSV  412
            +R    GLVYDI P DY  F+C L+YT QQ+  IV   ++ C+K+ S P AQLNYPSFS+
Sbjct  284  SRADDPGLVYDILPDDYIPFVCGLNYTNQQVGIIV-GRDVDCSKEKSIPEAQLNYPSFSI  342

Query  411  LFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFV-  235
            +FG S     TR LTNVG   + Y+V I +P +V V V+P KLVF  +GD+  Y VTF  
Sbjct  343  IFG-STPQTYTRTLTNVGKPDSSYDVEIVSPDNVIVKVEPKKLVFPKLGDKSSYNVTFTR  401

Query  234  SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            + K V+  +   F  + W  A   VRSPIA
Sbjct  402  TTKEVMNSTTQGF--IRWYTADYSVRSPIA  429



>gb|ACN28035.1| unknown [Zea mays]
Length=380

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 93/170 (55%), Gaps = 14/170 (8%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQL  433
            G     P R    GLVYD+   DY  FLC+L Y++  I A+ ++    CA+ K  +   L
Sbjct  214  GAGHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTYSVGAL  273

Query  432  NYPSFSVLF--------GKSRIVRQTRELTNVGAAGTL-YEVAIEAPPSVTVTVKPTKLV  280
            NYPSFSV +        G S  V  TR LTNVG AGT     ++ A   V V V+P +L 
Sbjct  274  NYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELE  333

Query  279  FKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  133
            F +VG++  YTV F SK     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  334  FTSVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  380



>gb|AFB32958.1| hypothetical protein 0_744_01, partial [Pinus mugo]
 gb|AFG70680.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70681.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70682.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70683.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70684.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70685.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70686.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70687.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70688.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70689.1| hypothetical protein 0_744_01, partial [Pinus taeda]
 gb|AFG70690.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score =   114 bits (284),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 81/133 (61%), Gaps = 4/133 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSFSV+F    +
Sbjct  10   GLIYDLGMDDYVSFLCSLNYTAKQIHILTRNAT-SCPKLSSAPGDLNYPSFSVVFKPRSL  68

Query  390  VRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVT  214
            VR T R +TNVG A  +YE+A+E+P +V +TV+PT L F+   D+  YTV F SK     
Sbjct  69   VRVTKRTVTNVGGAPCVYEMAVESPENVNITVEPTTLAFEKQNDKATYTVKFESKIAADN  128

Query  213  PSNA--AFGSVSW  181
             S    AFG + W
Sbjct  129  KSKGGQAFGQILW  141



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 98/167 (59%), Gaps = 7/167 (4%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK--APNITCAKK-LSN  445
            + G     P R    GLVYDI   DY  F+CS+ Y  +QI   ++  A +  CA+  L++
Sbjct  602  VHGAGHVDPNRALNPGLVYDIDVNDYVAFMCSIGYGPRQIAVFMRELAGDDICARNSLAS  661

Query  444  PAQLNYPSFSVLFGKSR-IVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKN  271
            P  LNYPSF+V+F   R +V+  R +TNVG+    +YEV ++AP  V ++V+P+KLVF  
Sbjct  662  PGDLNYPSFAVVFKPGRELVKYKRVVTNVGSVVDAVYEVNVDAPAGVEISVEPSKLVFSE  721

Query  270  VGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
            V     Y VTF   KG+   +   +GS+ W++ ++ VRSP+A  W+ 
Sbjct  722  VNQTQSYEVTFA--KGIGYVNGERYGSIEWSDGRHHVRSPVAVRWSN  766



>gb|AFG70679.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 80/133 (60%), Gaps = 4/133 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSFSV+F    +
Sbjct  10   GLIYDLGMDDYVSFLCSLNYTAKQIHILTRNAT-SCPKLSSAPGDLNYPSFSVVFKPRSL  68

Query  390  VRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVT  214
            VR T R +TNVG A  +YE A+E+P +V +TV+PT L F+   D+  YTV F SK     
Sbjct  69   VRVTKRTVTNVGGAPCVYETAVESPENVNITVEPTTLAFEKQNDKATYTVKFESKIAADN  128

Query  213  PSNA--AFGSVSW  181
             S    AFG + W
Sbjct  129  KSKGGQAFGQILW  141



>ref|XP_010919194.1| PREDICTED: subtilisin-like protease isoform X1 [Elaeis guineensis]
Length=774

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 93/163 (57%), Gaps = 10/163 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPAQ  436
            G     P R S  GLVYDI+P DY  +LCSL+YT+ Q+  + +  N +C   + L N   
Sbjct  616  GSGHVDPERASNPGLVYDISPKDYLDYLCSLNYTSAQLATLARK-NYSCPNNRILGNIRD  674

Query  435  LNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYPSFSVLF +      V QTR +TNVG A   Y V +  P  VT+ V P +L F  +G
Sbjct  675  LNYPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGVTMNVDPKELDFVELG  734

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             +L Y V+F+  +G    ++ +FG + W   +  VRSP+A +W
Sbjct  735  QKLSYKVSFLGLRG----TDTSFGELVWVCGEYSVRSPVAVTW  773



>ref|XP_010919195.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
Length=767

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 93/163 (57%), Gaps = 10/163 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPAQ  436
            G     P R S  GLVYDI+P DY  +LCSL+YT+ Q+  + +  N +C   + L N   
Sbjct  609  GSGHVDPERASNPGLVYDISPKDYLDYLCSLNYTSAQLATLARK-NYSCPNNRILGNIRD  667

Query  435  LNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYPSFSVLF +      V QTR +TNVG A   Y V +  P  VT+ V P +L F  +G
Sbjct  668  LNYPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGVTMNVDPKELDFVELG  727

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             +L Y V+F+  +G    ++ +FG + W   +  VRSP+A +W
Sbjct  728  QKLSYKVSFLGLRG----TDTSFGELVWVCGEYSVRSPVAVTW  766



>ref|XP_007220042.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
 gb|EMJ21241.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
Length=765

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 93/162 (57%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P   +  GLVYDI   DY  +LCSL Y + QI       N TC K  +  P  L
Sbjct  604  GSGHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFTCPKNAVLQPGDL  663

Query  432  NYPSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSFSVLF K   +  V   R + NVG   + Y V ++ P  V+VTV+P  L FK +G+
Sbjct  664  NYPSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAVQVKEPTGVSVTVEPRSLRFKKMGE  723

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y V+FV+  G  T +N++FG+++W + + +V SPIA +W
Sbjct  724  KLSYKVSFVALGG-PTLTNSSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 97/162 (60%), Gaps = 8/162 (5%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN-ITCA-KKLSNPAQ  436
            G     P +    GLVYD+  +DY  FLC+  YT   I+ I KAP  I CA +KLS+P  
Sbjct  603  GSGHIDPNKAVDPGLVYDLQVSDYIAFLCTAGYTKNMIRVIFKAPAVIDCASQKLSSPGN  662

Query  435  LNYPSFSVLF-GKSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYPSFSV+F G +  V+ TR + NVG++   +Y+V ++AP +V ++V P+ L F +   
Sbjct  663  LNYPSFSVVFRGATNKVKYTRVVKNVGSSKNAVYKVNVKAPLNVQISVAPSTLTFTSTVQ  722

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             L Y +TF S     +   ++FGS+ W++  + VRSPIA  W
Sbjct  723  TLSYDITFTS----TSRGASSFGSIEWSDGNHHVRSPIAIQW  760



>ref|XP_004229864.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326049.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326050.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=764

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 99/162 (61%), Gaps = 6/162 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P R S  GL+YDI+  DY  ++CSL+Y + QI  +++  N TC +    +   L
Sbjct  604  GSGHVDPERASDPGLIYDISTEDYLHYICSLNYNSSQIALLLR-ENYTCPSHSFQSLGNL  662

Query  432  NYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSFSVLF   ++ + QT  R +TNVG   + Y V ++ P  V+VTVKP  L F   G 
Sbjct  663  NYPSFSVLFDSNNQHLIQTFKRTVTNVGTPRSTYIVQVKTPYGVSVTVKPKILKFHKKGQ  722

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +LRY V FV+ KG  +P+++ FGS++W +  + VRSPIA +W
Sbjct  723  KLRYKVRFVT-KGKRSPADSTFGSLTWISRTHIVRSPIAVTW  763



>gb|AFB32953.1| hypothetical protein 0_744_01, partial [Abies alba]
 gb|AFB32954.1| hypothetical protein 0_744_01, partial [Abies alba]
Length=152

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GLVYD    +Y  FLCSL+YTT+QI  + +  + +C K    P  LNYPSFSV+F +  +
Sbjct  10   GLVYDAGMQEYVRFLCSLNYTTKQIHLLTRKAS-SCPKLPGQPGDLNYPSFSVVFKQRDL  68

Query  390  VRQTRE-LTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSK--KGV  220
            VR TR  +TNVGA  ++YE+A+E+P +V + V+P+KL FK   ++  + V F SK     
Sbjct  69   VRVTRRTVTNVGAVPSVYEMAVESPANVNIIVEPSKLAFKKQNEKASFKVRFESKVASDF  128

Query  219  VTPSNAAFGSVSW  181
             +  N  FG +SW
Sbjct  129  KSSGNKEFGQISW  141



>gb|AFG70691.1| hypothetical protein 0_744_01, partial [Pinus taeda]
Length=152

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 80/133 (60%), Gaps = 4/133 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSFSV+F    +
Sbjct  10   GLIYDLGMDDYVSFLCSLNYTAKQIHILTRNA-TSCPKLSSAPGDLNYPSFSVVFKPRSL  68

Query  390  VRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVT  214
            VR T R +TNVG A  +YE+A+E P +V +TV+PT L F+   D+  YTV F SK     
Sbjct  69   VRVTKRTVTNVGGAPCVYEMAVENPENVNITVEPTTLAFEKQNDKATYTVKFESKIAADN  128

Query  213  PSNA--AFGSVSW  181
             S    AFG + W
Sbjct  129  KSKGGQAFGQILW  141



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 90/160 (56%), Gaps = 3/160 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P R    GLVYDI P DY  +LC+L Y + +I       ++ C     +    L
Sbjct  599  GSGHVDPNRALDPGLVYDIKPEDYVAYLCALGYDSVRIAVFTGGKSVDCRVVGFAKSGDL  658

Query  432  NYPSFSVLFGKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            NYPSFS++FG  + V + +R +TNVG A + Y  +I  P SV + V P KLVF      L
Sbjct  659  NYPSFSMVFGPGKTVAKFSRTVTNVGDARSAYAASINGPDSVRIRVDPEKLVFCAQNQSL  718

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             Y+VTF   +G  +P +  FG ++W++ ++ V+SPIAFSW
Sbjct  719  SYSVTFEYVEG-YSPLDTCFGLLTWSDGRHDVKSPIAFSW  757



>ref|XP_008780373.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=765

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 90/163 (55%), Gaps = 10/163 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK--LSNPAQ  436
            G     P R S  GLVYDI+P DY  +LCSL+YT+ Q+  + +  N  C K   L N   
Sbjct  607  GSGHVNPERASNPGLVYDISPKDYLDYLCSLNYTSPQLATLARK-NYRCPKNRILRNIRD  665

Query  435  LNYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYPSFSVLF        V Q R +TNVG A   Y V +  P  VT+ V P +L F  +G
Sbjct  666  LNYPSFSVLFESGSPYSTVTQPRTVTNVGQARCRYTVKVREPKGVTINVDPKELAFVEMG  725

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             +L Y V+F+   G    SN++FG + W   +  VRSP+A +W
Sbjct  726  QKLSYKVSFLGLSG----SNSSFGELVWVCGEFSVRSPVAVTW  764



>gb|KDP25551.1| hypothetical protein JCGZ_20707 [Jatropha curcas]
Length=757

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 98/169 (58%), Gaps = 5/169 (3%)
 Frame = -3

Query  645  LEETNFPTRGLT-GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI  469
            ++E + P    T G     P+R +  GL+YDI P DY  +LC L Y  +Q+ +I+    I
Sbjct  588  VDEKHQPADLFTIGAGHVNPSRANDPGLIYDIQPDDYIPYLCGLGYKEEQV-SIIAHRRI  646

Query  468  TCAKKLSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  292
             C++KLS P  QLNYPSFSV  G S+    TR +TNVG A ++Y   I  PP V VTV+P
Sbjct  647  KCSEKLSIPEGQLNYPSFSVTLGASQTF--TRTVTNVGEANSVYAATIVPPPGVAVTVEP  704

Query  291  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
             +L F  V  ++ Y+VTF         S  A G + W++A++ VRSPI+
Sbjct  705  YRLYFSQVNQKVTYSVTFSPTGSSGKTSEFAQGYILWSSAKHLVRSPIS  753



>ref|XP_006490976.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO85943.1| hypothetical protein CISIN_1g004242mg [Citrus sinensis]
Length=766

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 8/162 (5%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS-NPAQL  433
            G     P   S  GL+YDIA  DY  +LCSL+YT+ Q+ A+    N TC    + +P +L
Sbjct  608  GSGHVDPESASDPGLIYDIATEDYLDYLCSLNYTSLQL-ALFAGGNFTCPNPSAFHPGKL  666

Query  432  NYPSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+V F    K+  +   R +TNVG +   Y V +E P  V VT+ P  L F+ +G+
Sbjct  667  NYPSFAVNFKGNVKNMSLEYERSVTNVGTSYCTYAVKVEEPNGVLVTITPPILSFQKIGE  726

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             L Y VTFVS +G    SN +FGS++W + +  V+SPIA +W
Sbjct  727  ILSYKVTFVSLRGA---SNESFGSLTWVSGKYAVKSPIAVTW  765



>gb|AFB32957.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 81/133 (61%), Gaps = 4/133 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSFSV+F    +
Sbjct  10   GLIYDLGMDDYVSFLCSLNYTAKQIHILTRNAT-SCPKLSSAPGDLNYPSFSVVFKPRSL  68

Query  390  VRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVT  214
            VR T R +TNVG A  +YE+A+++P +V +TV+PT L F+   D+  YTV F SK     
Sbjct  69   VRVTKRTVTNVGGAPCVYEMAVQSPENVNITVEPTTLAFEKQNDKATYTVKFESKIAADN  128

Query  213  PSNA--AFGSVSW  181
             S    AFG + W
Sbjct  129  KSKGGQAFGQILW  141



>ref|XP_009411443.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=765

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 86/162 (53%), Gaps = 9/162 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQL  433
            G     P + S  GL+YDIAP DY  +LCSL YT QQ+ A        C K K+     L
Sbjct  608  GSGHVDPEKASKPGLIYDIAPDDYLNYLCSLKYTPQQL-ATFAGKKYNCPKNKIIRARDL  666

Query  432  NYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSFSVLF   R    +  TR +TNVG A   Y V +  P  V +TVKP  L F  VG 
Sbjct  667  NYPSFSVLFDSGRKKATLTHTRTVTNVGQAPCGYTVNVREPQGVRITVKPKVLTFNKVGQ  726

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            ++RY VTF +  G      +AFG ++W      +RSP+  +W
Sbjct  727  KMRYMVTFSTVGG----HGSAFGELAWVGDDATIRSPVTVTW  764



>emb|CBI34784.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 91/157 (58%), Gaps = 4/157 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GL+YDI P DY  +LC L Y   Q++AI++   + C+K+ S P AQL
Sbjct  212  GAGHVNPSRANDPGLIYDIQPNDYIPYLCGLGYNDTQVRAIIRH-KVQCSKESSIPEAQL  270

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFSV  G S +  Q R +TNVG A   Y V I AP  V V+VKP KL F     +  
Sbjct  271  NYPSFSVAMGSSALKLQ-RTVTNVGEAKASYIVKISAPQGVDVSVKPRKLDFTQTNQKKT  329

Query  252  YTVTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSPIA  145
            YTVTF  K    T S   A G + W +A++ VRSPI+
Sbjct  330  YTVTFERKDDGKTGSKPFAQGFLEWVSAKHSVRSPIS  366



>gb|EAY90937.1| hypothetical protein OsI_12551 [Oryza sativa Indica Group]
Length=470

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 94/160 (59%), Gaps = 18/160 (11%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNYPSFSVLF----  406
            GLVYD+   DY  FLC+L+YT+  I A+ ++ +  C + K  +   LNYPSF+V +    
Sbjct  315  GLVYDLGTADYVDFLCALNYTSTMIAAVARSKSYGCTEGKAYSVYNLNYPSFAVAYSTAS  374

Query  405  --------GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
                      +  V   R LTNVGAAGT Y+V+  A P V V V+PT+L F + G++  Y
Sbjct  375  SQAAEGSGAAATTVTHKRTLTNVGAAGT-YKVSAAAMPGVAVAVEPTELAFTSAGEKKSY  433

Query  249  TVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  133
            TV+F +K     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  434  TVSFTAKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  470



>emb|CDP09846.1| unnamed protein product [Coffea canephora]
Length=729

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 97/166 (58%), Gaps = 6/166 (4%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
            TG     P + +  GL+YDI P DY  +LC L+YT +++  +V+   + C  + S P AQ
Sbjct  567  TGSGHVNPAKANNPGLIYDIEPKDYIPYLCGLNYTNREVSHLVQR-KVNCTAESSIPEAQ  625

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSFS++FG S I + TR +TNVG A ++Y V +  P  V VTVKP  L F  V  +L
Sbjct  626  LNYPSFSIVFGSS-IQKYTRTVTNVGEAKSVYTVKVAPPAGVNVTVKPNTLSFSEVNQKL  684

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA--FSWTQLF  124
             Y VTF S       +  + GS++W +A+  VRSPI   F  TQ F
Sbjct  685  TYEVTF-SLLASSANNTVSQGSLAWTSAKYSVRSPIVALFGATQRF  729



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 92/162 (57%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P   +  GLVYDI   DY  +LCSL Y + QI       N TC K  +  P  L
Sbjct  604  GSGHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFTCPKNAVLQPGDL  663

Query  432  NYPSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSFSVLF K   +  V   R + NVG   + Y V ++ P  V+VTV+P  L FK +G+
Sbjct  664  NYPSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAVQVKEPTGVSVTVEPRSLGFKKMGE  723

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +L Y V+FV+  G    +N++FG+++W + + +V SPIA +W
Sbjct  724  KLSYKVSFVALGGPAL-TNSSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_003625390.1| Subtilisin-like protease [Medicago truncatula]
Length=932

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 97/169 (57%), Gaps = 12/169 (7%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPA  439
            TG     P R    GL+YDI P DY   LCS+ YT  +I +I    NI+C    +++   
Sbjct  596  TGAGNVNPQRALNPGLIYDIKPDDYVNHLCSIGYTKSEIFSITHK-NISCHTIMRMNRGF  654

Query  438  QLNYPSFSVLFGKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
             LNYPS SV+F K  I R+  +R +TNVG   ++Y V + AP  V V VKP KL+FK + 
Sbjct  655  SLNYPSISVIF-KDGIRRKMFSRRVTNVGNPNSIYSVEVVAPQGVKVIVKPKKLIFKKIN  713

Query  264  DRLRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAFSW  136
              L Y V F+S+K V   S   N A G ++W N+QN   +VRSPIA SW
Sbjct  714  QSLSYRVYFISRKRVKKGSDTMNFAEGHLTWINSQNGSYRVRSPIAVSW  762



>gb|AFB32959.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 80/133 (60%), Gaps = 4/133 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSFSV+F    +
Sbjct  10   GLIYDLGMDDYVSFLCSLNYTAKQIHILTRNAT-SCPKLSSAPGDLNYPSFSVVFKPRSL  68

Query  390  VRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVT  214
            VR T R +TNVG A  +YE+ +E+P +V +TV+PT L F+   D+  YTV F SK     
Sbjct  69   VRVTKRTVTNVGGAPCVYEMTVESPENVNITVEPTTLAFEKQNDKATYTVKFESKIAADN  128

Query  213  PSNA--AFGSVSW  181
             S    AFG + W
Sbjct  129  KSKGGQAFGQILW  141



>ref|XP_006358406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=742

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GL+YD    DY  +LC L+YT QQ+ +IVK   + C K    P AQL
Sbjct  581  GAGHVNPSRANDPGLIYDTPVKDYLPYLCGLNYTNQQVGSIVKH-KVDCNKVKHIPEAQL  639

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS+ FG+S     TR +TN+G A + Y V I++PP VTV VKP+ L F  +  +L+
Sbjct  640  NYPSFSIKFGESSQTY-TRTVTNIGEANSSYSVEIDSPPGVTVIVKPSTLKFSQLNQKLK  698

Query  252  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y VTF +++   T S  A G + W+  +  VRSPIA
Sbjct  699  YQVTF-TRRDNSTNSGIAQGFLKWSWKKYSVRSPIA  733



>ref|XP_006339499.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 99/162 (61%), Gaps = 6/162 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P R S  GL+YDI+  DY  ++CSL+Y + QI  +++  N TC +    +   L
Sbjct  605  GSGHVDPERASDPGLIYDISTEDYLHYICSLNYNSSQIALLLRE-NYTCPSHSFQSLGDL  663

Query  432  NYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLF   ++ + QT  R +TNVG   + Y V ++ P  V+VTVKP  L F+  G 
Sbjct  664  NYPSFAVLFDSNNQHLIQTFKRTVTNVGTPRSTYSVQVKTPYGVSVTVKPKILKFQKKGQ  723

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +LRY V FV+ +G  +P ++ FGS++W +  + VRSPIA +W
Sbjct  724  KLRYKVRFVT-RGKRSPGDSTFGSLTWISRTHIVRSPIAVTW  764



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 98/178 (55%), Gaps = 10/178 (6%)
 Frame = -3

Query  651  GTLEETNFPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-  475
            GT EE+   T  + G     P R    GLVYD+   DY  FLCS+ Y+ +QI   V  P 
Sbjct  630  GTGEES---TPFVHGAGHVDPNRALNPGLVYDLNVNDYVAFLCSIGYSPRQIAVFVGKPT  686

Query  474  --NITCAKKLSNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVT  307
              +I     L++P  LNYPSFSV+    + +V+  R  TNVGA A  +YEV + AP  V 
Sbjct  687  GSDICTRNSLASPGDLNYPSFSVVLSSDQGLVKYKRIATNVGADADAVYEVTVNAPAGVE  746

Query  306  VTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            ++V+P KLVF        Y VTF  K+GV   S   +GS+ W + ++ VRSP+A  W+
Sbjct  747  ISVEPRKLVFSAENQTQSYEVTF--KRGVGYDSGERYGSIEWTDGRHLVRSPVAVRWS  802



>ref|XP_006445191.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
 gb|ESR58431.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
Length=1364

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 99/176 (56%), Gaps = 8/176 (5%)
 Frame = -3

Query  651   GTLEETNFPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN  472
             G   +T   T    G     P   S  GL+YDIA  DY  +LCSL+YT+ Q+ A+    N
Sbjct  1192  GGSSDTPLATAFAFGSGHVDPESASDPGLIYDIATEDYLDYLCSLNYTSLQL-ALFAGGN  1250

Query  471   ITCAKKLS-NPAQLNYPSFSVLFG---KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTV  304
              TC    + +P +LNYPSF+V F    K+  +   R +TNVG +   Y V +E P  V V
Sbjct  1251  FTCPNPSAFHPGKLNYPSFAVNFKGNVKNMSLEYERSVTNVGTSYCTYAVKVEEPNGVLV  1310

Query  303   TVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             T+ P  L F+ +G+ L Y VTFVS +G    SN +FGS++W + +  V+SPIA +W
Sbjct  1311  TITPPILSFQKIGEILSYKVTFVSLRGA---SNESFGSLTWVSGKYAVKSPIAVTW  1363


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 70/161 (43%), Gaps = 8/161 (5%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPA--Q  436
            G     P +    GLVYD+    Y  FLC   Y    +  +V + +I C   +       
Sbjct  486  GAGQVNPQKAVSPGLVYDMDDMSYIQFLCHEGYNGSSLAVLVGSKSINCTSLIPGVGYDA  545

Query  435  LNYPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYP+  V     G+       R +TNVG   ++Y   I+AP  V +TVKP  L F    
Sbjct  546  LNYPTMQVSLKSNGELTTAIFRRRVTNVGPRLSIYNATIKAPKGVNITVKPMSLSFSRTS  605

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  142
             +  ++V  V K   ++ +    GS+ W + +  V S + F
Sbjct  606  HKRSFSV--VVKAKPMSSTQVLSGSLEWKSPR-HVPSDVCF  643



>ref|XP_002303551.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
 gb|EEE78530.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
Length=764

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 90/157 (57%), Gaps = 4/157 (3%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
            TG     P+R +  GLVYDI P DY  +LC L Y   ++  IV    + C++K S P  +
Sbjct  600  TGAGHVNPSRANNPGLVYDIQPDDYIPYLCGLGYADNEVSIIVHE-QVKCSEKPSIPEGE  658

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSF+V  G S+    TR +TNVG   + YEVAI +PP V VTVKP+KL F  V  + 
Sbjct  659  LNYPSFAVTLGPSQTF--TRTVTNVGDVNSAYEVAIVSPPGVDVTVKPSKLYFSKVNQKA  716

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
             Y+V F   +     S  A G + W +A+  VRSPIA
Sbjct  717  TYSVAFSRTEYGGKTSETAQGYIVWASAKYTVRSPIA  753



>ref|XP_007162604.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
 gb|ESW34598.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
Length=1214

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 102/171 (60%), Gaps = 18/171 (11%)
 Frame = -3

Query  609   GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC--AKKLSNPAQ  436
             G     P R    GLVYDI P DY + LCSL YT  +I +I    N++C    K++    
Sbjct  1046  GAGHVNPQRALNPGLVYDIRPDDYIIHLCSLGYTRSEIFSITHR-NVSCNAVMKMNRGFS  1104

Query  435   LNYPSFSVLF--GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
             LNYPSFSV+F  G+ R + + R LTNVG+A ++Y V + AP  V V VKP +LVFK V  
Sbjct  1105  LNYPSFSVIFKDGERRKMFR-RRLTNVGSANSIYSVEVMAPEGVKVIVKPKRLVFKQVNQ  1163

Query  261   RLRYTVTFVSKK------GVVTPSNAAFGSVSWNNAQ---NQVRSPIAFSW  136
              L Y V F+S+K      G+VT    A G+++W ++Q   N+VRSP+A +W
Sbjct  1164  SLTYRVWFISRKRVKRGDGLVT---YAEGNLTWVHSQNGFNRVRSPVAVTW  1211



>gb|ACN27710.1| unknown [Zea mays]
Length=701

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 93/170 (55%), Gaps = 14/170 (8%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQL  433
            G     P R    GLVYD+   DY  FLC+L Y++  I A+ ++    CA+ K  +   L
Sbjct  535  GAGHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTYSVGAL  594

Query  432  NYPSFSVLF--------GKSRIVRQTRELTNVGAAGTL-YEVAIEAPPSVTVTVKPTKLV  280
            NYPSFSV +        G S  V  TR LTNVG AGT     ++ A   V V V+P +L 
Sbjct  595  NYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELE  654

Query  279  FKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  133
            F +VG++  YTV F SK     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  655  FTSVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  701



>tpg|DAA50265.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 93/170 (55%), Gaps = 14/170 (8%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQL  433
            G     P R    GLVYD+   DY  FLC+L Y++  I A+ ++    CA+ K  +   L
Sbjct  598  GAGHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTYSVGAL  657

Query  432  NYPSFSVLF--------GKSRIVRQTRELTNVGAAGTL-YEVAIEAPPSVTVTVKPTKLV  280
            NYPSFSV +        G S  V  TR LTNVG AGT     ++ A   V V V+P +L 
Sbjct  658  NYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELE  717

Query  279  FKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  133
            F +VG++  YTV F SK     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  718  FTSVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  764



>emb|CDP10007.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 96/167 (57%), Gaps = 5/167 (3%)
 Frame = -3

Query  642  EETNFPTRGLT-GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT  466
            +E + P    T G     P R +  GL+YDI P DY  +LC L+Y+ +++  I++     
Sbjct  573  DEKHLPADLFTMGSGHVNPARANNPGLIYDIEPKDYIPYLCGLNYSDREVGRILQRKANC  632

Query  465  CAKKLSNPAQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTK  286
             A+   +  QLNYPSFS++ G S I + TR +TNVG A ++Y V I+ P  V VTVKP  
Sbjct  633  KAESRISETQLNYPSFSIVVG-STIQKYTRTVTNVGDANSIYRVKIDQPGGVNVTVKPRI  691

Query  285  LVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            L F  V  +L Y +TF       TPS+   GS++W +A+  VRSPIA
Sbjct  692  LSFSKVNQKLSYDITFTPLSPYETPSD---GSLTWTSAKYSVRSPIA  735



>ref|NP_001151549.1| subtilisin-like protease precursor [Zea mays]
 gb|ACG43281.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 93/170 (55%), Gaps = 14/170 (8%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQL  433
            G     P R    GLVYD+   DY  FLC+L Y++  I A+ ++    CA+ K  +   L
Sbjct  598  GAGHVDPARALDPGLVYDLGTRDYVDFLCALKYSSTMIAAVARSREYACAENKTYSVGAL  657

Query  432  NYPSFSVLF--------GKSRIVRQTRELTNVGAAGTL-YEVAIEAPPSVTVTVKPTKLV  280
            NYPSFSV +        G S  V  TR LTNVG AGT     ++ A   V V V+P +L 
Sbjct  658  NYPSFSVAYSTANGDGGGDSATVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELE  717

Query  279  FKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  133
            F +VG++  YTV F SK     PS  A FG + W++ ++ V SPIAF+WT
Sbjct  718  FTSVGEKKSYTVRFTSKS---QPSGTAGFGRLVWSDGKHSVASPIAFTWT  764



>ref|XP_006358407.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=743

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GL+YD    DY  +LC L+YT QQ+ +IVK   + C K    P AQL
Sbjct  582  GAGHVNPSRANDPGLIYDTPFDDYLPYLCGLNYTNQQVGSIVKH-KVDCKKVKHIPEAQL  640

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS+ FG+S     TR +TNVG A + Y V I++PP VTV VKP+ L F  +  +L+
Sbjct  641  NYPSFSIEFGESSQTY-TRTVTNVGEAKSSYTVEIDSPPGVTVIVKPSTLKFSQLNQKLK  699

Query  252  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y V F +++   T S  A G + W++ +  VRSPIA
Sbjct  700  YQVMF-TRRDNSTNSGIAQGFLKWSSKKYSVRSPIA  734



>ref|XP_009762584.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
 ref|XP_009762585.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
Length=767

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 98/162 (60%), Gaps = 6/162 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P + S  GL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  L +P  L
Sbjct  607  GSGHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLR-KNYTCPSHVLKSPGDL  665

Query  432  NYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLF  KSR + QT  R +TNVG   + Y V +  P  V+VTVKP  L F+  G 
Sbjct  666  NYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVNTPSGVSVTVKPKILKFQKKGQ  725

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +LRY +  V+ +G  +  ++ FGS+ W +  + VRSPIA +W
Sbjct  726  KLRYKMRVVA-RGKRSAGDSTFGSLVWFSRTHIVRSPIAITW  766



>ref|XP_009762581.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009762582.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
 ref|XP_009762583.1| PREDICTED: subtilisin-like protease isoform X3 [Nicotiana sylvestris]
Length=769

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 98/162 (60%), Gaps = 6/162 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P + S  GL+YDI+  DY  ++CSL+Y + QI  +++  N TC +  L +P  L
Sbjct  609  GSGHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLR-KNYTCPSHVLKSPGDL  667

Query  432  NYPSFSVLF-GKSRIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSF+VLF  KSR + QT  R +TNVG   + Y V +  P  V+VTVKP  L F+  G 
Sbjct  668  NYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVNTPSGVSVTVKPKILKFQKKGQ  727

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            +LRY +  V+ +G  +  ++ FGS+ W +  + VRSPIA +W
Sbjct  728  KLRYKMRVVA-RGKRSAGDSTFGSLVWFSRTHIVRSPIAITW  768



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 96/175 (55%), Gaps = 18/175 (10%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN--ITC-AKKLSN  445
            + G     P R    GLVYDI+  DY  FLCS+ Y  + I   ++  N  + C A+ L +
Sbjct  604  VHGAGHVDPNRALDPGLVYDISVNDYVEFLCSIGYDEKMIALFIRDGNTSVNCSAQSLPS  663

Query  444  PAQLNYPSFSVLF---GKSRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVF  277
            P  LNYPSFSV+F   G   +V+  R +TNVG +   +YE  +  P SV ++V P+KLVF
Sbjct  664  PGDLNYPSFSVVFKLNGGKDVVKYRRVVTNVGDSVDAVYEAKVWGPDSVEISVSPSKLVF  723

Query  276  KNVGDRLRYTVTFVSKKGVVTP--------SNAAFGSVSWNNAQNQVRSPIAFSW  136
                +R  Y +TF   K VV P        S + FG + W++  ++VRSPIAF W
Sbjct  724  SGEEERQSYEITF---KSVVPPNETEERTASASKFGWIEWSDGSHRVRSPIAFWW  775



>gb|EYU28633.1| hypothetical protein MIMGU_mgv1a023843mg [Erythranthe guttata]
Length=720

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 95/157 (61%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R    GLVYDI P DY  ++C L+YT QQ+  IV   N+ C+K+ S P AQL
Sbjct  563  GSGHVNPSRADDPGLVYDILPDDYVPYVCGLNYTNQQVGIIV-GRNVDCSKEKSIPEAQL  621

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG   + Y+V I +P +V V V+P KLVF  +GD+  
Sbjct  622  NYPSFSIIFG-STTQTYTRTLTNVGKPDSSYDVEIVSPDNVIVKVEPKKLVFPKLGDKSS  680

Query  252  YTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y VTF  + K V+  +   F  + W +A   VRSPIA
Sbjct  681  YNVTFTRTTKEVMNSTTQGF--IRWYSADYSVRSPIA  715



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 93/174 (53%), Gaps = 8/174 (5%)
 Frame = -3

Query  636  TNFPTRGLT-GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA  460
            T  P   L  G     P      GLVYD+   DY  FLCSL+YT + IQ + K    +C 
Sbjct  597  TALPADALAMGAGHVNPNAALDPGLVYDLGIDDYVSFLCSLNYTAKHIQILTKNAT-SCP  655

Query  459  KKLSNPAQLNYPSFSVLFGKSRIVRQTRE-LTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  283
            K  S P  LNYPSFSV+F    +VR TR  +TNVG A ++YE+A+E+P +V V V+P  L
Sbjct  656  KLRSRPGDLNYPSFSVVFKPRSLVRVTRRTVTNVGGAPSVYEMAVESPENVNVIVEPRTL  715

Query  282  VFKNVGDRLRYTVTFVSKKGVVTPS--NAAFGSVSWNNAQNQ---VRSPIAFSW  136
             F    ++  YTV F SK      S  +  FG + W   +     VRSP+A +W
Sbjct  716  AFTKQNEKATYTVRFESKIASDNKSKRHRGFGQILWKCVKGGTQVVRSPVAIAW  769



>gb|AFB32956.1| hypothetical protein 0_744_01, partial [Pinus mugo]
Length=152

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 79/133 (59%), Gaps = 4/133 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSFSV+F    +
Sbjct  10   GLIYDLGMDDYVSFLCSLNYTAKQIHILTRNAT-SCPKLRSAPGDLNYPSFSVVFKPRSL  68

Query  390  VRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVT  214
            VR T R +TNVG A  +YE+ +E+P +V +TV+P  L F+   D+  YTV F SK     
Sbjct  69   VRVTKRTVTNVGGAPCVYEMTVESPENVNITVEPMTLAFEKQNDKATYTVKFESKIAADN  128

Query  213  PSNA--AFGSVSW  181
             S    AFG + W
Sbjct  129  KSKGGQAFGQILW  141



>ref|XP_004493834.1| PREDICTED: subtilisin-like protease SDD1-like [Cicer arietinum]
Length=763

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 95/166 (57%), Gaps = 10/166 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK--KLSNPAQ  436
            G     P R    GLVYDI P DY   LCS+ YT  +I +I    N++C    +++    
Sbjct  597  GAGNVNPQRALNPGLVYDIRPDDYVNHLCSIGYTRSEIFSITHR-NVSCHAMMQMNRGFS  655

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPS SV+F K  + R+ R ++NVG   ++Y V + AP  V V VKP +LVFK +   L
Sbjct  656  LNYPSISVIF-KDGMTRKIRRVSNVGGPNSIYSVEVVAPQGVKVIVKPKRLVFKQINQSL  714

Query  255  RYTVTFVSKKGVVTPSNA---AFGSVSWNNAQN---QVRSPIAFSW  136
             Y V F+S+KG    ++    A G ++W ++QN   +VRSPIA SW
Sbjct  715  SYRVWFISRKGAKRGADTMDFAEGHLTWVHSQNGSYRVRSPIAVSW  760



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   110 bits (275),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 61/152 (40%), Positives = 92/152 (61%), Gaps = 5/152 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKLSNPAQLNYPSFSVLF-GK  400
            GLVYD+  +DY  FLC++ Y +++I   V+ P  +  C+ K+ +P  LNYPSFSV+F   
Sbjct  616  GLVYDMDTSDYIAFLCAIGYDSKRIAVFVREPPSSDICSGKVGSPGNLNYPSFSVVFQSN  675

Query  399  SRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKG  223
            S +V   R + +VG +   +YEV + AP +V + V P++LVF      + Y +TF S   
Sbjct  676  SDVVTYRRTVKSVGNSPDAVYEVEVNAPANVDIKVSPSRLVFNAENKTVSYEITFSSVSS  735

Query  222  VVTPSNAA-FGSVSWNNAQNQVRSPIAFSWTQ  130
              +  N+A FGS+ W+N  ++VRSPIA  W Q
Sbjct  736  GWSSINSATFGSIEWSNGIHRVRSPIAVKWRQ  767


 Score = 35.8 bits (81),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            +D    E S P+ HG+GHVDP+ AL PG
Sbjct  589  KDLASSEESTPFIHGAGHVDPNSALDPG  616



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score =   109 bits (272),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 63/152 (41%), Positives = 90/152 (59%), Gaps = 5/152 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKLSNPAQLNYPSFSVLF-GK  400
            GLVYD+  +DY  FLC++ Y +++I   V+ P  +  C+ K  +P  LNYPSFSV+F   
Sbjct  616  GLVYDMDTSDYIAFLCAIGYDSKRIAVFVREPPSSDICSGKEGSPGNLNYPSFSVVFQSN  675

Query  399  SRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKG  223
            S  V   R + NVG +   +YEV + AP +V + V P+KLVF      + Y +TF S   
Sbjct  676  SDEVTYRRTVKNVGNSLDAVYEVEVNAPANVDIKVSPSKLVFNAENKTVSYDITFSSVSS  735

Query  222  VVTPSNAA-FGSVSWNNAQNQVRSPIAFSWTQ  130
              +  N+A FGS+ W+N  ++VRSPIA  W Q
Sbjct  736  GWSSINSATFGSIEWSNGIHRVRSPIAVKWRQ  767


 Score = 36.2 bits (82),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            +D    E S P+ HG+GHVDP+ AL+PG
Sbjct  589  KDLASSEESTPFIHGAGHVDPNSALNPG  616



>ref|XP_002509668.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51055.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=758

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 97/159 (61%), Gaps = 8/159 (5%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
            TG     P++ S  GLVYDI P DY  +LC L YT + I  IV+   + C++  S P AQ
Sbjct  598  TGAGHVNPSKASDPGLVYDIQPDDYIPYLCGLGYTDRDITYIVQY-KVKCSEVGSIPEAQ  656

Query  435  LNYPSFSVLFG-KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            LNYPSFS++FG K++I   TR +TNVG A + Y V++  PP V VTV P+K+ F  V   
Sbjct  657  LNYPSFSIVFGAKTQIY--TRTVTNVGPATSSYTVSVAPPPGVDVTVTPSKIAFTQVKQT  714

Query  258  LRYTVTFV-SKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
              Y+VTF  + KG   PS    G + W++ Q+ VRSPI+
Sbjct  715  ATYSVTFTNTGKGYSDPS--VQGYLKWDSDQHSVRSPIS  751



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 96/169 (57%), Gaps = 9/169 (5%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP--NITCAKKLSNP  442
            + G     P R    GLVYDI  ++Y  FLCS+ Y  ++I   V+ P  +  C + L+ P
Sbjct  432  IHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPVSSDICTRALATP  491

Query  441  AQLNYPSFSVLFGKSR-IVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNV  268
              LNYPSFSV+F  +  +V+  R + NVG++   +YEV + APP+V V V P+KL F   
Sbjct  492  GNLNYPSFSVVFNSNNDVVKYKRVVKNVGSSVDAVYEVKVNAPPNVAVNVWPSKLAFSAE  551

Query  267  GDRLRYTVTF--VSKKGV-VTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
               L Y +TF  V   G+ V+P  +  GS+ W++  + VRSPIA  W Q
Sbjct  552  KKALAYEITFSSVGLDGLGVSPQQS--GSIEWSDGVHLVRSPIAVRWIQ  598



>gb|AEW07410.1| hypothetical protein 0_744_01, partial [Pinus radiata]
Length=152

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 79/133 (59%), Gaps = 4/133 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GL+YD+   DY  FLCSL+YT +QI  + +    +C K  S P  LNYPSFSV+F    +
Sbjct  10   GLIYDLGMDDYVSFLCSLNYTAKQIHILTRNA-TSCPKLSSAPGDLNYPSFSVVFKPRSL  68

Query  390  VRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVT  214
            VR T R +TNVG A  +YE+A+E P +V +TV+PT L F+   D+  YTV   SK     
Sbjct  69   VRVTKRTVTNVGGAPCVYEMAVENPENVNITVEPTTLAFEKQNDKATYTVKSESKIAADN  128

Query  213  PSNA--AFGSVSW  181
             S    AFG + W
Sbjct  129  KSKGGQAFGQILW  141



>ref|NP_001060094.1| Os07g0578300 [Oryza sativa Japonica Group]
 dbj|BAC83078.1| putative subtilisin-like serine protease [Oryza sativa Japonica 
Group]
 dbj|BAD30472.1| putative subtilisin-like serine protease [Oryza sativa Japonica 
Group]
 dbj|BAF22008.1| Os07g0578300 [Oryza sativa Japonica Group]
 gb|EAZ40414.1| hypothetical protein OsJ_24865 [Oryza sativa Japonica Group]
Length=770

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 83/149 (56%), Gaps = 6/149 (4%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT-CAKKL--SNPAQLNYPSFSVLF-G  403
            GLVYD    DY  FLCSL+YT +Q++  V  P+   CA  L    PA LNYPSF V F G
Sbjct  623  GLVYDAGVEDYVDFLCSLNYTVEQLRVFV--PDTAGCAPALPGGGPANLNYPSFVVAFNG  680

Query  402  KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKG  223
             +R+   TR +T V      Y VA+ AP  V VTV+P  L FK   +   YTV F S  G
Sbjct  681  STRVRTLTRTVTKVYEKPETYSVAVSAPAGVKVTVRPATLEFKEKNEEKSYTVEFTSVAG  740

Query  222  VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
                 +  FG +SW N ++QVRSP+ F W
Sbjct  741  GHVNQSWDFGHISWENRKHQVRSPVVFMW  769



>ref|NP_001050634.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|AAR87229.1| putaive subtilisin-like proteinase [Oryza sativa Japonica Group]
 gb|AAT78773.1| putative serine protease [Oryza sativa Japonica Group]
 gb|ABF97524.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12548.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|EAZ27735.1| hypothetical protein OsJ_11683 [Oryza sativa Japonica Group]
Length=765

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 94/160 (59%), Gaps = 18/160 (11%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQLNYPSFSVLF----  406
            GLVYD+   DY  FLC+L+YT+  I A+ ++ +  C + K  +   LNYPSF+V +    
Sbjct  610  GLVYDLGTADYVDFLCALNYTSTMIAAVARSKSYGCTEGKAYSVYNLNYPSFAVAYSTAS  669

Query  405  --------GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
                      +  V   R LTNVGAAGT Y+V+  A P V V V+PT+L F + G++  Y
Sbjct  670  SQAAESSGAAATTVTHRRTLTNVGAAGT-YKVSAAAMPGVAVAVEPTELAFTSAGEKKSY  728

Query  249  TVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  133
            TV+F +K     PS  A FG + W++ ++ V SP+AF+WT
Sbjct  729  TVSFTAKS---QPSGTAGFGRLVWSDGKHSVASPMAFTWT  765



>gb|EAZ04458.1| hypothetical protein OsI_26606 [Oryza sativa Indica Group]
Length=770

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 83/149 (56%), Gaps = 6/149 (4%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT-CAKKL--SNPAQLNYPSFSVLF-G  403
            GLVYD    DY  FLCSL+YT +Q++  V  P+   CA  L    PA LNYPSF V F G
Sbjct  623  GLVYDAGVEDYVDFLCSLNYTVEQLRVFV--PDTAGCAPALPGGGPANLNYPSFVVAFNG  680

Query  402  KSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKG  223
             +R+   TR +T V      Y VA+ AP  V VTV+P  L FK   +   YTV F S  G
Sbjct  681  STRVRTLTRTVTKVYEKPETYSVAVSAPAGVKVTVRPATLEFKEKNEEKSYTVEFTSVAG  740

Query  222  VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
                 +  FG +SW N ++QVRSP+ F W
Sbjct  741  GHVNQSWDFGHISWENRKHQVRSPVVFMW  769



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 96/164 (59%), Gaps = 8/164 (5%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT-CAKK-LSNP  442
            + G     P +    GLVYD+  +DY  FLC++ Y T++I  + K P +  CA + LS+P
Sbjct  603  VHGSGHIDPNKAVDPGLVYDLQISDYIAFLCTIGYDTKRIHVLFKEPAVVDCASQILSSP  662

Query  441  AQLNYPSFSVLF-GKSRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNV  268
              LNYPSFSV+F G +  V+ TR + NVG++   +Y+V ++ P +V ++V PT L F + 
Sbjct  663  GNLNYPSFSVVFRGDTNKVKYTRVVKNVGSSKNAVYKVNVKVPLNVHISVAPTTLAFTST  722

Query  267  GDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
               L Y +TF S   +  PS   FGS+ W +  + VRSPIA  W
Sbjct  723  VQTLSYDITFTSTS-IGPPS---FGSIEWTDGSHHVRSPIAVQW  762



>emb|CDP11276.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 94/158 (59%), Gaps = 8/158 (5%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
            TG     P++ +  GL+YDI P DY  +LC L+YT ++I  ++K   + CA +L  P AQ
Sbjct  594  TGSGHVNPSKATNPGLIYDIEPKDYIPYLCGLNYTNREIGILLKR-KVNCAVELLMPEAQ  652

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSFS++FG S + R TR +TNV  A + Y V I  P  V +TVKPT L F     +L
Sbjct  653  LNYPSFSIIFG-SPVQRYTRMVTNVDEANSTYTVKIIPPAGVNLTVKPTTLGFSQANQKL  711

Query  255  RYTVTFVSKKGVVTP--SNAAFGSVSWNNAQNQVRSPI  148
             Y VTF     V +P  S  + GS+SW + +  VRSPI
Sbjct  712  TYEVTFTL---VASPAKSRVSQGSLSWTSTKFSVRSPI  746



>gb|EYU33441.1| hypothetical protein MIMGU_mgv1a022698mg [Erythranthe guttata]
Length=751

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 93/163 (57%), Gaps = 8/163 (5%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     PTR +  GLVYDI+P DY  +LC L+YT Q++  IV    + CAK  S P AQL
Sbjct  588  GSGHVNPTRANDPGLVYDISPDDYIPYLCGLNYTNQEVGIIV-GRKVDCAKVRSIPEAQL  646

Query  432  NYPSFSVLFGK--SRIVRQTRELTNVGAAGTLYEVAIEA-PPSVTVTVKPTKLVFKNVGD  262
            NYPSFS++     ++    TR LTNVG   + Y V I +    V V VKP +L F+ +GD
Sbjct  647  NYPSFSIVLTGPTNQFFTTTRTLTNVGKPNSSYHVEIGSTADGVFVEVKPQELFFQKLGD  706

Query  261  RLRYTVTFV---SKKGVVTPSNAAFGSVSWNNAQNQVRSPIAF  142
            +L Y VTF    S + V   +    G ++W +A   VRSPIAF
Sbjct  707  KLSYNVTFTVLRSTRKVTNTTTQTQGFITWTSADYSVRSPIAF  749



>ref|XP_011033844.1| PREDICTED: subtilisin-like protease SDD1 [Populus euphratica]
Length=766

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 92/160 (58%), Gaps = 4/160 (3%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
            TG     P+R +  GLVYDI P +Y  +LC L Y   ++  IV    + C++K S P  +
Sbjct  609  TGAGHVNPSRANNPGLVYDIQPDNYIPYLCGLGYADNEVSIIVHE-QVKCSEKPSIPEGE  667

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSF+V  G S+    TR +TNVG   + YEVAI +PP V VTVKP+KL F  V  + 
Sbjct  668  LNYPSFAVTLGPSQTF--TRTVTNVGDVNSAYEVAIFSPPGVDVTVKPSKLYFSKVNRKA  725

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             Y+V F   +     S  A G + W +++  VRSPIA S+
Sbjct  726  TYSVAFSRTEYGGKTSEIAQGHIVWASSKYIVRSPIAVSF  765



>ref|XP_002275410.2| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
Length=755

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 100/172 (58%), Gaps = 4/172 (2%)
 Frame = -3

Query  645  LEETNFPTRGLT-GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI  469
            L++ + P      G     P++ +  GL+YDI P DY  +LC L YT  Q++AIV    +
Sbjct  585  LDDKHMPADLFAIGAGHVNPSKANDPGLIYDIEPYDYIPYLCGLGYTNAQVEAIV-LRKV  643

Query  468  TCAKKLSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  292
             C+K+ S P A+LNYPSFS+  G S+ ++  R +TNVG   + Y V+I AP  V V VKP
Sbjct  644  NCSKESSIPEAELNYPSFSIALG-SKDLKFKRVVTNVGKPHSSYAVSINAPEGVDVVVKP  702

Query  291  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            TK+ F  V  +  YTV F S  GV + +  A G + W +A +  +SPI+ ++
Sbjct  703  TKIHFNKVYQKKSYTVIFRSIGGVDSRNRYAQGFLKWVSATHSAKSPISVTF  754



>emb|CDP10008.1| unnamed protein product [Coffea canephora]
Length=1406

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
            +G     P R S  GL+YDI P DY  +LC L+YT +++ A+V    + C++  S P AQ
Sbjct  518  SGAGHVNPARASNPGLIYDIEPKDYIPYLCGLNYTNREV-ALVLQRKVNCSEIPSIPEAQ  576

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSF+++  +S + + TR +TNVG A ++Y V I AP  V VTV PT L F  V  +L
Sbjct  577  LNYPSFAIVV-RSAVQKYTRTVTNVGEANSVYSVQIVAPAGVNVTVNPTTLSFTKVNQKL  635

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
             Y VTF S   + +    + GS++W +++N VRSPIA
Sbjct  636  TYEVTF-SPSRLASNITVSQGSLTWISSKNAVRSPIA  671


 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 92/159 (58%), Gaps = 6/159 (4%)
 Frame = -3

Query  612   TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
             TG     P   S  GL+YDI P DY  +LC L+YT +Q+  I++   + C++  + P  Q
Sbjct  1243  TGAGHVNPASASNPGLIYDIEPKDYIPYLCGLNYTDKQVGLILQR-KVKCSEISNIPEGQ  1301

Query  435   LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
             LNYPSFSV+  +  + + TR +TNVG A ++Y V I AP  V V V PT L F  V  +L
Sbjct  1302  LNYPSFSVVV-RLAVQKYTRTVTNVGEASSVYHVQIVAPAGVNVRVNPTMLSFTKVNQKL  1360

Query  255   RYTVTFVSKKGVVTPSNAAFGSVSWN--NAQNQVRSPIA  145
              Y VTF S  G       + GS++W+  N++  VRSPIA
Sbjct  1361  AYEVTF-SPSGSANNIAVSQGSLTWHSSNSKYSVRSPIA  1398



>ref|XP_004958126.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 85/148 (57%), Gaps = 5/148 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN-ITCAKKLSN-PAQLNYPSFSVLFGKS  397
            GLVYD    DY  FLC+L+YT +Q++  V  P+ + C + L+  PA LNYPSF V+F   
Sbjct  633  GLVYDAGERDYVDFLCALNYTPEQLRVFV--PDFVKCTRTLAGGPADLNYPSFVVVFDDR  690

Query  396  RIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGV  220
              +R  TR LT V      Y V + AP  V V + PT L FK   +   YTV FV++ G 
Sbjct  691  TAIRTLTRTLTKVFEEAETYNVTVMAPEHVKVIITPTTLEFKEPKETRSYTVEFVNEAGG  750

Query  219  VTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
               S   FG +SW N +++VRSP+AF W
Sbjct  751  NRKSGWDFGHISWENEKHRVRSPVAFQW  778



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 89/162 (55%), Gaps = 4/162 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITCA-KKLSNPAQ  436
            G     P R    GLVYD    DY  FLC+++Y+  QI    +   ++ C+   L +P  
Sbjct  604  GAGHVDPNRALDPGLVYDSNVDDYLAFLCAMEYSPAQIAVFTRNEISVNCSTAALDSPGD  663

Query  435  LNYPSFSVLFGK-SRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYP+FSV+F   S +V   R + NVG +A   YE  + +PP V VTV P+ LVF  V  
Sbjct  664  LNYPAFSVIFSSNSDVVTYKRVVRNVGTSAAAAYEARVSSPPGVDVTVTPSTLVFDAVNV  723

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             L Y +TF S        + A+GS+SW++  + VRSPIA +W
Sbjct  724  SLSYEITFTSLASQAVAGSYAYGSISWSDGDHDVRSPIAVTW  765



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   113 bits (283),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 63/152 (41%), Positives = 86/152 (57%), Gaps = 5/152 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPN--ITCAKKLSNPAQLNYPSFSVLF-GK  400
            GLVYDI   DY  FLCS+ Y +++I   V+ P     C  KL+ P  LNYPSFSV+F   
Sbjct  610  GLVYDIDDGDYVAFLCSIGYDSKRIAIFVREPTGPDVCEGKLATPGNLNYPSFSVVFDSN  669

Query  399  SRIVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKK-  226
              +V+  R + NVG +   +YE  + APP V ++V P+KL F      L Y +TF S   
Sbjct  670  DHVVKYKRTVKNVGPSVDAVYEAKVNAPPGVEISVSPSKLEFSAENQTLSYEITFASDGL  729

Query  225  GVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
             +   +  AFGS+ W++  + VRSPIA  W Q
Sbjct  730  ALFAVALEAFGSIEWSDGVHLVRSPIAVRWLQ  761


 Score = 31.2 bits (69),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -2

Query  628  SNPWAHGSGHVDPHKALSPG  569
            S+P+ +G+GHVDP+ AL PG
Sbjct  591  SSPFVYGAGHVDPNIALMPG  610



>gb|AFB32955.1| hypothetical protein 0_744_01, partial [Larix decidua]
Length=148

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GLVYD    +Y  FLCSL+YT +QI  + K  + +C K  + P  LNYPSFSV+F    +
Sbjct  10   GLVYDAGMEEYVSFLCSLNYTAKQIYLLTKRTS-SCPKLRARPGDLNYPSFSVVFKPRDL  68

Query  390  VRQTRE-LTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKGVVT  214
            VR TR  + NVG A + YE+A+E+PP+V + V+P+ L FK   ++  +TV F SK  + +
Sbjct  69   VRVTRRTVKNVGQAFSEYEMAVESPPNVNIIVEPSTLTFKKQNEKANFTVRFKSK--IAS  126

Query  213  PSNAAFGSVSW  181
                 FG +SW
Sbjct  127  SGRPEFGQISW  137



>gb|AES80028.2| subtilisin-like serine protease [Medicago truncatula]
Length=774

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 91/160 (57%), Gaps = 3/160 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P   S  GLVYDI   DY  + CSL++T+ +I  + K  N  C+KK +     L
Sbjct  615  GSGHVNPESASDPGLVYDINTKDYLNYFCSLNFTSSEITILTKT-NFKCSKKPVFQVGDL  673

Query  432  NYPSFSVLFGKS-RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            NYPSFSVLF K+   V   R +TNVG + + Y V +  P  V V V+P KL F+  G +L
Sbjct  674  NYPSFSVLFSKTTHNVTYKRVVTNVGKSQSAYVVEVLEPHGVIVNVEPRKLKFEKFGQKL  733

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             Y VTF++        +++FGS+ W + + +VRSPIA +W
Sbjct  734  SYKVTFLAVGKARVTGSSSFGSIIWVSGKYKVRSPIAVTW  773



>emb|CBI34785.3| unnamed protein product [Vitis vinifera]
Length=966

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 101/176 (57%), Gaps = 6/176 (3%)
 Frame = -3

Query  645  LEETNFPTRGLT-GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI  469
            L++ + P      G     P++ +  GL+YDI P DY  +LC L YT  Q++AIV    +
Sbjct  781  LDDKHMPADLFAIGAGHVNPSKANDPGLIYDIEPYDYIPYLCGLGYTNAQVEAIVLR-KV  839

Query  468  TCAKKLSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  292
             C+K+ S P A+LNYPSFS+  G S+ ++  R +TNVG   + Y V+I AP  V V VKP
Sbjct  840  NCSKESSIPEAELNYPSFSIALG-SKDLKFKRVVTNVGKPHSSYAVSINAPEGVDVVVKP  898

Query  291  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQLF  124
            TK+ F  V  +  YTV F S  GV + +  A G + W +A +  +SPI  S TQ F
Sbjct  899  TKIHFNKVYQKKSYTVIFRSIGGVDSRNRYAQGFLKWVSATHSAKSPI--SVTQDF  952



>ref|XP_003623810.1| Subtilisin-like protease [Medicago truncatula]
Length=786

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 91/160 (57%), Gaps = 3/160 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P   S  GLVYDI   DY  + CSL++T+ +I  + K  N  C+KK +     L
Sbjct  627  GSGHVNPESASDPGLVYDINTKDYLNYFCSLNFTSSEITILTKT-NFKCSKKPVFQVGDL  685

Query  432  NYPSFSVLFGKS-RIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            NYPSFSVLF K+   V   R +TNVG + + Y V +  P  V V V+P KL F+  G +L
Sbjct  686  NYPSFSVLFSKTTHNVTYKRVVTNVGKSQSAYVVEVLEPHGVIVNVEPRKLKFEKFGQKL  745

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
             Y VTF++        +++FGS+ W + + +VRSPIA +W
Sbjct  746  SYKVTFLAVGKARVTGSSSFGSIIWVSGKYKVRSPIAVTW  785



>ref|XP_011081168.1| PREDICTED: subtilisin-like protease SDD1, partial [Sesamum indicum]
Length=740

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 91/157 (58%), Gaps = 4/157 (3%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
            TG     P+R +  GLVYDI P DY  +LC L+YT +++  I+    + C+K    P +Q
Sbjct  585  TGAGHVNPSRANDPGLVYDIQPNDYIPYLCGLEYTDREV-GIITQQKVNCSKISWIPESQ  643

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSFSVLFG SR+   TR +TNVG A + Y V I  PP V V VKP KL F     + 
Sbjct  644  LNYPSFSVLFG-SRVQTYTRTVTNVGEANSSYVVEISPPPGVHVAVKPEKLEFMEQKQKA  702

Query  255  RYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
             Y VTF S+      SN + G + W + +  VRSPI+
Sbjct  703  TYEVTF-SRLPSAGNSNFSQGFLMWTSEKCFVRSPIS  738



>ref|XP_002275429.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=740

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 75/170 (44%), Positives = 97/170 (57%), Gaps = 5/170 (3%)
 Frame = -3

Query  645  LEETNFPTRGLT-GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNI  469
            L+ET+ P      G     P+R +  GL+YDI P DY  +LC L Y   Q++AI++   +
Sbjct  569  LDETHEPADVFAVGAGHVNPSRANDPGLIYDIQPNDYIPYLCGLGYNDTQVRAIIRH-KV  627

Query  468  TCAKKLSNP-AQLNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKP  292
             C+K+ S P AQLNYPSFSV  G S +  Q R +TNVG A   Y V I AP  V V+VKP
Sbjct  628  QCSKESSIPEAQLNYPSFSVAMGSSALKLQ-RTVTNVGEAKASYIVKISAPQGVDVSVKP  686

Query  291  TKLVFKNVGDRLRYTVTFVSKKGVVTPSNA-AFGSVSWNNAQNQVRSPIA  145
             KL F     +  YTVTF  K    T S   A G + W +A++ VRSPI+
Sbjct  687  RKLDFTQTNQKKTYTVTFERKDDGKTGSKPFAQGFLEWVSAKHSVRSPIS  736



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 94/171 (55%), Gaps = 16/171 (9%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA-KKLSNPAQL  433
            G     P +    GLVYD+   DY  FLC+L+YTT QI ++ +  N  C  KK    + L
Sbjct  603  GAGHVDPPKALDPGLVYDLTVDDYLDFLCALNYTTLQIASVSRRSNFNCDNKKAYAVSDL  662

Query  432  NYPSFSVLF----------GKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKL  283
            NYPSF+V F            +  V+ TR LTNVGA GT Y+  + AP    VTV P++L
Sbjct  663  NYPSFAVAFATASGAGGGGSAATTVKHTRTLTNVGAPGT-YKATVSAPQEAKVTVDPSEL  721

Query  282  VFKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  133
             F   G++  YTV F +      PS  AAFG + W++ ++ V SP++F+WT
Sbjct  722  SFAAAGEKKSYTVAFSAAS---QPSGTAAFGRLEWSDGKHVVASPLSFTWT  769



>ref|XP_004244717.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=744

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 69/156 (44%), Positives = 93/156 (60%), Gaps = 4/156 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P R +  GL+YDI+  DY  +LC L+YT QQ+ +IVK   + C K    P AQL
Sbjct  583  GAGHVNPLRANDPGLIYDISIEDYLPYLCGLNYTNQQVGSIVKH-KVDCNKVKHIPEAQL  641

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS+  G       TR +TNVG A + Y V I++PP VTV VKP+ L F  +  +L+
Sbjct  642  NYPSFSITLGDISQT-YTRTVTNVGEAKSSYTVEIDSPPRVTVIVKPSTLKFSQLDQKLK  700

Query  252  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y VTF +++   T S  A G + W++ +  VRSPIA
Sbjct  701  YQVTF-TRRDDSTSSGIAQGFLKWSSKKYSVRSPIA  735



>ref|XP_009789823.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 88/147 (60%), Gaps = 7/147 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSR-  394
            GLVYD+A  DY  FLC+++Y  + IQ I K+P + C  K   P  LNYPS + LF  +  
Sbjct  621  GLVYDLANEDYVSFLCAIEYGPKTIQVITKSP-VNCPMKKPLPENLNYPSIAALFSTAAK  679

Query  393  -IVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY--TVTFVSK  229
             +  +T  R +TNVG     Y+V IEAP  VTV+VKP KLVF     +L Y  T+T  SK
Sbjct  680  GVSSKTFFRTVTNVGDTNAEYKVKIEAPKGVTVSVKPDKLVFSEKVRKLSYYVTITVDSK  739

Query  228  KGVVTPSNAAFGSVSWNNAQNQVRSPI  148
              V+  S A FGS+SW +  + VRSPI
Sbjct  740  NLVLNDSGAEFGSLSWIDGNHVVRSPI  766



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 96/178 (54%), Gaps = 10/178 (6%)
 Frame = -3

Query  651  GTLEETNFPTRGLTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-  475
            GT EE+   T  + G     P R    GL+YD+   DY  FLCS+ Y+ +QI   V  P 
Sbjct  592  GTGEES---TPFVHGAGHVDPNRALNPGLIYDLNVNDYVAFLCSIGYSPRQIAVFVGKPT  648

Query  474  --NITCAKKLSNPAQLNYPSFSVLFGKSR-IVRQTRELTNVGA-AGTLYEVAIEAPPSVT  307
              ++     L++P  LNYPSFSV+    + +++  R  TNVG  A  +YEV + AP  V 
Sbjct  649  GSDMCTRNSLASPGDLNYPSFSVVLSSDQGLIKYKRIATNVGGDADAVYEVTVNAPAGVE  708

Query  306  VTVKPTKLVFKNVGDRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            ++V+P KLVF        Y VTF  K+GV       +GS+ W + ++ VRSP+A  W+
Sbjct  709  ISVEPRKLVFSAENQTQSYEVTF--KRGVGYDGGERYGSIEWTDGRHLVRSPVAVRWS  764



>ref|XP_010087293.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB28740.1| Subtilisin-like protease [Morus notabilis]
Length=743

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 97/163 (60%), Gaps = 6/163 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G   + P      GLVYD+   DY  FLC+L+YT  QI  + +      AKK  +   LN
Sbjct  583  GAGHADPVAALDPGLVYDLTVDDYLDFLCALNYTDDQISGLTRKEFSCDAKKKYSVTDLN  642

Query  429  YPSFSVLF---GKSRIVRQTRELTNVGAAGTLYEVAIEAP-PSVTVTVKPTKLVFKNVGD  262
            YPSF+V F   G S +   +R LTNVG AGT Y++++++   SV ++V+P  L F +  +
Sbjct  643  YPSFAVNFQSNGGSSVYNYSRTLTNVGPAGT-YKLSLKSETQSVKISVEPETLSFSHANE  701

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            +  YTVTF +  G ++P + +FG + W++ ++ V SPIAFSW+
Sbjct  702  KKSYTVTFTA-VGSMSPDSKSFGRIEWSDGKHIVGSPIAFSWS  743



>gb|EYU29557.1| hypothetical protein MIMGU_mgv1a0023062mg, partial [Erythranthe 
guttata]
Length=302

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 89/156 (57%), Gaps = 3/156 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSN-PAQL  433
            G     PTR +  GLVYDI+P DY  +LC +++T +++  +V+  N+ C+   S   +QL
Sbjct  145  GSGHVNPTRANDPGLVYDISPDDYIPYLCGMNFTDKEVSVVVQR-NVDCSDVNSIIDSQL  203

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++ G S     TR +TNVG A   ++V I +P  V V V+P +L F  +G +L 
Sbjct  204  NYPSFSIILG-STPQSYTRTVTNVGKANASFDVEIVSPDGVIVRVEPERLWFWELGQKLS  262

Query  252  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y VTF              G + WN+A + VRSPI+
Sbjct  263  YNVTFTRSAANGATKKNGEGFIKWNSADHSVRSPIS  298



>ref|XP_009391664.1| PREDICTED: subtilisin-like protease SDD1 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 88/164 (54%), Gaps = 7/164 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQ--  436
            G     P R    GLVYD+ P DY   +CSL Y   +I  I    NI+C K L    Q  
Sbjct  608  GAGHVNPARAVDPGLVYDVQPEDYIAHICSLGYNQAEIFTITHR-NISCGKLLKGQKQFN  666

Query  435  LNYPSFSVLFGKSRIVRQT-RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            LNYPS SV F + R      R+LTNVG   ++Y V + APP VTVTV P  L F  + + 
Sbjct  667  LNYPSISVSFTQGRTSTTIQRKLTNVGLPDSIYTVQVTAPPGVTVTVTPKILAFGGINEI  726

Query  258  LRYTVTFVSKKGVVTPSNAAFGSVSWNNA---QNQVRSPIAFSW  136
              YTV F SKKGV    + A G + W ++   + +VRSPI+ +W
Sbjct  727  KSYTVVFESKKGVQEEGSVAGGQLMWVHSGRKKYKVRSPISVTW  770



>ref|XP_004166310.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=768

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 96/166 (58%), Gaps = 10/166 (6%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK--KLSNPAQ  436
            G     PT+    GLVYDI P +Y + LC+L YT  +I  I+   N++C K  +++    
Sbjct  603  GAGHVNPTKAIDPGLVYDIKPYEYIIHLCALGYTHSEI-FIITHMNVSCHKILQMNKGFT  661

Query  435  LNYPSFSVLFGKSRIVRQ-TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDR  259
            LNYPS SV+F      +  +R LTNVG+  ++YEV + AP  V V VKP +LVFK+V + 
Sbjct  662  LNYPSISVIFKHGTTSKMVSRRLTNVGSTNSIYEVKVTAPEGVRVRVKPRRLVFKHVNES  721

Query  258  LRYTVTFVSKKGVVTPSNAAF--GSVSWNNAQN---QVRSPIAFSW  136
            L Y V F+S+KG        F  G ++W + +N   +VRSPI  +W
Sbjct  722  LNYKVWFMSEKG-KEGRKVRFTEGDLTWIHCENSKYKVRSPIVVTW  766



>ref|XP_006359680.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=772

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 89/147 (61%), Gaps = 7/147 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKS--  397
            GLVYD+A  DY  FLC+++Y  + IQ I K+P + C  +   P  LNYPS + LF  +  
Sbjct  619  GLVYDLANQDYVSFLCAIEYGPKTIQVITKSP-VNCPMRKPLPENLNYPSIAALFSTATK  677

Query  396  RIVRQT--RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY--TVTFVSK  229
             +  +T  R +TNVG A  +Y V IEAP  VTV+VKP KL F     +L Y  T+T  SK
Sbjct  678  GVSSKTFFRTVTNVGDANAVYRVKIEAPKGVTVSVKPAKLGFSEKIRKLSYYVTITVDSK  737

Query  228  KGVVTPSNAAFGSVSWNNAQNQVRSPI  148
              V+  S A FGS+SW + ++ VRSPI
Sbjct  738  NLVLNDSGAVFGSLSWVDGKHVVRSPI  764



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 70/167 (42%), Positives = 93/167 (56%), Gaps = 9/167 (5%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITC-AKKLSNPAQ  436
            G     P R    GLVYD+  TDY  FLC++ Y +++I    K A ++ C A     P  
Sbjct  600  GSGHVDPNRAVDPGLVYDLEITDYVAFLCTIGYDSRRISVFTKQASSVDCDALGFKTPGN  659

Query  435  LNYPSFSVLF-GKSRIVRQTRELTNVGA-AGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            LNYPSFSV+F G   +V+  R + NVG  A  +YEV +  P  V V+V P+KLVF    D
Sbjct  660  LNYPSFSVVFSGSESVVKYKRTVKNVGKEANAVYEVKVNTPLGVEVSVSPSKLVFSEKED  719

Query  261  RLRYTVTFVSKKGVV----TPSNAAFGSVSWNNAQNQ-VRSPIAFSW  136
            +L Y VTF S    V    T S ++FGS+ W++  +  VRSPIA  W
Sbjct  720  KLSYEVTFKSSANAVGFEITGSKSSFGSIEWSDGGSHLVRSPIAVLW  766



>ref|XP_010091819.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB46027.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=771

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 100/168 (60%), Gaps = 12/168 (7%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLS--NPAQ  436
            G     P R    GLVYDI P +Y   LC+L YT  ++ ++    N++C + L+      
Sbjct  605  GAGHVNPQRALDPGLVYDIRPGEYVTHLCTLGYTDLEVFSVTHK-NVSCREILTINKGFS  663

Query  435  LNYPSFSVLFGK---SRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            LNYPS SV+F +   S++++  R LTNVG+  ++Y + IEAP  V V VKP +LVF  + 
Sbjct  664  LNYPSISVIFKRGTGSKMIK--RRLTNVGSPNSIYSLEIEAPQDVKVRVKPRRLVFTRIN  721

Query  264  DRLRYTVTFVSKKGVVTPSNA-AFGSVSWNNAQN---QVRSPIAFSWT  133
              L Y V F+S+K  V  S++ A G ++W NA+N   +VRSPI+ +WT
Sbjct  722  QVLSYRVWFISRKRSVVQSHSYAQGHLTWVNAKNSLYRVRSPISIAWT  769



>ref|XP_004982450.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=775

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 96/174 (55%), Gaps = 18/174 (10%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAK-KLSNPAQL  433
            G     P+R    GLVYD+   DY  FLC+L Y+   I  + ++ + +CA+ +  +   L
Sbjct  605  GAGHVDPSRAVDPGLVYDLGTRDYVDFLCALKYSPAMIATVARSRDFSCAENRTYSVGGL  664

Query  432  NYPSFSVLF-------GKSRI---VRQTRELTNVGAAGTLY---EVAIEAPPSVTVTVKP  292
            NYPSFSV F       G+S     V  TR LTNVG AGT      VA  A   VTV V+P
Sbjct  665  NYPSFSVAFSTANGEGGESSAAATVTHTRTLTNVGGAGTYKVSTSVAGAAAQGVTVAVEP  724

Query  291  TKLVFKNVGDRLRYTVTFVSKKGVVTPSN-AAFGSVSWNNAQNQVRSPIAFSWT  133
            T+L F + G++  YTV F S+     PS  + FG + W++ ++ V SPIAF+WT
Sbjct  725  TELAFTSAGEKKSYTVRFTSRS---QPSGTSGFGRLVWSDGKHSVASPIAFTWT  775



>ref|XP_002272824.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 95/165 (58%), Gaps = 7/165 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKK-LSNPAQL  433
            G     P R S  GL+YDI   DY  +LCSL YT +Q+ A+V   + TC    +  P  L
Sbjct  612  GSGHVDPMRASNPGLIYDITHEDYLNYLCSLKYTPEQM-ALVSRESFTCPNDTVLQPGDL  670

Query  432  NYPSFSVLFGKSRIVRQT----RELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
            NYPSF+V+F  S ++  +    R +TNVG   + Y V ++ P  V+V V+P  L F+++ 
Sbjct  671  NYPSFAVVF-DSDVLNNSATYRRTVTNVGLPCSTYVVRVQEPEGVSVRVEPNVLKFRHLN  729

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
             +L Y V+FV+++   +   A FGS+SW   +  VRSPIA +W Q
Sbjct  730  QKLSYRVSFVAERESSSSGEAVFGSLSWVFWKYTVRSPIAVTWQQ  774



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 96/173 (55%), Gaps = 11/173 (6%)
 Frame = -3

Query  615  LTGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAP-NITC-AKKLSNP  442
            + G     P +    GLVYDI   DY   LC++ Y + +I   +K P  I C AK LS  
Sbjct  626  VHGSGHVDPNKALNPGLVYDINANDYISLLCAMGYNSTRIAIFLKEPTTIDCAAKNLSTA  685

Query  441  AQLNYPSFSVLFGKSR-IVRQTRELTNVG-AAGTLYEVAIEAPPSVTVTVKPTKLVFKNV  268
              LNYPSFSV+F   + +V+ TR + NVG +A  +YEV++ AP +V V+V P KL F   
Sbjct  686  GNLNYPSFSVVFESGKNVVKYTRVVKNVGSSADAVYEVSVNAPLNVDVSVSPRKLEFSAD  745

Query  267  GDRLRYTVTFVSKK-----GVVTP--SNAAFGSVSWNNAQNQVRSPIAFSWTQ  130
               L Y ++F S       G V P    ++FGS+ W++  ++VRSPIA  W +
Sbjct  746  KQTLSYEISFTSISETYLTGKVKPILGTSSFGSIEWSDGSHRVRSPIAVRWVE  798



>gb|ADY38794.1| serine protease [Coffea arabica]
Length=763

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 94/156 (60%), Gaps = 4/156 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GL+YDI P DY  +LC L+YT + +  I++   + CA++ S P AQL
Sbjct  602  GSGHVNPSRANNPGLIYDIVPKDYVPYLCGLNYTRRGLLYILQR-RVNCAEESSIPEAQL  660

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS+ FG S I R TR +TNVG A ++Y V +  P  V V VKP  L F  V  ++ 
Sbjct  661  NYPSFSIQFG-SPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQKVT  719

Query  252  YTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
            Y V F S+      + A+ GS++W +A+  VRSPIA
Sbjct  720  YEVVF-SQLPTAANNTASQGSITWTSAKVSVRSPIA  754



>gb|AES81608.2| subtilisin-like serine protease [Medicago truncatula]
Length=874

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 95/167 (57%), Gaps = 12/167 (7%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCA--KKLSNPA  439
            TG     P R    GL+YDI P DY   LCS+ YT  +I +I    NI+C    +++   
Sbjct  596  TGAGNVNPQRALNPGLIYDIKPDDYVNHLCSIGYTKSEIFSITHK-NISCHTIMRMNRGF  654

Query  438  QLNYPSFSVLFGKSRIVRQ--TRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
             LNYPS SV+F K  I R+  +R +TNVG   ++Y V + AP  V V VKP KL+FK + 
Sbjct  655  SLNYPSISVIF-KDGIRRKMFSRRVTNVGNPNSIYSVEVVAPQGVKVIVKPKKLIFKKIN  713

Query  264  DRLRYTVTFVSKKGVVTPS---NAAFGSVSWNNAQN---QVRSPIAF  142
              L Y V F+S+K V   S   N A G ++W N+QN   +VRSPIA 
Sbjct  714  QSLSYRVYFISRKRVKKGSDTMNFAEGHLTWINSQNGSYRVRSPIAM  760



>gb|EYU29561.1| hypothetical protein MIMGU_mgv1a018614mg, partial [Erythranthe 
guttata]
Length=692

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQL  433
            G     P+R +  GLVYDI P DY  +LC L+YT Q++  IVK   + C+KK S P AQL
Sbjct  560  GSGHVNPSRANDPGLVYDILPDDYIPYLCGLNYTNQEVGIIVKC-KVDCSKKKSIPEAQL  618

Query  432  NYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLR  253
            NYPSFS++FG S     TR LTNVG A + Y+V I +   V V V+P KL+F  +GD+  
Sbjct  619  NYPSFSIIFG-STPQTYTRTLTNVGKANSSYDVEIVSSHGVNVKVEPHKLMFPKLGDKSS  677

Query  252  YTVTF  238
            Y+VTF
Sbjct  678  YSVTF  682



>gb|AFK33735.1| unknown [Medicago truncatula]
Length=186

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 96/158 (61%), Gaps = 4/158 (3%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNP-AQ  436
            TG     P + +  GLVYDI P DY  +LC L Y+ ++I+ IV+   + C+   S P AQ
Sbjct  27   TGAGHVNPVKANDPGLVYDIEPEDYVPYLCGLGYSDKEIEVIVQR-KVKCSNVKSIPEAQ  85

Query  435  LNYPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRL  256
            LNYPSFS+L G S     TR LTNVG A ++Y+V +E P ++ ++V P+++ F  V +++
Sbjct  86   LNYPSFSILLG-SDSQYYTRTLTNVGFANSIYKVELEVPLALGMSVNPSEITFTEVNEKV  144

Query  255  RYTVTFVSK-KGVVTPSNAAFGSVSWNNAQNQVRSPIA  145
             +++ F+ + K        A GS++W + ++ VR PI+
Sbjct  145  SFSIEFIPQIKENRRSQTFAQGSLTWVSDKHAVRIPIS  182



>ref|XP_009375850.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 91/162 (56%), Gaps = 5/162 (3%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQL  433
            G     P   +  GLVYDI   DY ++LCSL+Y + QI       N TC    +     L
Sbjct  603  GSGHVDPESAADPGLVYDITTEDYLLYLCSLNYNSSQIALFSNGVNFTCPGTSVVQSGDL  662

Query  432  NYPSFSVLFGKSR---IVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGD  262
            NYPSFSV+F + R    V   R + NVG+  + Y V ++ P  V+V+V+P  L FK +G+
Sbjct  663  NYPSFSVIFDQDRRKTSVTYKRTVKNVGSIPSTYAVQVKEPAGVSVSVEPKTLRFKKMGE  722

Query  261  RLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            ++ Y V FV+  G  T +N++FGS++    + +VRSPIA  W
Sbjct  723  KMSYKVRFVALGG-ATSTNSSFGSLTLVAEKYRVRSPIAVLW  763



>gb|EMS49460.1| Subtilisin-like protease SDD1 [Triticum urartu]
Length=815

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 92/159 (58%), Gaps = 8/159 (5%)
 Frame = -3

Query  612  TGRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVK-APNITCAK--KLSNP  442
            TG     P +    GLVY+++ +DY  +LC L+YT QQ+ +I+   P + C K  K+   
Sbjct  541  TGAGHVNPKKAMDPGLVYNLSASDYVPYLCGLNYTDQQVNSIIHPEPAVDCTKITKIGE-  599

Query  441  AQLNYPSFSVLFGKSRI-VRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVG  265
              LNYPS +++  K+   V  TR +TNVG A + YE+ +E P SVTV V PTKL FK + 
Sbjct  600  KDLNYPSITIIIDKADTTVNATRAVTNVGVASSTYEMEVEVPKSVTVEVTPTKLEFKELD  659

Query  264  DRLRYTVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPI  148
            + L YT   VS K    P  A  G + W ++++ VRSPI
Sbjct  660  EVLNYT---VSVKAAAVPEGAVEGQLKWVSSKHIVRSPI  695



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   110 bits (276),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 90/156 (58%), Gaps = 12/156 (8%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITC-AKKLSNPAQLNYPSFSVLFGKSR  394
            GLVYD+   DY  FLC+L+YT  QI ++ +  + TC +KK  +   LNYPSF+V+F    
Sbjct  608  GLVYDLTVDDYLNFLCALNYTPSQINSLARK-DFTCDSKKKYSVNDLNYPSFAVVFDGVL  666

Query  393  IV--------RQTRELTNVGAAGTLYEVAIEAP-PSVTVTVKPTKLVFKNVGDRLRYTVT  241
                      + TR LTNVG+ GT Y+V+I +   SV ++V+P  L F    ++  YTVT
Sbjct  667  GGGGSGSSVVKHTRTLTNVGSPGT-YKVSISSETKSVKISVEPESLSFTGANEKKSYTVT  725

Query  240  FVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSWT  133
            F S       S   FG + W++ ++ V SPIAFSWT
Sbjct  726  FTSNGSAAPSSAEGFGRIEWSDGKHVVGSPIAFSWT  761


 Score = 31.6 bits (70),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            +D    + S P+ HG+GHVDP  AL+PG
Sbjct  581  QDIATGKPSTPFDHGAGHVDPVSALNPG  608



>ref|XP_006358147.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=730

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 90/157 (57%), Gaps = 6/157 (4%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     P   +  GL+YDI P DY  +LC L+YT QQ+ AI++   + C  ++   A+LN
Sbjct  574  GAGHVNPLSANDPGLIYDIQPHDYVPYLCGLNYTDQQVSAILQK-KVNCTIRIPE-AELN  631

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSFS+  G S     TR +TNVG A + Y V I  P  V +TV P+ L F  V +R+ Y
Sbjct  632  YPSFSIKLG-SETQEYTRAVTNVGEANSTYTVEISPPEGVEITVSPSSLHFSEVKERITY  690

Query  249  TVTFVSKKGVVTPSNAAF--GSVSWNNAQNQVRSPIA  145
             VTF  +    T SNA F  G + W++ ++ VRSPIA
Sbjct  691  QVTF-KRSAPGTVSNAKFVQGYLKWSSDKHSVRSPIA  726



>ref|XP_003605881.1| Subtilisin-like protease [Medicago truncatula]
 gb|KEH17073.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   111 bits (278),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLNYPSFSVLFGKSRI  391
            GLVYD+   DY  FLC+L+Y++ +I+ + +       KK  +   LNYPSF+V+F     
Sbjct  613  GLVYDLTVDDYLSFLCALNYSSNEIEMVARRKYTCDPKKQYSVENLNYPSFAVVFEDEHG  672

Query  390  V---RQTRELTNVGAAGTLYEVAIEAP-PSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKG  223
            V   + TR LTNVG  GT Y+V++++  PS+ ++V+P  L FK    +L YT++F S  G
Sbjct  673  VEEIKHTRTLTNVGVEGT-YKVSVKSDAPSIKISVEPEVLSFKKNEKKL-YTISF-SSAG  729

Query  222  VVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
                S  +FGSV W+N +  VRSPIAFSW
Sbjct  730  SKPNSTQSFGSVEWSNGKTIVRSPIAFSW  758


 Score = 30.0 bits (66),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = -2

Query  649  DAGGDELSNPWAHGSGHVDPHKALSPG  569
            D   ++ + P+  G+GHVDP  AL+PG
Sbjct  587  DGASNKPATPFDFGAGHVDPVSALNPG  613



>ref|XP_006418467.1| hypothetical protein EUTSA_v10006878mg [Eutrema salsugineum]
 gb|ESQ36820.1| hypothetical protein EUTSA_v10006878mg [Eutrema salsugineum]
Length=766

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 91/158 (58%), Gaps = 2/158 (1%)
 Frame = -3

Query  609  GRAMSTPTRPSPRGLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNITCAKKLSNPAQLN  430
            G     PTR +  GLVYD++  DY  +LC+L+YT ++I  +    + TC    S P  LN
Sbjct  610  GAGHVDPTRAADPGLVYDLSTVDYLNYLCNLNYTRERIL-LFSGTDYTCPAATS-PGDLN  667

Query  429  YPSFSVLFGKSRIVRQTRELTNVGAAGTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRY  250
            YPSF+V   K   +R  R +TNVG+    Y   IE P  V V V+P  L F  V ++L Y
Sbjct  668  YPSFAVNVVKGARLRYKRTVTNVGSRACEYIAHIEEPKGVKVRVEPKVLKFDKVREKLSY  727

Query  249  TVTFVSKKGVVTPSNAAFGSVSWNNAQNQVRSPIAFSW  136
            TV+FV++    + S ++FG++ W   Q +VRSPIA +W
Sbjct  728  TVSFVAEASTNSSSTSSFGALVWICDQYKVRSPIALTW  765



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   106 bits (265),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 7/153 (5%)
 Frame = -3

Query  570  GLVYDIAPTDYTMFLCSLDYTTQQIQAIVKAPNIT--CAKKLSNPAQLNYPSFSVLF-GK  400
            GLVYD+  +DY  FLC++ Y + +I   V+ P  +  C+ K+S+P  LNYPSFSV+F   
Sbjct  616  GLVYDMDTSDYISFLCAIGYDSNRIAVFVREPPSSDICSGKVSSPGNLNYPSFSVVFQST  675

Query  399  SRIVRQTRELTNVGAA-GTLYEVAIEAPPSVTVTVKPTKLVFKNVGDRLRYTVTFVSKKG  223
            S +V   R + NVG++   +YEV + +P +V + V P+KLVF      L Y +TF S  G
Sbjct  676  SDVVTCKRVVKNVGSSLDAVYEVKVNSPANVDIKVSPSKLVFSAENKTLSYEITF-SSVG  734

Query  222  VVTPS--NAAFGSVSWNNAQNQVRSPIAFSWTQ  130
            +  P+   + +GS+ W++  + VR PIA  W Q
Sbjct  735  LDWPTIIPSTYGSIEWSDGIHGVRGPIAVKWRQ  767


 Score = 35.4 bits (80),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = -2

Query  652  RDAGGDELSNPWAHGSGHVDPHKALSPG  569
            +D    E S P+ HG+GHVDP+ AL PG
Sbjct  589  KDLASAEESTPFIHGAGHVDPNSALDPG  616



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250