BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002N22

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002529997.1|  cystathionine gamma-synthase, putative             324   9e-106   
gb|ABK96139.1|  unknown                                                 318   5e-105   Populus trichocarpa [western balsam poplar]
ref|NP_001234489.1|  cystathionine gamma synthase                       324   2e-104   Solanum lycopersicum
gb|AAF74981.1|AF082891_1  cystathionine gamma-synthase isoform 1        324   2e-104   Solanum tuberosum [potatoes]
gb|KHG00425.1|  Cystathionine gamma-synthase, chloroplastic -like...    324   3e-104   Gossypium arboreum [tree cotton]
ref|XP_009628949.1|  PREDICTED: cystathionine gamma-synthase, chl...    323   5e-104   Nicotiana tomentosiformis
pdb|1QGN|A  Chain A, Cystathionine Gamma-Synthase From Nicotiana ...    320   6e-104   Nicotiana tabacum [American tobacco]
gb|KJB11075.1|  hypothetical protein B456_001G240000                    323   7e-104   Gossypium raimondii
gb|AJF83863.1|  cystathionine gamma synthase 1                          323   7e-104   Nicotiana tabacum [American tobacco]
gb|KJB11079.1|  hypothetical protein B456_001G240300                    323   8e-104   Gossypium raimondii
ref|XP_011085742.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    322   2e-103   Sesamum indicum [beniseed]
ref|XP_009775845.1|  PREDICTED: cystathionine gamma-synthase, chl...    321   3e-103   Nicotiana sylvestris
ref|XP_011035793.1|  PREDICTED: cystathionine gamma-synthase, chl...    322   3e-103   Populus euphratica
gb|KHG14739.1|  Cystathionine gamma-synthase, chloroplastic -like...    321   4e-103   Gossypium arboreum [tree cotton]
ref|XP_002323872.1|  cystathionine gamma synthase family protein        320   6e-103   
ref|XP_006373333.1|  hypothetical protein POPTR_0017s12240g             320   7e-103   Populus trichocarpa [western balsam poplar]
emb|CBI22246.3|  unnamed protein product                                319   7e-103   Vitis vinifera
ref|XP_009602123.1|  PREDICTED: cystathionine gamma-synthase, chl...    322   8e-103   Nicotiana tomentosiformis
gb|AHM22940.1|  cystathionine gamma synthase                            320   1e-102   Nicotiana tabacum [American tobacco]
ref|XP_009797245.1|  PREDICTED: cystathionine gamma-synthase, chl...    319   2e-102   Nicotiana sylvestris
ref|XP_002283866.1|  PREDICTED: cystathionine gamma-synthase, chl...    318   2e-102   Vitis vinifera
ref|XP_007032603.1|  Pyridoxal phosphate-dependent transferases s...    318   7e-102   
ref|XP_007032602.1|  Pyridoxal phosphate-dependent transferases s...    318   1e-101   
gb|AGT40329.1|  cystathionine gamma synthase                            317   2e-101   Nicotiana attenuata
gb|KJB75684.1|  hypothetical protein B456_012G052100                    315   5e-101   Gossypium raimondii
gb|AHL84163.1|  cystathionine gamma synthase                            315   7e-101   Nicotiana tabacum [American tobacco]
emb|CAA56143.1|  CYS1                                                   304   8e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029311.1|  PREDICTED: cystathionine gamma-synthase, chl...    315   8e-101   Eucalyptus grandis [rose gum]
ref|XP_009592901.1|  PREDICTED: cystathionine gamma-synthase, chl...    315   1e-100   Nicotiana tomentosiformis
ref|NP_001275144.1|  cystathionine gamma-synthase isoform 2             314   1e-100   Solanum tuberosum [potatoes]
ref|XP_010525099.1|  PREDICTED: cystathionine gamma-synthase, chl...    310   3e-100   Tarenaya hassleriana [spider flower]
gb|KDP27172.1|  hypothetical protein JCGZ_19871                         313   5e-100   Jatropha curcas
ref|XP_011098654.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    313   5e-100   Sesamum indicum [beniseed]
dbj|BAP47509.1|  cystathionine gamma-synthase                           313   6e-100   Gentiana triflora
ref|XP_010550033.1|  PREDICTED: cystathionine gamma-synthase, chl...    313   6e-100   Tarenaya hassleriana [spider flower]
gb|AGF95116.1|  cystathionine gamma synthase                            299   1e-99    Prunus persica
ref|XP_006408463.1|  hypothetical protein EUTSA_v10020394mg             313   1e-99    Eutrema salsugineum [saltwater cress]
emb|CDP02254.1|  unnamed protein product                                311   2e-99    Coffea canephora [robusta coffee]
ref|XP_006431203.1|  hypothetical protein CICLE_v10011434mg             311   2e-99    
ref|XP_006431204.1|  hypothetical protein CICLE_v10011434mg             311   3e-99    Citrus clementina [clementine]
gb|EYU44131.1|  hypothetical protein MIMGU_mgv1a002982mg                313   3e-99    Erythranthe guttata [common monkey flower]
ref|XP_008230796.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    310   5e-99    
ref|XP_007216002.1|  hypothetical protein PRUPE_ppa004232mg             310   5e-99    Prunus persica
ref|XP_010670238.1|  PREDICTED: cystathionine gamma-synthase, chl...    310   6e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006482629.1|  PREDICTED: cystathionine gamma-synthase, chl...    310   8e-99    Citrus sinensis [apfelsine]
ref|NP_186761.1|  cystathionine gamma-synthase                          310   2e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CAA64383.1|  cystathionine gamma-synthase                           310   2e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDY43269.1|  BnaC05g48620D                                          307   3e-98    Brassica napus [oilseed rape]
ref|XP_006297283.1|  hypothetical protein CARUB_v10013298mg             310   3e-98    
ref|XP_010463584.1|  PREDICTED: cystathionine gamma-synthase, chl...    308   4e-98    Camelina sativa [gold-of-pleasure]
gb|KCW56210.1|  hypothetical protein EUGRSUZ_I01959                     308   7e-98    Eucalyptus grandis [rose gum]
emb|CDY37543.1|  BnaA05g34080D                                          307   7e-98    Brassica napus [oilseed rape]
ref|XP_009147397.1|  PREDICTED: cystathionine gamma-synthase, chl...    307   8e-98    Brassica rapa
gb|KHN11627.1|  Cystathionine gamma-synthase, chloroplastic             300   8e-98    Glycine soja [wild soybean]
gb|AAM13883.1|  putative cystathionine gamma-synthase                   308   9e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KHN13598.1|  Cystathionine gamma-synthase, chloroplastic             302   1e-97    Glycine soja [wild soybean]
ref|XP_010485423.1|  PREDICTED: cystathionine gamma-synthase, chl...    307   1e-97    Camelina sativa [gold-of-pleasure]
gb|AAC49574.1|  similar to the metB gene product of Escherichia c...    307   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882199.1|  hypothetical protein ARALYDRAFT_477417             307   2e-97    
ref|XP_010429549.1|  PREDICTED: cystathionine gamma-synthase, chl...    307   2e-97    Camelina sativa [gold-of-pleasure]
gb|AAC25687.1|  cystathionine gamma-synthase precursor                  307   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|EYU34642.1|  hypothetical protein MIMGU_mgv1a004543mg                305   2e-97    Erythranthe guttata [common monkey flower]
ref|XP_008368433.1|  PREDICTED: cystathionine gamma-synthase, chl...    304   8e-97    
gb|AAC19395.1|  cystathionine gamma-synthase                            305   1e-96    Mesembryanthemum crystallinum
ref|XP_009360603.1|  PREDICTED: cystathionine gamma-synthase, chl...    303   1e-96    Pyrus x bretschneideri [bai li]
ref|XP_003552541.1|  PREDICTED: cystathionine gamma-synthase, chl...    304   2e-96    
ref|NP_001237572.1|  cystathionine-gamma-synthase precursor             302   8e-96    
emb|CDX91962.1|  BnaC03g32640D                                          300   1e-95    
emb|CDX74285.1|  BnaA03g27620D                                          301   1e-95    
ref|XP_009134628.1|  PREDICTED: cystathionine gamma-synthase, chl...    301   1e-95    Brassica rapa
ref|XP_004136690.1|  PREDICTED: cystathionine gamma-synthase, chl...    300   4e-95    Cucumis sativus [cucumbers]
ref|XP_010258325.1|  PREDICTED: cystathionine gamma-synthase, chl...    300   6e-95    Nelumbo nucifera [Indian lotus]
ref|XP_008443381.1|  PREDICTED: cystathionine gamma-synthase, chl...    298   3e-94    Cucumis melo [Oriental melon]
ref|XP_007139535.1|  hypothetical protein PHAVU_008G038100g             298   3e-94    Phaseolus vulgaris [French bean]
ref|NP_001266947.1|  cystathionine gamma-synthase, chloroplastic-...    298   4e-94    Fragaria vesca [alpine strawberry]
ref|NP_001265950.1|  cystathionine gamma-synthase, chloroplastic-...    295   6e-93    Cicer arietinum [garbanzo]
ref|XP_010453667.1|  PREDICTED: cystathionine gamma-synthase, chl...    294   7e-93    
ref|XP_006858075.1|  hypothetical protein AMTR_s00062p00067400          294   7e-93    Amborella trichopoda
gb|KDO72635.1|  hypothetical protein CISIN_1g0091671mg                  280   2e-92    Citrus sinensis [apfelsine]
gb|ABI34092.1|  cystathionine gamma-synthase                            293   2e-92    Medicago sativa [alfalfa]
ref|XP_010937206.1|  PREDICTED: cystathionine gamma-synthase, chl...    293   2e-92    Elaeis guineensis
ref|XP_010939832.1|  PREDICTED: cystathionine gamma-synthase, chl...    292   5e-92    Elaeis guineensis
gb|KDO72629.1|  hypothetical protein CISIN_1g0091673mg                  278   8e-92    Citrus sinensis [apfelsine]
ref|XP_010495203.1|  PREDICTED: cystathionine gamma-synthase, chl...    287   1e-91    
ref|XP_003621272.1|  Cystathionine gamma-synthase                       290   3e-91    Medicago truncatula
ref|XP_006400053.1|  hypothetical protein EUTSA_v10015332mg             285   2e-90    
gb|AGA60137.1|  cystathionine gamma-synthase                            288   2e-90    Lens culinaris
emb|CDX90997.1|  BnaC02g06000D                                          286   2e-90    
ref|XP_009409044.1|  PREDICTED: cystathionine gamma-synthase, chl...    287   4e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010424106.1|  PREDICTED: cystathionine gamma-synthase, chl...    281   3e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006400056.1|  hypothetical protein EUTSA_v10013649mg             277   3e-89    
ref|XP_006400055.1|  hypothetical protein EUTSA_v10013649mg             277   1e-88    
emb|CDX69530.1|  BnaA10g18790D                                          278   2e-88    
ref|NP_001274915.1|  cystathionine-gamma-synthase                       283   6e-88    
ref|XP_006400054.1|  hypothetical protein EUTSA_v10013649mg             278   8e-88    Eutrema salsugineum [saltwater cress]
ref|XP_009122874.1|  PREDICTED: cystathionine gamma-synthase, chl...    277   2e-87    
tpg|DAA45549.1|  TPA: hypothetical protein ZEAMMB73_196241              266   8e-86    
ref|XP_010937207.1|  PREDICTED: cystathionine gamma-synthase, chl...    275   1e-85    Elaeis guineensis
tpg|DAA45550.1|  TPA: hypothetical protein ZEAMMB73_196241              267   2e-85    
ref|XP_008800507.1|  PREDICTED: cystathionine gamma-synthase, chl...    262   2e-85    Phoenix dactylifera
gb|EEC75352.1|  hypothetical protein OsI_11784                          264   3e-85    Oryza sativa Indica Group [Indian rice]
gb|ACF82119.1|  unknown                                                 267   7e-85    Zea mays [maize]
ref|XP_009404092.1|  PREDICTED: cystathionine gamma-synthase, chl...    273   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG51206.1|AC051630_3  cystathionine gamma-synthase, putative;...    268   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465206.1|  hypothetical protein SORBIDRAFT_01g034130          266   3e-84    
gb|ABF96222.1|  Cys/Met metabolism PLP-dependent enzyme family pr...    265   3e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EEE59137.1|  hypothetical protein OsJ_11031                          265   4e-84    Oryza sativa Japonica Group [Japonica rice]
ref|NP_174600.1|  Pyridoxal phosphate (PLP)-dependent transferase...    268   4e-84    Arabidopsis thaliana [mouse-ear cress]
gb|AAG38873.1|AF076495_1  cystathionine gamma-synthase                  266   8e-84    Oryza sativa [red rice]
gb|EMT23437.1|  Cystathionine gamma-synthase, chloroplastic             270   1e-83    
ref|NP_001050220.1|  Os03g0376100                                       265   1e-83    
ref|XP_010499872.1|  PREDICTED: cystathionine gamma-synthase, chl...    266   1e-83    Camelina sativa [gold-of-pleasure]
gb|ACF83809.1|  unknown                                                 263   2e-83    Zea mays [maize]
gb|KEH25015.1|  cystathionine gamma-synthase                            267   4e-83    Medicago truncatula
ref|XP_003618534.1|  Cystathionine-gamma-synthase                       267   4e-83    Medicago truncatula
ref|XP_003557832.1|  PREDICTED: cystathionine gamma-synthase, chl...    268   6e-83    
gb|AAL82522.1|AC084766_8  putative cystathionine gamma synthase         266   7e-83    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001104875.1|  cystathionine gamma-synthase1                      268   7e-83    
dbj|BAJ84799.1|  predicted protein                                      266   2e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16369.1|  unknown                                                 267   2e-82    Picea sitchensis
ref|XP_010478750.1|  PREDICTED: cystathionine gamma-synthase, chl...    263   3e-82    Camelina sativa [gold-of-pleasure]
gb|ABF96221.1|  Cys/Met metabolism PLP-dependent enzyme family pr...    265   5e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010461154.1|  PREDICTED: cystathionine gamma-synthase, chl...    262   5e-82    Camelina sativa [gold-of-pleasure]
ref|XP_004172088.1|  PREDICTED: cystathionine gamma-synthase, chl...    253   7e-82    
ref|NP_001130426.1|  uncharacterized protein LOC100191523               264   7e-82    Zea mays [maize]
ref|XP_004984247.1|  PREDICTED: cystathionine gamma-synthase, chl...    265   8e-82    Setaria italica
gb|AFW87953.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    264   1e-81    
ref|XP_010461152.1|  PREDICTED: cystathionine gamma-synthase, chl...    262   1e-81    Camelina sativa [gold-of-pleasure]
gb|AAB61348.1|  cystathionine gamma-synthase                            264   2e-81    Zea mays [maize]
ref|XP_009772869.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    262   2e-81    Nicotiana sylvestris
ref|XP_001761633.1|  predicted protein                                  252   1e-76    
ref|XP_002965872.1|  hypothetical protein SELMODRAFT_143363             248   1e-75    
ref|XP_002983120.1|  hypothetical protein SELMODRAFT_155550             248   2e-75    
ref|XP_001772529.1|  predicted protein                                  249   2e-75    
gb|KJB75687.1|  hypothetical protein B456_012G052100                    245   4e-74    Gossypium raimondii
gb|EMS45856.1|  Cystathionine gamma-synthase, chloroplastic             249   1e-73    Triticum urartu
ref|XP_003057119.1|  predicted protein                                  231   2e-70    Micromonas pusilla CCMP1545
ref|XP_003561880.1|  PREDICTED: cystathionine gamma-synthase, chl...    232   1e-69    Brachypodium distachyon [annual false brome]
ref|XP_009602125.1|  PREDICTED: cystathionine gamma-synthase, chl...    233   4e-69    Nicotiana tomentosiformis
ref|XP_009775846.1|  PREDICTED: cystathionine gamma-synthase, chl...    231   6e-69    Nicotiana sylvestris
gb|EMT09613.1|  Cystathionine gamma-synthase, chloroplastic             228   6e-68    
ref|XP_003081090.1|  O-succinylhomoserine (ISS)                         223   7e-68    
dbj|BAJ93384.1|  predicted protein                                      227   8e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007510517.1|  cystathionine gamma-synthase                       227   9e-68    Bathycoccus prasinos
gb|EMS47533.1|  Cystathionine gamma-synthase, chloroplastic             227   9e-68    Triticum urartu
ref|XP_005651362.1|  cystathionine gamma-synthase                       227   2e-67    Coccomyxa subellipsoidea C-169
ref|XP_004983123.1|  PREDICTED: cystathionine gamma-synthase, chl...    226   2e-67    Setaria italica
ref|NP_001064539.1|  Os10g0399200                                       225   9e-67    
ref|XP_001419722.1|  cystathione gamma synthase                         224   1e-66    Ostreococcus lucimarinus CCE9901
emb|CEF98968.1|  Pyridoxal phosphate-dependent transferase, major...    223   1e-66    Ostreococcus tauri
ref|XP_002467292.1|  hypothetical protein SORBIDRAFT_01g023050          224   1e-66    Sorghum bicolor [broomcorn]
gb|EMT09614.1|  Cystathionine gamma-synthase, chloroplastic             223   3e-66    
gb|EAY78389.1|  hypothetical protein OsI_33476                          223   4e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_002506028.1|  predicted protein                                  220   6e-66    Micromonas commoda
ref|XP_008666693.1|  PREDICTED: cystathionine gamma-synthase, chl...    221   3e-65    Zea mays [maize]
gb|KDD72103.1|  Cys/Met metabolism PLP-dependent enzyme                 211   5e-65    Helicosporidium sp. ATCC 50920
ref|XP_008666694.1|  PREDICTED: cystathionine gamma-synthase, chl...    219   9e-65    Zea mays [maize]
tpg|DAA50063.1|  TPA: hypothetical protein ZEAMMB73_244612              219   9e-65    
gb|EAY78386.1|  hypothetical protein OsI_33473                          219   1e-64    Oryza sativa Indica Group [Indian rice]
ref|XP_005846526.1|  hypothetical protein CHLNCDRAFT_24830              218   1e-64    Chlorella variabilis
ref|NP_001064540.1|  Os10g0399700                                       219   2e-64    
gb|AAK50404.1|AC021891_5  Putative O-succinylhomoserine (thiol)-l...    220   2e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661751.1|  PREDICTED: cystathionine gamma-synthase, chl...    219   2e-64    Oryza brachyantha
gb|KIZ06880.1|  cystathionine gamma-synthase                            226   5e-64    Monoraphidium neglectum
ref|XP_006662330.1|  PREDICTED: cystathionine gamma-synthase, chl...    216   2e-63    
gb|AFW87952.1|  hypothetical protein ZEAMMB73_590146                    208   4e-62    
gb|EEC80304.1|  hypothetical protein OsI_22339                          210   6e-62    Oryza sativa Indica Group [Indian rice]
ref|XP_001695742.1|  cystathionine gamma-synthase                       211   2e-61    Chlamydomonas reinhardtii
ref|XP_007024260.1|  Pyridoxal phosphate (PLP)-dependent transfer...    205   2e-61    
ref|XP_002953537.1|  hypothetical protein VOLCADRAFT_75793              210   4e-61    Volvox carteri f. nagariensis
gb|EEE65425.1|  hypothetical protein OsJ_20780                          207   9e-61    Oryza sativa Japonica Group [Japonica rice]
gb|EMT05299.1|  Cystathionine gamma-synthase, chloroplastic             207   1e-59    
ref|XP_011397361.1|  Cystathionine gamma-synthase, chloroplastic        202   5e-59    Auxenochlorella protothecoides
dbj|BAD37853.1|  putative O-succinylhomoserine (thiol)-lyase            202   2e-58    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ15990.1|  hypothetical protein OsJ_31434                          202   2e-58    Oryza sativa Japonica Group [Japonica rice]
ref|WP_012828513.1|  cystathionine gamma-synthase                       200   4e-58    Haliangium ochraceum
gb|ETW97684.1|  hypothetical protein ETSY2_44200                        193   1e-57    Candidatus Entotheonella gemina
ref|WP_006563164.1|  cystathionine gamma-synthase                       199   1e-57    Oscillochloris trichoides
ref|WP_029671929.1|  cystathionine gamma-synthase                       197   4e-57    
ref|WP_015940702.1|  cystathionine gamma-synthase                       195   5e-56    Chloroflexus aggregans
ref|WP_012257342.1|  MULTISPECIES: cystathionine gamma-synthase         194   1e-55    Chloroflexus aurantiacus
ref|WP_034419446.1|  cystathionine gamma-synthase                       193   2e-55    
ref|WP_028458069.1|  cystathionine gamma-synthase                       192   5e-55    Chloroflexus sp. Y-396-1
ref|WP_031459521.1|  cystathionine gamma-synthase                       192   6e-55    Chloroflexus sp. MS-G
gb|EMT09615.1|  Cystathionine gamma-synthase, chloroplastic             193   2e-54    
ref|WP_020740637.1|  cystathionine beta-lyase                           190   3e-54    
ref|WP_012240206.1|  cystathionine gamma-synthase                       188   2e-53    Sorangium cellulosum
ref|WP_041903797.1|  cystathionine gamma-synthase                       186   7e-53    
ref|WP_012174821.1|  cystathionine gamma-synthase                       181   6e-51    Desulfococcus oleovorans
ref|WP_002653306.1|  cystathionine gamma-synthase                       181   1e-50    Blastopirellula marina
ref|WP_007334081.1|  cystathionine gamma-synthase                       179   5e-50    Rhodopirellula baltica
ref|WP_007324756.1|  cystathionine gamma-synthase                       179   5e-50    Rhodopirellula baltica
ref|WP_011120920.1|  cystathionine gamma-synthase                       179   8e-50    Rhodopirellula baltica
ref|WP_008655459.1|  methionine gamma-lyase                             179   1e-49    Rhodopirellula europaea
ref|WP_007339059.1|  methionine gamma-lyase                             177   4e-49    Rhodopirellula baltica
ref|WP_037466783.1|  cystathionine gamma-synthase                       174   3e-48    
ref|WP_014432877.1|  cystathionine gamma-synthase                       174   3e-48    Caldilinea aerophila
gb|ABB47533.1|  Cys/Met metabolism PLP-dependent enzyme family pr...    174   5e-48    Oryza sativa Japonica Group [Japonica rice]
ref|WP_008695126.1|  methionine gamma-lyase                             173   8e-48    Rhodopirellula maiorica
ref|WP_036745737.1|  hypothetical protein                               172   2e-47    
gb|EMS50136.1|  Cystathionine gamma-synthase, chloroplastic             164   3e-47    Triticum urartu
ref|WP_012912576.1|  cystathionine gamma-synthase                       171   1e-46    Pirellula staleyi
ref|WP_044251002.1|  cystathionine gamma-synthase                       170   3e-46    Rhodopirellula sp. SWK7
gb|EMI46706.1|  methionine gamma-lyase                                  170   3e-46    Rhodopirellula sp. SWK7
ref|XP_005702997.1|  cystathionine gamma-synthase                       170   2e-45    Galdieria sulphuraria
ref|WP_044302136.1|  cystathionine gamma-synthase                       167   2e-45    
gb|KJB75686.1|  hypothetical protein B456_012G052100                    168   2e-45    Gossypium raimondii
gb|EMI56348.1|  cystathionine gamma synthase                            167   3e-45    Rhodopirellula sallentina SM41
gb|KHD07814.1|  Cys/Met metabolism pyridoxal-phosphate-dependent ...    166   3e-45    
dbj|BAL55052.1|  cystathionine gamma-lyase                              166   4e-45    uncultured Acidobacteria bacterium
gb|KIG18323.1|  Cystathionine gamma-synthase                            166   5e-45    Enhygromyxa salina
ref|WP_009709642.1|  cystathionine gamma-synthase                       166   6e-45    Desmospora sp. 8437
ref|WP_034152361.1|  cystathionine beta-lyase                           165   1e-44    Pseudomonas fluorescens
ref|WP_016987095.1|  cystathionine beta-lyase                           165   1e-44    Pseudomonas
ref|WP_013905610.1|  cystathionine beta-lyase                           164   2e-44    Pyrococcus yayanosii
ref|WP_043248620.1|  cystathionine beta-lyase                           164   3e-44    Pseudomonas knackmussii
ref|WP_018150728.1|  methionine gamma-lyase                             163   4e-44    Leeia oryzae
ref|WP_012501926.1|  cystathionine beta-lyase                           163   5e-44    Chlorobaculum parvum
ref|WP_004068005.1|  cystathionine beta-lyase                           163   6e-44    Thermococcus litoralis
ref|WP_042681523.1|  cystathionine gamma-synthase                       162   7e-44    Thermococcus paralvinellae
ref|WP_009034610.1|  cystathionine gamma-synthase                       162   9e-44    Indibacter alkaliphilus
ref|WP_027178852.1|  cystathionine gamma-synthase                       162   1e-43    Desulfovibrio bastinii
ref|WP_027621174.1|  cystathionine beta-lyase                           162   1e-43    Pseudomonas sp. URHB0015
ref|WP_007999877.1|  cystathionine beta-lyase                           162   2e-43    Pseudomonas sp. GM49
ref|WP_038368044.1|  cystathionine beta-lyase                           162   2e-43    Pseudomonas chlororaphis
ref|WP_007931537.1|  cystathionine beta-lyase                           162   2e-43    Pseudomonas
ref|WP_018926010.1|  MULTISPECIES: cystathionine beta-lyase             162   2e-43    Pseudomonas
ref|WP_009042798.1|  cystathionine beta-lyase                           162   2e-43    Pseudomonas
ref|WP_028940547.1|  cystathionine beta-lyase                           162   2e-43    Pseudomonas umsongensis
ref|WP_019649893.1|  cystathionine beta-lyase                           162   2e-43    Pseudomonas sp. 45MFCol3.1
ref|WP_008039031.1|  cystathionine beta-lyase                           161   2e-43    Pseudomonas sp. GM67
ref|WP_009858211.1|  cystathionine beta-lyase                           161   2e-43    Rubrivivax benzoatilyticus
ref|WP_008027244.1|  cystathionine beta-lyase                           161   3e-43    Pseudomonas sp. GM60
ref|WP_043269495.1|  cystathionine beta-lyase                           161   3e-43    Pseudomonas
ref|WP_008019625.1|  cystathionine beta-lyase                           161   3e-43    Pseudomonas sp. GM55
ref|WP_043317852.1|  cystathionine beta-lyase                           161   3e-43    Pseudomonas sp. PI1
ref|WP_010169730.1|  cystathionine beta-lyase                           161   3e-43    Pseudomonas sp. PAMC 25886
ref|WP_017338177.1|  cystathionine beta-lyase                           161   3e-43    Pseudomonas fluorescens
ref|WP_008006048.1|  cystathionine beta-lyase                           161   3e-43    Pseudomonas sp. GM50
ref|WP_007918059.1|  MULTISPECIES: cystathionine beta-lyase             160   4e-43    Pseudomonas
ref|WP_008085129.1|  cystathionine beta-lyase                           160   4e-43    Pseudomonas sp. GM80
ref|WP_027613062.1|  cystathionine beta-lyase                           160   4e-43    Pseudomonas sp. URIL14HWK12:I6
ref|WP_034633929.1|  cystathionine gamma-synthase                       154   5e-43    
ref|WP_016979942.1|  cystathionine beta-lyase                           160   5e-43    Pseudomonas fluorescens
gb|AIF70130.1|  cystathionine beta-lyase                                160   5e-43    Palaeococcus pacificus DY20341
ref|WP_008069856.1|  cystathionine beta-lyase                           160   5e-43    Pseudomonas sp. GM79
ref|WP_025856711.1|  cystathionine beta-lyase                           160   5e-43    Pseudomonas sp. CHM02
ref|WP_006976115.1|  cystathionine gamma-synthase                       160   6e-43    
ref|WP_007896198.1|  cystathionine beta-lyase                           160   6e-43    Pseudomonas sp. GM102
ref|WP_011334626.1|  cystathionine beta-lyase                           160   7e-43    Pseudomonas
ref|WP_038983351.1|  cystathionine beta-lyase                           160   7e-43    Pseudomonas
ref|WP_041062583.1|  cystathionine beta-lyase                           160   8e-43    Pseudomonas
ref|WP_039108500.1|  cystathionine gamma-synthase                       160   8e-43    Flavobacterium sp. AED
ref|WP_007957389.1|  cystathionine beta-lyase                           160   8e-43    Pseudomonas
ref|WP_007965729.1|  cystathionine beta-lyase                           160   8e-43    Pseudomonas sp. GM30
ref|WP_013905650.1|  cystathionine beta-lyase                           160   9e-43    Pyrococcus yayanosii
ref|WP_030130242.1|  cystathionine beta-lyase                           160   9e-43    Pseudomonas sp. QTF5
gb|EZP32506.1|  cystathionine gamma-lyase                               160   9e-43    Pseudomonas sp. RIT288
ref|WP_007945159.1|  cystathionine beta-lyase                           160   9e-43    Pseudomonas sp. GM21
ref|WP_042606757.1|  cystathionine beta-lyase                           159   1e-42    Pseudomonas fluorescens
ref|WP_019579019.1|  O-succinylhomoserine sulfhydrylase                 160   1e-42    Pseudomonas mandelii
ref|WP_033055870.1|  cystathionine beta-lyase                           159   1e-42    Pseudomonas mandelii
ref|WP_013467658.1|  cystathionine beta-lyase                           159   1e-42    Thermococcus barophilus
ref|WP_017520122.1|  cystathionine beta-lyase                           159   1e-42    Pseudomonas nitroreducens
ref|WP_025111620.1|  cystathionine beta-lyase                           159   1e-42    Pseudomonas sp. H1h
ref|WP_039766902.1|  cystathionine beta-lyase                           159   1e-42    Pseudomonas fluorescens
ref|WP_042342462.1|  methionine gamma-lyase                             160   1e-42    
ref|WP_038849655.1|  cystathionine beta-lyase                           159   1e-42    Pseudomonas fluorescens
ref|WP_017475516.1|  cystathionine beta-lyase                           159   1e-42    Pseudomonas sp. PAMC 26793
ref|WP_033896563.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas fluorescens group
ref|WP_010456815.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas mandelii
ref|WP_044461938.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas
ref|WP_009615241.1|  putative cystathionine gamma-lyase                 159   2e-42    Pseudomonas sp. M1
ref|WP_027608451.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas
ref|WP_019690673.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas fluorescens
ref|WP_008436288.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas
ref|WP_007987063.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas sp. GM48
ref|WP_003225733.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas fluorescens
ref|WP_017906920.1|  cystathionine beta-lyase                           159   2e-42    Pseudomonas fuscovaginae
ref|WP_035669220.1|  cystathionine gamma-synthase                       158   2e-42    
ref|WP_016970165.1|  cystathionine beta-lyase                           159   2e-42    
ref|WP_007420916.1|  cystathionine beta-lyase                           159   3e-42    
ref|WP_007976078.1|  MULTISPECIES: cystathionine beta-lyase             159   3e-42    
ref|WP_022541518.1|  cystathionine gamma-lyase                          158   3e-42    
ref|WP_007936634.1|  cystathionine beta-lyase                           159   3e-42    
ref|WP_021273496.1|  cystathionine beta-lyase                           158   3e-42    
ref|WP_040067071.1|  cystathionine beta-lyase                           158   4e-42    
ref|WP_016702204.1|  O-succinylhomoserine sulfhydrylase                 158   4e-42    
ref|WP_015243721.1|  cystathionine gamma-synthase                       158   4e-42    
ref|WP_014322773.1|  cystathionine gamma-synthase                       158   4e-42    
ref|WP_007412771.1|  cystathionine gamma-synthase                       158   4e-42    
ref|WP_012724563.1|  cystathionine beta-lyase                           158   4e-42    
ref|WP_035663612.1|  cystathionine gamma-synthase                       158   5e-42    
ref|WP_035636324.1|  cystathionine gamma-synthase                       157   5e-42    
ref|WP_025805270.1|  cystathionine beta-lyase                           158   5e-42    
ref|WP_015475134.1|  cystathionine gamma-lyase                          158   5e-42    
ref|WP_027310268.1|  cystathionine gamma-synthase                       157   5e-42    
ref|WP_028681905.1|  cystathionine beta-lyase                           157   6e-42    
ref|WP_039763077.1|  cystathionine beta-lyase                           157   6e-42    
ref|WP_009047777.1|  cystathionine beta-lyase                           157   6e-42    
ref|WP_003173743.1|  cystathionine beta-lyase                           157   6e-42    
ref|WP_015374550.1|  MULTISPECIES: cystathionine gamma-synthase         157   7e-42    
ref|WP_008049666.1|  cystathionine beta-lyase                           157   7e-42    
ref|WP_023968374.1|  cystathionine beta-lyase                           157   7e-42    
dbj|GAM27720.1|  hypothetical protein SAMD00019534_108960               157   7e-42    
ref|WP_043903364.1|  methionine gamma-lyase                             157   8e-42    
ref|WP_024013201.1|  cystathionine beta-lyase                           157   8e-42    
ref|WP_017437713.1|  methionine gamma-lyase                             157   8e-42    
ref|WP_034134968.1|  cystathionine beta-lyase                           157   8e-42    
ref|WP_003191636.1|  cystathionine beta-lyase                           157   8e-42    
ref|WP_036317152.1|  cystathionine gamma-synthase                       151   8e-42    
ref|WP_016775028.1|  cystathionine beta-lyase                           157   9e-42    
ref|WP_042411373.1|  methionine gamma-lyase                             157   9e-42    
ref|WP_008061126.1|  cystathionine beta-lyase                           157   9e-42    
ref|WP_032880897.1|  cystathionine beta-lyase                           157   9e-42    
ref|WP_019817159.1|  MULTISPECIES: putative cystathionine gamma-s...    157   9e-42    
ref|WP_038580993.1|  cystathionine beta-lyase                           157   9e-42    
ref|WP_019408015.1|  cystathionine beta-lyase                           157   1e-41    
ref|WP_020302292.1|  putative cystathionine gamma-synthase              157   1e-41    
ref|WP_032897041.1|  cystathionine beta-lyase                           157   1e-41    
ref|WP_014718631.1|  MULTISPECIES: cystathionine beta-lyase             157   1e-41    
ref|WP_003215115.1|  cystathionine beta-lyase                           157   1e-41    
gb|KDO72637.1|  hypothetical protein CISIN_1g0091671mg                  148   1e-41    
ref|WP_028852232.1|  cystathionine beta-lyase                           156   1e-41    
ref|WP_004044791.1|  cystathionine beta-lyase                           157   1e-41    
ref|WP_041480052.1|  cystathionine beta-lyase                           156   2e-41    
gb|KFH67597.1|  cystathionine gamma-lyase                               157   2e-41    
ref|WP_035127615.1|  cystathionine gamma-synthase                       156   2e-41    
ref|WP_041961175.1|  methionine gamma-lyase                             153   2e-41    
ref|WP_014387246.1|  cystathionine beta-lyase                           156   2e-41    
ref|WP_028616324.1|  cystathionine beta-lyase                           156   2e-41    
ref|WP_005787968.1|  cystathionine beta-lyase                           156   2e-41    
ref|WP_004066012.1|  MULTISPECIES: cystathionine gamma-synthase         156   2e-41    
ref|WP_034150558.1|  cystathionine beta-lyase                           156   2e-41    
ref|WP_034119841.1|  cystathionine beta-lyase                           156   2e-41    
ref|WP_030162325.1|  cystathionine beta-lyase                           156   2e-41    
ref|WP_044871042.1|  cystathionine beta-lyase                           156   2e-41    
ref|WP_032902946.1|  cystathionine beta-lyase                           156   3e-41    
ref|WP_004974217.1|  MULTISPECIES: cystathionine gamma-synthase         155   3e-41    
ref|WP_008148631.1|  cystathionine beta-lyase                           156   3e-41    
ref|WP_003247687.1|  MULTISPECIES: methionine gamma-lyase               156   3e-41    
ref|WP_010932383.1|  cystathionine beta-lyase                           155   3e-41    
ref|WP_010448363.1|  cystathionine beta-lyase                           155   3e-41    
ref|WP_038611749.1|  cystathionine beta-lyase                           155   3e-41    
ref|WP_036175292.1|  methionine gamma-lyase                             155   3e-41    
ref|WP_026716757.1|  cystathionine gamma-synthase                       155   3e-41    
ref|WP_026964173.1|  methionine gamma-lyase                             155   4e-41    
ref|WP_038995966.1|  cystathionine beta-lyase                           155   4e-41    
ref|WP_034733831.1|  cystathionine beta-lyase                           155   4e-41    
ref|WP_043864321.1|  cystathionine beta-lyase                           155   4e-41    
ref|WP_024766754.1|  cystathionine beta-lyase                           155   4e-41    
ref|XP_004336485.1|  cystathionine gammasynthase                        155   4e-41    
ref|WP_024075784.1|  cystathionine beta-lyase                           155   4e-41    
gb|EWG07846.1|  hypothetical protein ASUL_02344                         155   4e-41    
ref|WP_041072964.1|  methionine gamma-lyase                             155   4e-41    
ref|WP_039113148.1|  MULTISPECIES: cystathionine gamma-synthase         155   4e-41    
ref|XP_004341366.1|  Cys/Met metabolism PLPdependent enzyme super...    155   5e-41    
ref|WP_020796352.1|  MULTISPECIES: cystathionine beta-lyase/cysta...    155   5e-41    
ref|WP_044273377.1|  cystathionine beta-lyase                           155   5e-41    
ref|WP_027922429.1|  cystathionine beta-lyase                           155   6e-41    
ref|WP_043047775.1|  cystathionine beta-lyase                           155   6e-41    
ref|WP_015893710.1|  methionine gamma-lyase                             155   6e-41    
ref|WP_008576394.1|  MULTISPECIES: cystathionine gamma-synthase         155   6e-41    
ref|WP_039837665.1|  methionine gamma-lyase                             155   6e-41    
ref|WP_042205508.1|  methionine gamma-lyase                             155   6e-41    
ref|WP_042565513.1|  cystathionine gamma-synthase                       154   7e-41    
ref|WP_017127486.1|  cystathionine beta-lyase                           155   7e-41    
gb|EPZ51796.1|  cystathionine beta-lyase                                155   7e-41    
ref|WP_013749046.1|  cystathionine beta-lyase                           155   7e-41    
ref|WP_036599226.1|  methionine gamma-lyase                             155   7e-41    
ref|WP_026989801.1|  cystathionine gamma-synthase                       154   8e-41    
ref|WP_040313960.1|  cystathionine gamma-synthase                       154   8e-41    
ref|WP_010226471.1|  MULTISPECIES: cystathionine beta-lyase             155   8e-41    
ref|XP_003284098.1|  cystathionine gamma-lyase                          154   8e-41    
ref|WP_034040647.1|  cystathionine beta-lyase                           153   8e-41    
ref|WP_010606739.1|  methionine gamma-lyase                             154   9e-41    
ref|WP_020611640.1|  methionine gamma-lyase                             154   9e-41    
ref|WP_017216112.1|  methionine gamma-lyase                             154   9e-41    
ref|WP_010371197.1|  methionine gamma-lyase                             154   9e-41    
ref|WP_007274716.1|  cystathionine gamma-synthase                       154   9e-41    
ref|WP_040262032.1|  cystathionine beta-lyase                           154   1e-40    
ref|WP_033100917.1|  methionine gamma-lyase                             154   1e-40    
ref|WP_035525686.1|  methionine gamma-lyase                             154   1e-40    
ref|WP_032885295.1|  cystathionine beta-lyase                           154   1e-40    
ref|WP_028308971.1|  methionine gamma-lyase                             154   1e-40    
ref|WP_004968670.1|  cystathionine gamma-synthase                       154   1e-40    
ref|WP_034104975.1|  cystathionine beta-lyase                           154   1e-40    
ref|WP_013276329.1|  methionine gamma-lyase                             154   1e-40    
ref|WP_035617629.1|  cystathionine gamma-synthase                       154   1e-40    
ref|WP_007720575.1|  methionine gamma-lyase                             154   1e-40    
ref|WP_021328787.1|  Cys/Met metabolism pyridoxal-phosphate-depen...    154   1e-40    
ref|WP_027362967.1|  cystathionine gamma-synthase                       154   1e-40    
ref|WP_022542028.1|  cystathionine gamma-synthase                       154   1e-40    
ref|WP_011997433.1|  cystathionine beta-lyase                           154   1e-40    
ref|WP_039497091.1|  methionine gamma-lyase                             154   1e-40    
ref|WP_010567973.1|  cystathionine beta-lyase                           154   2e-40    
ref|WP_028621680.1|  cystathionine beta-lyase                           154   2e-40    
ref|WP_004967707.1|  cystathionine gamma-synthase                       151   2e-40    
ref|WP_011320837.1|  cystathionine beta-lyase                           154   2e-40    
ref|WP_036184693.1|  methionine gamma-lyase                             154   2e-40    
ref|WP_039790759.1|  methionine gamma-lyase                             154   2e-40    
ref|WP_028629512.1|  cystathionine beta-lyase                           154   2e-40    
ref|WP_028102445.1|  cystathionine beta-lyase                           154   2e-40    
ref|WP_007136971.1|  cystathionine beta-lyase                           153   2e-40    
emb|CBH39218.1|  Cys/Met metabolism PLP-dependent enzyme family p...    154   2e-40    
ref|WP_017252446.1|  methionine gamma-lyase                             154   2e-40    
ref|WP_006965184.1|  cystathionine gamma-synthase MetB                  153   2e-40    
ref|WP_003353106.1|  methionine gamma-lyase                             154   2e-40    
ref|WP_017131917.1|  cystathionine beta-lyase                           153   2e-40    
ref|XP_005818465.1|  hypothetical protein GUITHDRAFT_159042             154   2e-40    
ref|WP_024334154.1|  cystathionine gamma-synthase                       153   2e-40    
gb|EGQ26448.1|  cystathionine beta-lyase                                154   2e-40    
ref|WP_031686325.1|  cystathionine beta-lyase                           153   3e-40    
ref|WP_024918011.1|  cystathionine beta-lyase                           153   3e-40    
ref|WP_001242786.1|  cystathionine beta-lyase                           153   3e-40    
dbj|GAM21339.1|  hypothetical protein SAMD00019534_045140               153   3e-40    
ref|WP_040933890.1|  cystathionine beta-lyase                           153   3e-40    
ref|WP_042559531.1|  cystathionine beta-lyase                           153   3e-40    
ref|WP_010958610.1|  cystathionine beta-lyase                           153   3e-40    
ref|WP_021279072.1|  Cys/Met metabolism PLP-dependent enzyme            153   3e-40    
ref|WP_032413379.1|  cystathionine gamma-synthase                       153   3e-40    
ref|WP_034009517.1|  cystathionine beta-lyase                           153   3e-40    
gb|KIX20649.1|  cystathionine gamma-synthase                            153   3e-40    
ref|WP_025333516.1|  methionine gamma-lyase                             153   3e-40    
ref|WP_003157910.1|  cystathionine gamma-lyase                          153   3e-40    
ref|WP_025703025.1|  methionine gamma-lyase                             153   4e-40    
ref|WP_017731179.1|  hypothetical protein                               152   4e-40    
gb|KFP71606.1|  Cystathionine gamma-lyase                               152   4e-40    
gb|EQC49607.1|  Cys/Met metabolism PLP-dependent enzyme                 152   4e-40    
ref|WP_005769800.1|  cystathionine beta-lyase                           152   4e-40    
ref|WP_003084564.1|  cystathionine beta-lyase                           152   4e-40    
ref|WP_006423786.1|  methionine gamma-lyase                             153   4e-40    
ref|WP_034727572.1|  cystathionine gamma-synthase                       152   5e-40    
ref|WP_018664726.1|  methionine gamma-lyase                             152   5e-40    
ref|WP_043105866.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_033980153.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_019395777.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_040759024.1|  methionine gamma-lyase                             152   5e-40    
ref|WP_044061315.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_023114752.1|  cystathionine gamma-lyase                          152   5e-40    
ref|XP_009070878.1|  PREDICTED: cystathionine gamma-lyase               152   5e-40    
ref|WP_025688083.1|  methionine gamma-lyase                             153   5e-40    
ref|WP_012073996.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_035377727.1|  methionine gamma-lyase                             152   5e-40    
ref|WP_025324561.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_012020635.1|  hypothetical protein                               152   5e-40    
ref|WP_034080815.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_034014750.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_015649763.1|  putative cystathionine gamma-lyase                 152   5e-40    
ref|WP_034033911.1|  cystathionine beta-lyase                           152   5e-40    
ref|WP_014163641.1|  cystathionine gamma-synthase                       152   5e-40    
ref|WP_024979814.1|  cystathionine gamma-synthase                       152   5e-40    
ref|WP_003117897.1|  MULTISPECIES: cystathionine beta-lyase             152   5e-40    
ref|WP_023130970.1|  cystathionine gamma-lyase                          152   5e-40    
ref|WP_040371317.1|  cystathionine gamma-synthase                       152   5e-40    
ref|WP_020213859.1|  cystathionine beta-lyase                           152   6e-40    
ref|WP_040953457.1|  cystathionine beta-lyase                           152   6e-40    
ref|WP_014404176.1|  cystathionine beta-lyase                           152   6e-40    
ref|WP_029921292.1|  cystathionine beta-lyase                           152   6e-40    
gb|EPR30603.1|  Cys/Met metabolism pyridoxal-phosphate-dependent ...    152   6e-40    
ref|WP_034036828.1|  cystathionine beta-lyase                           152   6e-40    
ref|WP_034012071.1|  cystathionine beta-lyase                           152   6e-40    
ref|WP_016852373.1|  cystathionine beta-lyase                           152   6e-40    
ref|WP_003351060.1|  methionine gamma-lyase                             152   6e-40    
ref|WP_038402512.1|  cystathionine beta-lyase                           152   6e-40    
ref|WP_043510793.1|  cystathionine beta-lyase                           152   6e-40    
ref|WP_038340712.1|  hypothetical protein                               152   6e-40    
ref|WP_005225940.1|  cystathionine beta-lyase                           152   7e-40    
ref|WP_028534157.1|  cystathionine beta-lyase                           152   7e-40    
ref|WP_034043751.1|  cystathionine beta-lyase                           152   7e-40    
ref|WP_012220028.1|  cystathionine beta-lyase                           152   7e-40    
ref|WP_034027509.1|  cystathionine beta-lyase                           152   7e-40    
ref|WP_015372194.1|  Cystathionine beta-lyase                           152   7e-40    
ref|WP_033955000.1|  cystathionine beta-lyase                           152   7e-40    
ref|WP_006205341.1|  cystathionine beta-lyase                           152   7e-40    
ref|WP_023088754.1|  cystathionine gamma-lyase                          152   7e-40    
ref|WP_033877411.1|  cystathionine beta-lyase                           152   7e-40    
ref|WP_043094761.1|  cystathionine beta-lyase                           152   8e-40    
ref|WP_003100953.1|  MULTISPECIES: cystathionine beta-lyase             152   8e-40    
ref|WP_034053272.1|  cystathionine beta-lyase                           152   8e-40    
ref|WP_033871616.1|  cystathionine beta-lyase                           152   8e-40    
ref|WP_003110017.1|  MULTISPECIES: cystathionine beta-lyase             152   8e-40    
ref|WP_031756654.1|  cystathionine beta-lyase                           152   8e-40    
ref|WP_023086800.1|  cystathionine gamma-lyase                          152   8e-40    
ref|WP_033993068.1|  cystathionine beta-lyase                           152   8e-40    
ref|WP_026983630.1|  cystathionine gamma-synthase                       152   8e-40    
ref|WP_040492800.1|  cystathionine gamma-synthase                       152   8e-40    
ref|WP_018399711.1|  hypothetical protein                               152   8e-40    
ref|WP_018718898.1|  hypothetical protein                               152   8e-40    
ref|WP_025693850.1|  methionine gamma-lyase                             152   8e-40    
ref|WP_003755281.1|  cystathionine beta-lyase                           152   9e-40    
ref|WP_003348109.1|  methionine gamma-lyase                             152   9e-40    
ref|WP_016490246.1|  putative cystathionine gamma-lyase                 152   1e-39    
gb|EAA23213.1|  Methionine gamma-lyase                                  147   1e-39    
ref|WP_015509599.1|  cystathionine beta-lyase                           151   1e-39    
ref|WP_023116000.1|  cystathionine gamma-lyase                          152   1e-39    
ref|WP_025151570.1|  methionine gamma-lyase                             152   1e-39    
ref|WP_022588007.1|  cystathionine beta-lyase                           151   1e-39    
ref|WP_042787869.1|  cystathionine gamma-synthase                       151   1e-39    
ref|WP_024947137.1|  cystathionine beta-lyase                           151   1e-39    



>ref|XP_002529997.1| cystathionine gamma-synthase, putative [Ricinus communis]
 gb|EEF32359.1| cystathionine gamma-synthase, putative, partial [Ricinus communis]
Length=425

 Score =   324 bits (830),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV+ VYYPG
Sbjct  262  SEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVKHVYYPG  321

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPE+HIAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  322  LPSHPEYHIAKRQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGGCESIVDQPAI  381

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ+ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  382  MSYWDLTQSEREKYGIKDNLVRFSFGVEDFEDMKADILQALETI  425



>gb|ABK96139.1| unknown [Populus trichocarpa]
Length=310

 Score =   318 bits (815),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKVR VYYPG
Sbjct  144  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVRCVYYPG  203

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAKKQMTGFGGVVSFE+DGDL  T+KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  204  LPSHPEHHIAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAPSFGGCESIVDQPAI  263

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+++ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  264  MSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI  307



>ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycopersicum]
 gb|AAR92031.1| cystathionine gamma synthase [Solanum lycopersicum]
Length=540

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SV+RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV+ VYYPG
Sbjct  377  SVIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVKHVYYPG  436

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGGCESIVDQPAI
Sbjct  437  LPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGGCESIVDQPAI  496

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct  497  MSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI  540



>gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 [Solanum tuberosum]
Length=539

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SV+RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV+ VYYPG
Sbjct  376  SVIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVKHVYYPG  435

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGGCESIVDQPAI
Sbjct  436  LPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGGCESIVDQPAI  495

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct  496  MSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI  539



>gb|KHG00425.1| Cystathionine gamma-synthase, chloroplastic -like protein [Gossypium 
arboreum]
Length=539

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP+V+RVYYPGLP
Sbjct  377  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPRVKRVYYPGLP  436

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  437  SHPEHEIAKRQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGGCESIVDQPAIMS  496

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+QAER+ YGI+DNL+RFSFGVEDFED+KAD+LQALETI
Sbjct  497  YWDLSQAERSKYGILDNLIRFSFGVEDFEDLKADILQALETI  538



>ref|XP_009628949.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=527

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV+ VYYPG
Sbjct  364  SVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVKHVYYPG  423

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPE+HIAKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGGCESIVDQPAI
Sbjct  424  LQSHPEYHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGGCESIVDQPAI  483

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGIMDNLVRFSFGVEDFEDVKADVLQALE+I
Sbjct  484  MSYWDLSQSDRAKYGIMDNLVRFSFGVEDFEDVKADVLQALESI  527



>pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum]
Length=445

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKVR VYYPG
Sbjct  282  SEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPG  341

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAKKQMTGFGG VSFE+DGDL+TTAKFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  342  LQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAI  401

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  402  MSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  445



>gb|KJB11075.1| hypothetical protein B456_001G240000 [Gossypium raimondii]
Length=544

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP+VRRVYYPGLP
Sbjct  383  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPRVRRVYYPGLP  442

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  443  SHPEHEIAKQQMTGFGGVVSFEVDGDLMTTKKFVDALKIPYIAPSFGGCESIVDQPAIMS  502

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+QAER  YGI DNLVRFSFGVEDFED+KADVLQALETI
Sbjct  503  YWDLSQAERRKYGIEDNLVRFSFGVEDFEDLKADVLQALETI  544



>gb|AJF83863.1| cystathionine gamma synthase 1 [Nicotiana tabacum]
Length=537

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SV+RNLHHILGG LNPNAAYLIIRGMKTLHLR+QQQNSTALRMAE+LEAHPKVR VYYPG
Sbjct  374  SVIRNLHHILGGALNPNAAYLIIRGMKTLHLRLQQQNSTALRMAEILEAHPKVRHVYYPG  433

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  434  LQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAI  493

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  494  MSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  537



>gb|KJB11079.1| hypothetical protein B456_001G240300 [Gossypium raimondii]
Length=546

 Score =   323 bits (827),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP+VRRVYYPGLP
Sbjct  385  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPRVRRVYYPGLP  444

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  445  SHPEHEIAKQQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGGCESIVDQPAIMS  504

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+QAER  YGI DNLVRFSFGVEDFED+KADVLQALETI
Sbjct  505  YWDLSQAERRKYGIEDNLVRFSFGVEDFEDLKADVLQALETI  546



>ref|XP_011085742.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase 
1, chloroplastic-like [Sesamum indicum]
Length=543

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SVVRNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQN+TA RMAE+LEAHPKVRRVYYPG
Sbjct  380  SVVRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNTTAQRMAEILEAHPKVRRVYYPG  439

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH +AK+QM GFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGGCESIVDQPAI
Sbjct  440  LASHPEHELAKRQMNGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGGCESIVDQPAI  499

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q+ERA YGIMDNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  500  MSYWDLSQSERAKYGIMDNLVRFSFGVEDFEDLKADILQALETI  543



>ref|XP_009775845.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=538

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKVR VYYPG
Sbjct  375  SEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPG  434

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  435  LQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAI  494

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  495  MSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  538



>ref|XP_011035793.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Populus 
euphratica]
Length=543

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKVR VYYPG
Sbjct  377  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVRCVYYPG  436

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAKKQMTGFGGVVSFE+DGDL+ T+KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  437  LPSHPEHHIAKKQMTGFGGVVSFEVDGDLLITSKFVDALKIPYIAPSFGGCESIVDQPAI  496

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+++ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  497  MSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI  540



>gb|KHG14739.1| Cystathionine gamma-synthase, chloroplastic -like protein [Gossypium 
arboreum]
Length=547

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE LEAHP+VRRVYYPGLP
Sbjct  386  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEALEAHPRVRRVYYPGLP  445

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  446  SHPEHEIAKQQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGGCESIVDQPAIMS  505

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+QAER  YGI DNLVRFSFGVEDFED+KADVLQALETI
Sbjct  506  YWDLSQAERRKYGIEDNLVRFSFGVEDFEDLKADVLQALETI  547



>ref|XP_002323872.1| cystathionine gamma synthase family protein [Populus trichocarpa]
 gb|EEF04005.1| cystathionine gamma synthase family protein [Populus trichocarpa]
Length=532

 Score =   320 bits (821),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKVR VYYPG
Sbjct  366  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVRCVYYPG  425

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAKKQMTGFGGVVSFE+DGDL  T+KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  426  LPSHPEHHIAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAPSFGGCESIVDQPAI  485

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+++ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  486  MSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI  529



>ref|XP_006373333.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa]
 gb|ERP51130.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa]
Length=548

 Score =   320 bits (821),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKVR VYYPG
Sbjct  382  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVRCVYYPG  441

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAKKQMTGFGGVVSFE+DGDL  T+KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  442  LPSHPEHHIAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAPSFGGCESIVDQPAI  501

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+++ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  502  MSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI  545



>emb|CBI22246.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   319 bits (817),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKV+ VYYPG
Sbjct  334  STIRNLHHVLGGVLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKCVYYPG  393

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK+QMTGFGGVVSFE+DGDL TT KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  394  LPSHPEHHIAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGGCESIVDQPAI  453

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q+ERA YGI DNLVRFSFGVEDFED+KAD+LQALE+I
Sbjct  454  MSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQALESI  497



>ref|XP_009602123.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Nicotiana tomentosiformis]
Length=601

 Score =   322 bits (825),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SV+RNLHHILGG LNPNAAYLIIRGMKTLHLR+QQQNSTALRMAE+LEAHPKVR VYYPG
Sbjct  438  SVIRNLHHILGGALNPNAAYLIIRGMKTLHLRLQQQNSTALRMAEILEAHPKVRHVYYPG  497

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  498  LQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAI  557

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  558  MSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  601



>gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum]
Length=540

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKVR VYYPG
Sbjct  377  SEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVRHVYYPG  436

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAKKQMTGFGG VSFE+DGDL+TTAKFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  437  LQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAI  496

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  497  MSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  540



>ref|XP_009797245.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
sylvestris]
Length=552

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAHPKVR VYYPG
Sbjct  389  SVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAHPKVRCVYYPG  448

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGGCESIVDQPAI
Sbjct  449  LPSHPEHQLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGGCESIVDQPAI  508

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGI+DNLVRFSFGVEDFED+KAD+LQAL+TI
Sbjct  509  MSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALDTI  552



>ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Vitis 
vinifera]
Length=531

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKV+ VYYPG
Sbjct  368  STIRNLHHVLGGVLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKCVYYPG  427

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK+QMTGFGGVVSFE+DGDL TT KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  428  LPSHPEHHIAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGGCESIVDQPAI  487

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q+ERA YGI DNLVRFSFGVEDFED+KAD+LQALE+I
Sbjct  488  MSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQALESI  531



>ref|XP_007032603.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY03529.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 2 [Theobroma cacao]
Length=541

 Score =   318 bits (814),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAL+MA+VLEAHP+V+RVYYPGLP
Sbjct  380  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALKMAKVLEAHPRVKRVYYPGLP  439

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAK QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  440  SHPEHEIAKLQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGGCESIVDQPAIMS  499

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDLTQAER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  500  YWDLTQAERRKYGIEDNLVRFSFGVEDFEDLKADILQALETI  541



>ref|XP_007032602.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY03528.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
Length=559

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAL+MA+VLEAHP+V+RVYYPGLP
Sbjct  398  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALKMAKVLEAHPRVKRVYYPGLP  457

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAK QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  458  SHPEHEIAKLQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGGCESIVDQPAIMS  517

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDLTQAER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  518  YWDLTQAERRKYGIEDNLVRFSFGVEDFEDLKADILQALETI  559



>gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata]
Length=553

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SVVRNLHHILGG +NPNAAYLIIRGMKTLHLR++QQNSTA R+AE+LEAHPKVR VYYPG
Sbjct  390  SVVRNLHHILGGAINPNAAYLIIRGMKTLHLRIKQQNSTAQRIAEILEAHPKVRCVYYPG  449

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGGCESIVDQPAI
Sbjct  450  LPSHPEHQLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGGCESIVDQPAI  509

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGI+DNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  510  MSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALEAI  553



>gb|KJB75684.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=539

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP+V+RVYYPGLP
Sbjct  377  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPRVKRVYYPGLP  436

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAK+QMTGFGGVVSFE+DGDL TT KFVDALKIPYIAPSFGGCESIVD PAIMS
Sbjct  437  SHPEHEIAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGGCESIVDPPAIMS  496

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL++AER+ YGI+DNL+RFSFGVEDFED+KAD+LQALE+I
Sbjct  497  YWDLSRAERSKYGILDNLIRFSFGVEDFEDLKADILQALESI  538



>gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum]
Length=527

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAHPKVR VYYPG
Sbjct  364  SVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAHPKVRCVYYPG  423

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGGCESIVDQPAI
Sbjct  424  LQSHPEHQLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGGCESIVDQPAI  483

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGI+DNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  484  MSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALEAI  527



>emb|CAA56143.1| CYS1 [Arabidopsis thaliana]
Length=224

 Score =   304 bits (779),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  61   SEIRNLHHVLGGPLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  120

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  121  LPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  180

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  181  MSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  224



>ref|XP_010029311.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW56209.1| hypothetical protein EUGRSUZ_I01959 [Eucalyptus grandis]
Length=558

 Score =   315 bits (808),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +RNLHH+LGG LNPNAAYLIIRGMKTLHLRV+QQNSTA RMAE+LEAHPKV+RVYYPGLP
Sbjct  397  IRNLHHVLGGALNPNAAYLIIRGMKTLHLRVKQQNSTAQRMAEILEAHPKVKRVYYPGLP  456

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAKKQMTGFGGVVSFEIDGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  457  SHPEHQIAKKQMTGFGGVVSFEIDGDLMTTIKFVDALKIPYIAPSFGGCESIVDQPAIMS  516

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+QAER +YGI D+LVRFSFGVED ED+KADVLQALE I
Sbjct  517  YWDLSQAERVSYGISDSLVRFSFGVEDLEDLKADVLQALEAI  558



>ref|XP_009592901.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=553

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAHPKVR VYYPG
Sbjct  390  SVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAHPKVRCVYYPG  449

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGGCESIVDQPAI
Sbjct  450  LQSHPEHQLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGGCESIVDQPAI  509

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGI+DNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  510  MSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALEAI  553



>ref|NP_001275144.1| cystathionine gamma-synthase isoform 2 [Solanum tuberosum]
 gb|AAF74982.1|AF082892_1 cystathionine gamma-synthase isoform 2 [Solanum tuberosum]
Length=540

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR LHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAHPKVR VYYPG
Sbjct  377  SAVRTLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAHPKVRCVYYPG  436

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPE+H+AK+QMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  437  LPSHPEYHLAKRQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAI  496

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL ++ERA YGIMDNLVRFSFGVEDFED+KAD+LQALE++
Sbjct  497  MSYWDLKESERAKYGIMDNLVRFSFGVEDFEDLKADILQALESM  540



>ref|XP_010525099.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Tarenaya 
hassleriana]
Length=424

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRV+QQNSTALRMA++LEAHPKV  VYYPG
Sbjct  261  SEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVKQQNSTALRMAQILEAHPKVSHVYYPG  320

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH IAK+QMTGFGGVVSFEIDGDL TT KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  321  LPSHPEHDIAKRQMTGFGGVVSFEIDGDLDTTIKFVDALKIPYIAPSFGGCESIVDQPAI  380

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNL+RFSFGVEDFEDVKADVLQAL+ I
Sbjct  381  MSYWDLTQEERLKYGIKDNLIRFSFGVEDFEDVKADVLQALDAI  424



>gb|KDP27172.1| hypothetical protein JCGZ_19871 [Jatropha curcas]
Length=540

 Score =   313 bits (802),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA+RMAEVLEAHPKVR VYYPG
Sbjct  377  SEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAMRMAEVLEAHPKVRCVYYPG  436

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK+QMTGFGGVVSFE+DGDL TT KFVD+LKIPYIAPSFGG ESIVDQPAI
Sbjct  437  LPSHPEHHIAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAPSFGGVESIVDQPAI  496

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ++R +YGI DNLVRFSFGVE FED+KADVLQALE I
Sbjct  497  MSYWDLTQSQRESYGIKDNLVRFSFGVEAFEDLKADVLQALEAI  540



>ref|XP_011098654.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase 
1, chloroplastic [Sesamum indicum]
Length=532

 Score =   313 bits (801),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VRNLHHILGG LNPNAAYL+IRGMKTLHLRVQQQNSTA RM E+LEAHPK+RRVYYPG
Sbjct  369  SAVRNLHHILGGALNPNAAYLLIRGMKTLHLRVQQQNSTAQRMVEILEAHPKIRRVYYPG  428

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH +AKKQM GFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGGCESIVDQPAI
Sbjct  429  LASHPEHELAKKQMNGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGGCESIVDQPAI  488

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL  +ERA YGI+DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  489  MSYWDLPPSERAKYGILDNLVRFSFGVEDFEDLKADILQALETI  532



>dbj|BAP47509.1| cystathionine gamma-synthase [Gentiana triflora]
Length=553

 Score =   313 bits (802),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SV+R LHHI+GG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LE HPKVRRVYYPG
Sbjct  390  SVIRTLHHIMGGALNPNAAYLIIRGMKTLHLRVQQQNSTASRMAEILEGHPKVRRVYYPG  449

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGGCESIVDQPAI
Sbjct  450  LKSHPEHTLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGGCESIVDQPAI  509

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL QA+RA YGI+DNLVRFSFGVE FED+K D+LQALETI
Sbjct  510  MSYWDLCQADRAKYGILDNLVRFSFGVEVFEDIKNDILQALETI  553



>ref|XP_010550033.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010550034.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=547

 Score =   313 bits (802),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VRNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTALRMAE+LEAHPKV RVYYPG
Sbjct  384  SEVRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTALRMAEILEAHPKVSRVYYPG  443

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH IAKKQMTGFGGVVSFE+DGD+  T KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  444  LPSHPEHDIAKKQMTGFGGVVSFEVDGDIEKTIKFVDALKIPYIAPSFGGCESIVDQPAI  503

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADV+ AL++I
Sbjct  504  MSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVIHALDSI  547



>gb|AGF95116.1| cystathionine gamma synthase, partial [Prunus persica]
Length=157

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -3

Query  685  HILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEH  506
            HILGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA++LEAHPKV RVYYPGL SHPEH
Sbjct  1    HILGGALNPNAAYLIIRGMKTLHLRVQQQNSTASRMAKILEAHPKVARVYYPGLSSHPEH  60

Query  505  HIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLT  326
             +AK+QMTGFGGVVSFEIDGDLMTT KFVDAL+IPYIAPSFGGCESIVDQPAIMSYWDL+
Sbjct  61   QLAKRQMTGFGGVVSFEIDGDLMTTIKFVDALRIPYIAPSFGGCESIVDQPAIMSYWDLS  120

Query  325  QAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            Q+ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  121  QSERITYGIKDNLVRFSFGVEDFEDLKADILQALETI  157



>ref|XP_006408463.1| hypothetical protein EUTSA_v10020394mg [Eutrema salsugineum]
 gb|ESQ49916.1| hypothetical protein EUTSA_v10020394mg [Eutrema salsugineum]
Length=568

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAEVLEAHPKV  VYYPG
Sbjct  405  SEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTASRMAEVLEAHPKVSHVYYPG  464

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  465  LASHPEHHIAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  524

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  525  MSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  568



>emb|CDP02254.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SVVR++HHILGGTLNPNAAYLIIRGMKTL LRV QQNSTA RMAE+LEAHPKVRRVYYPG
Sbjct  389  SVVRDMHHILGGTLNPNAAYLIIRGMKTLDLRVHQQNSTASRMAEILEAHPKVRRVYYPG  448

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHH+AK+QMTGFGGVVSFE+DG+L TTAKFVDAL+IPYIAPSFGGCESIVDQPAI
Sbjct  449  LASHPEHHLAKRQMTGFGGVVSFEVDGELYTTAKFVDALRIPYIAPSFGGCESIVDQPAI  508

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q+ERA YGI+DNLVRFSFGVE FED+KAD+LQALETI
Sbjct  509  MSYWDLPQSERAKYGIVDNLVRFSFGVEGFEDLKADILQALETI  552



>ref|XP_006431203.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
 gb|ESR44443.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
Length=537

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV+RV+YPGL 
Sbjct  376  IRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVKRVHYPGLK  435

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEHHIA +QMTGFGGVVSFE+DGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  436  SHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMS  495

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+Q+ER  YGIMDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  496  YWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI  537



>ref|XP_006431204.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
 gb|ESR44444.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
Length=541

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV+RV+YPGL 
Sbjct  380  IRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVKRVHYPGLK  439

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEHHIA +QMTGFGGVVSFE+DGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  440  SHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMS  499

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+Q+ER  YGIMDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  500  YWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI  541



>gb|EYU44131.1| hypothetical protein MIMGU_mgv1a002982mg [Erythranthe guttata]
Length=619

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VRNLHH+LGG LNPNAAYLIIRGMKTLHLR+QQQNSTA RMAE+LEAHPK+ RVYYPG
Sbjct  456  SAVRNLHHVLGGALNPNAAYLIIRGMKTLHLRIQQQNSTAQRMAEILEAHPKISRVYYPG  515

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHH+AKKQM GFGGVVSFE+DGDL+ TAKFVDAL+IPYIAPSFGGCESIVDQPAI
Sbjct  516  LASHPEHHLAKKQMNGFGGVVSFEVDGDLLITAKFVDALRIPYIAPSFGGCESIVDQPAI  575

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+ +ERA YGIMDNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  576  MSYWDLSPSERAKYGIMDNLVRFSFGVEDFEDLKADILQALEKI  619



>ref|XP_008230796.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase, 
chloroplastic-like [Prunus mume]
Length=522

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA++LEAHPKV  VYYPGLP
Sbjct  361  IRTLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTASRMAKILEAHPKVAHVYYPGLP  420

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH +AK+QMTGFGGVVSFEIDGDLMTT KFVDAL+IPYIAPSFGGCESIVDQPAIMS
Sbjct  421  SHPEHQLAKRQMTGFGGVVSFEIDGDLMTTIKFVDALRIPYIAPSFGGCESIVDQPAIMS  480

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+Q+ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  481  YWDLSQSERITYGIKDNLVRFSFGVEDFEDLKADILQALETI  522



>ref|XP_007216002.1| hypothetical protein PRUPE_ppa004232mg [Prunus persica]
 gb|EMJ17201.1| hypothetical protein PRUPE_ppa004232mg [Prunus persica]
Length=522

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA++LEAHPKV RVYYPG
Sbjct  359  SEIRTLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTASRMAKILEAHPKVARVYYPG  418

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH +AK+QMTGFGGVVSFEIDGDLMTT KFVDAL+IPYIAPSFGGCESIVDQPAI
Sbjct  419  LSSHPEHQLAKRQMTGFGGVVSFEIDGDLMTTIKFVDALRIPYIAPSFGGCESIVDQPAI  478

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q+ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  479  MSYWDLSQSERITYGIKDNLVRFSFGVEDFEDLKADILQALETI  522



>ref|XP_010670238.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=543

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RN+HH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN+TALRMAEVLEAHPK++ VYYPG
Sbjct  380  SEIRNMHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNTTALRMAEVLEAHPKIKCVYYPG  439

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGDLMTT KFVDALKI YIAPSFGGCESIVDQPAI
Sbjct  440  LPSHPEHELAKRQMTGFGGVVSFEIDGDLMTTIKFVDALKIAYIAPSFGGCESIVDQPAI  499

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+ +ER  YGI DNL+RFSFGVEDFED+KAD+LQALE I
Sbjct  500  MSYWDLSPSERLKYGITDNLIRFSFGVEDFEDLKADILQALEAI  543



>ref|XP_006482629.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Citrus 
sinensis]
Length=541

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKV+RV+YPGL 
Sbjct  380  IRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLK  439

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEHHIA +QMTGFGGVVSFE+DGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  440  SHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMS  499

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+Q+ER  YGIMDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  500  YWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI  541



>ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 sp|P55217.3|CGS1_ARATH RecName: Full=Cystathionine gamma-synthase 1, chloroplastic; 
Short=AtCGS1; AltName: Full=METHIONINE OVERACCUMULATION 1; AltName: 
Full=O-succinylhomoserine (thiol)-lyase; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF26162.1|AC008261_19 putative cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AAB41235.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 dbj|BAA24699.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AAM19810.1| AT3g01120/T4P13_19 [Arabidopsis thaliana]
 gb|AAO22582.1| putative cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AEE73612.1| cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  400  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  459

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  460  LPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  519

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  520  MSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  563



>emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  400  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  459

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  460  LPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  519

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  520  MSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  563



>emb|CDY43269.1| BnaC05g48620D [Brassica napus]
Length=492

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  329  SEIRNLHHVLGGTLNPNAAYLMIRGMKTMHLRVQQQNSTASRMAEILEAHPKVSHVYYPG  388

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  389  LASHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  448

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  449  MSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  492



>ref|XP_006297283.1| hypothetical protein CARUB_v10013298mg, partial [Capsella rubella]
 gb|EOA30181.1| hypothetical protein CARUB_v10013298mg, partial [Capsella rubella]
Length=589

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  426  SEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  485

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  486  LPSHPEHELAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  545

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  546  MSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  589



>ref|XP_010463584.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=560

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  397  SEIRNLHHVLGGTLNPNAAYLLIRGMKTMHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  456

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QM+GFGGVVSFEIDGD+  T KFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  457  LPSHPEHELAKRQMSGFGGVVSFEIDGDIERTIKFVDALKIPYIAPSFGGCESIVDQPAI  516

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  517  MSYWDLTQEERMKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  560



>gb|KCW56210.1| hypothetical protein EUGRSUZ_I01959 [Eucalyptus grandis]
Length=556

 Score =   308 bits (789),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 152/162 (94%), Gaps = 2/162 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +RNLHH+LGG LNPNAAYLIIRGMKTLHLRV+QQNSTA RMAE+LEAHPK  RVYYPGLP
Sbjct  397  IRNLHHVLGGALNPNAAYLIIRGMKTLHLRVKQQNSTAQRMAEILEAHPK--RVYYPGLP  454

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAKKQMTGFGGVVSFEIDGDLMTT KFVDALKIPYIAPSFGGCESIVDQPAIMS
Sbjct  455  SHPEHQIAKKQMTGFGGVVSFEIDGDLMTTIKFVDALKIPYIAPSFGGCESIVDQPAIMS  514

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+QAER +YGI D+LVRFSFGVED ED+KADVLQALE I
Sbjct  515  YWDLSQAERVSYGISDSLVRFSFGVEDLEDLKADVLQALEAI  556



>emb|CDY37543.1| BnaA05g34080D [Brassica napus]
Length=530

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  367  SEIRNLHHVLGGTLNPNAAYLMIRGMKTMHLRVQQQNSTASRMAEILEAHPKVSHVYYPG  426

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  427  LASHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  486

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFG+EDFEDVKADVLQALE I
Sbjct  487  MSYWDLTQEERLKYGIKDNLVRFSFGIEDFEDVKADVLQALEAI  530



>ref|XP_009147397.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Brassica 
rapa]
Length=530

 Score =   307 bits (786),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  367  SEIRNLHHVLGGTLNPNAAYLMIRGMKTMHLRVQQQNSTASRMAEILEAHPKVSHVYYPG  426

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  427  LASHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  486

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFG+EDFEDVKADVLQALE I
Sbjct  487  MSYWDLTQEERLKYGIKDNLVRFSFGIEDFEDVKADVLQALEAI  530



>gb|KHN11627.1| Cystathionine gamma-synthase, chloroplastic [Glycine soja]
Length=311

 Score =   300 bits (767),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAHPKV+RVYYPG
Sbjct  148  SQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAHPKVKRVYYPG  207

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGGCESIVDQPAI
Sbjct  208  LPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGGCESIVDQPAI  267

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  268  LSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI  311



>gb|AAM13883.1| putative cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score =   308 bits (788),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  400  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  459

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  460  LPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  519

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFSFGV+DFEDVKAD+LQALE I
Sbjct  520  MSYWDLPQEERLKYGIKDNLVRFSFGVKDFEDVKADILQALEAI  563



>gb|KHN13598.1| Cystathionine gamma-synthase, chloroplastic [Glycine soja]
Length=390

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMAE+LEAHPKV+RVYYPG
Sbjct  227  SQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAELLEAHPKVKRVYYPG  286

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGGCESIVDQPAI
Sbjct  287  LPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGGCESIVDQPAI  346

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  347  LSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI  390



>ref|XP_010485423.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Camelina 
sativa]
Length=562

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  399  SEIRNLHHVLGGTLNPNAAYLLIRGMKTMHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  458

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QM+GFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  459  LPSHPEHELAKRQMSGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  518

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  519  MSYWDLTQEERMKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  562



>gb|AAC49574.1| similar to the metB gene product of Escherichia coli; cloned 
by functional complementation of a metB mutant strain of Escherichia 
coli LE392 [Arabidopsis thaliana]
Length=563

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYP 
Sbjct  400  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPA  459

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  460  LPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  519

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  520  MSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  563



>ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58458.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  401  SEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  460

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  461  LASHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  520

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  521  MSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  564



>ref|XP_010429549.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Camelina 
sativa]
Length=563

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRV+QQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  400  SEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVKQQNSTAFRMAEILEAHPKVSHVYYPG  459

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QM+GFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  460  LPSHPEHELAKRQMSGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  519

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  520  MSYWDLTQEERMKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  563



>gb|AAC25687.1| cystathionine gamma-synthase precursor [Arabidopsis thaliana]
Length=563

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  400  SEIRNLHHVLGGPLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG  459

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  460  LPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  519

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  520  MSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  563



>gb|EYU34642.1| hypothetical protein MIMGU_mgv1a004543mg [Erythranthe guttata]
Length=521

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR LH+I+GG LNPNAAYLIIRGMKTLHLR+QQQNSTA RMAE+LEAHPK+ RVYYPG
Sbjct  358  STVRVLHNIIGGALNPNAAYLIIRGMKTLHLRIQQQNSTAQRMAEILEAHPKITRVYYPG  417

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH++AK+QM+GFGGVVSFE+DGDL+TT+KF+DAL+IPYIAPSFGGCESIVDQPAI
Sbjct  418  LVSHPEHNLAKRQMSGFGGVVSFEVDGDLLTTSKFIDALRIPYIAPSFGGCESIVDQPAI  477

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q ERA YGIMDNLVRFSFGVEDFED+K D+LQALE I
Sbjct  478  MSYWDLSQKERAKYGIMDNLVRFSFGVEDFEDLKTDILQALEKI  521



>ref|XP_008368433.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Malus 
domestica]
Length=523

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKV  VYYPG
Sbjct  360  SEIRILHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVAHVYYPG  419

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGDL  T  FVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  420  LPSHPEHQLAKRQMTGFGGVVSFEIDGDLTRTINFVDALKIPYIAPSFGGCESIVDQPAI  479

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++R  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  480  MSYWDLSQSDRIKYGIKDNLVRFSFGVEDFEDLKADILQALETI  523



>gb|AAC19395.1| cystathionine gamma-synthase [Mesembryanthemum crystallinum]
Length=548

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH+LGGTLNPNAAYL+IRGMKTLHLRVQQQN+TALRMAE+LEAHPKV+ VYYPG
Sbjct  385  STIRTFHHVLGGTLNPNAAYLMIRGMKTLHLRVQQQNTTALRMAEILEAHPKVKHVYYPG  444

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFE+DGDL+TTAKFVD+LKI YIAPSFGGCESIVDQPAI
Sbjct  445  LPSHPEHKLAKRQMTGFGGVVSFEVDGDLLTTAKFVDSLKIAYIAPSFGGCESIVDQPAI  504

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+ ++R  YGI DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  505  MSYWDLSPSDRLKYGIKDNLVRFSFGVEDFEDLKADVLQALEAI  548



>ref|XP_009360603.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Pyrus 
x bretschneideri]
Length=521

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKV  VYYPG
Sbjct  358  SEIRILHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVAHVYYPG  417

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGDL  T  FVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  418  LPSHPEHQLAKRQMTGFGGVVSFEIDGDLTRTINFVDALKIPYIAPSFGGCESIVDQPAI  477

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++R  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  478  MSYWDLSQSDRIKYGIKDNLVRFSFGVEDFEDLKADILQALETI  521



>ref|XP_003552541.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Glycine 
max]
Length=535

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMAE+LEAHPKV+RVYYPG
Sbjct  372  SQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAELLEAHPKVKRVYYPG  431

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGGCESIVDQPAI
Sbjct  432  LPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGGCESIVDQPAI  491

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  492  LSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI  535



>ref|NP_001237572.1| cystathionine-gamma-synthase precursor [Glycine max]
 gb|AAD34548.1|AF141602_1 cystathionine-gamma-synthase precursor [Glycine max]
Length=536

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAHPKV+RVYYPG
Sbjct  373  SQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAHPKVKRVYYPG  432

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGGCESIVDQPAI
Sbjct  433  LPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGGCESIVDQPAI  492

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  493  LSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI  536



>emb|CDX91962.1| BnaC03g32640D [Brassica napus]
Length=483

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH++GGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  320  SEIRNLHHVMGGTLNPNAAYLIIRGMKTMHLRVQQQNSTASRMAEILEAHPKVSHVYYPG  379

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L +HPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  380  LANHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  439

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL   ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  440  MSYWDLAPEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  483



>emb|CDX74285.1| BnaA03g27620D [Brassica napus]
Length=544

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  381  SEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTASRMAEILEAHPKVSHVYYPG  440

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L +HPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  441  LANHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  500

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL   ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  501  MSYWDLAPEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  544



>ref|XP_009134628.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Brassica 
rapa]
Length=545

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct  382  SEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTASRMAEILEAHPKVSHVYYPG  441

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L +HPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  442  LANHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGGCESIVDQPAI  501

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL   ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  502  MSYWDLAPEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  545



>ref|XP_004136690.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN59542.1| hypothetical protein Csa_3G824870 [Cucumis sativus]
Length=543

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH++GG LNPNAAYLIIRGMKT+HLRVQQQNS+ L+MA +LEAHPK++ VYYPG
Sbjct  380  SEIRNLHHVIGGALNPNAAYLIIRGMKTMHLRVQQQNSSGLKMAMLLEAHPKIKCVYYPG  439

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH++AK+QMTGFGGVVSFE+DGDLMTTAKF+D+LKIPYIAPSFGGCESI+DQPAI
Sbjct  440  LPSHPEHNLAKRQMTGFGGVVSFEVDGDLMTTAKFIDSLKIPYIAPSFGGCESIIDQPAI  499

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFS G+EDFED+KAD+LQAL+ I
Sbjct  500  MSYWDLNQTERLKYGIKDNLVRFSIGIEDFEDLKADILQALDAI  543



>ref|XP_010258325.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Nelumbo 
nucifera]
Length=535

 Score =   300 bits (767),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV RVYYPG
Sbjct  371  SEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVTRVYYPG  430

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHP+HHIAKKQM+GFGGVVSFEIDGD   T KF+D+LKIPYIAPSFGGCESIVDQPA+
Sbjct  431  LASHPDHHIAKKQMSGFGGVVSFEIDGDFEKTKKFIDSLKIPYIAPSFGGCESIVDQPAL  490

Query  346  MSYWDLTQAERA-AYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL QAER   + I DNLVRFS GVEDFED+KADVLQALE I
Sbjct  491  MSYWDLNQAERTNEFSIRDNLVRFSVGVEDFEDLKADVLQALENI  535



>ref|XP_008443381.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Cucumis 
melo]
Length=544

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHH++GG LNPNAAYLIIRGMKT+HLRVQQQNS+ L+MA +LEAHPK++ VYYPG
Sbjct  381  SEIRNLHHVIGGALNPNAAYLIIRGMKTMHLRVQQQNSSGLKMARLLEAHPKIKCVYYPG  440

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFE+DGDL TTAKF+D+LKIPYIAPSFGGCESI+DQPAI
Sbjct  441  LPSHPEHSLAKRQMTGFGGVVSFEVDGDLTTTAKFIDSLKIPYIAPSFGGCESIIDQPAI  500

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL Q ER  YGI DNLVRFS G+EDFED+KAD+LQAL+ I
Sbjct  501  MSYWDLNQTERLKYGIKDNLVRFSIGIEDFEDLKADILQALDAI  544



>ref|XP_007139535.1| hypothetical protein PHAVU_008G038100g [Phaseolus vulgaris]
 gb|ESW11529.1| hypothetical protein PHAVU_008G038100g [Phaseolus vulgaris]
Length=540

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HHILGGTLNPNAAYL+IRGMKTLHLRVQQQNST + MA++LEAHPKV+RVYYPG
Sbjct  377  SQIRTFHHILGGTLNPNAAYLLIRGMKTLHLRVQQQNSTGMGMAKILEAHPKVKRVYYPG  436

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIA SFGGCESIVDQPAI
Sbjct  437  LPSHPEHELAKRQMTGFGGVVSFEIDGDIHTTIKFVDSLKIPYIAASFGGCESIVDQPAI  496

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  497  LSYWDLPQSERAKYKIHDNLVRFSFGVEDFEDLKADVLQALEAI  540



>ref|NP_001266947.1| cystathionine gamma-synthase, chloroplastic-like [Fragaria vesca]
 emb|CAA04772.2| cystathionine gamma synthase [Fragaria vesca]
 emb|CAB57356.1| cystathionine gamma synthase [Fragaria vesca]
Length=545

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHHILGG LNPNAAYLIIRGMKTLH+R+QQQNSTALRMA++LEAHPKV  VYYPG
Sbjct  382  SEIRILHHILGGALNPNAAYLIIRGMKTLHIRIQQQNSTALRMAKILEAHPKVAHVYYPG  441

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +AK+QMTGFGGVVSFEIDGDL  T KF+DALKIPYIAPSFGGCESIVDQPAI
Sbjct  442  LPSHPEHELAKRQMTGFGGVVSFEIDGDLKRTIKFIDALKIPYIAPSFGGCESIVDQPAI  501

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++R  YGI DNLVRFSFG+EDF D+KAD+LQALE I
Sbjct  502  MSYWDLSQSDRLKYGIKDNLVRFSFGIEDFNDLKADILQALEKI  545



>ref|NP_001265950.1| cystathionine gamma-synthase, chloroplastic-like [Cicer arietinum]
 gb|AGA60136.1| cystathionine gamma-synthase [Cicer arietinum]
Length=534

 Score =   295 bits (754),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHHILGG LNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAHPKV+RVYYPG
Sbjct  371  SQIRILHHILGGALNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAHPKVKRVYYPG  430

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +A +QMTGFGGVVSFEIDGDL TT KFVD+LKIPYIA SFGGCESIVDQPAI
Sbjct  431  LPSHPEHELAMRQMTGFGGVVSFEIDGDLTTTIKFVDSLKIPYIAASFGGCESIVDQPAI  490

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL  +ERA Y I DNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  491  LSYWDLPASERAKYKIYDNLVRFSFGVEDFEDLKADILQALEAI  534



>ref|XP_010453667.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010453668.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=520

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VRNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTALRMA++LE HPKVRRVYYPG
Sbjct  329  SEVRNLHHVLGGTLNPNAAYLLIRGMKTMHLRVQQQNSTALRMAQILETHPKVRRVYYPG  388

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHP+HHIAK+QMTGFGGVV+FEI GDL +T  FVD+LKIPYIA SFGGCES+VDQPAI
Sbjct  389  LPSHPDHHIAKRQMTGFGGVVTFEIAGDLGSTINFVDSLKIPYIATSFGGCESLVDQPAI  448

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             SYWDL Q ER  +GI DNLVRFSFGVEDF+DVKAD+L ALE I
Sbjct  449  SSYWDLPQEERPKHGIKDNLVRFSFGVEDFDDVKADILHALEVI  492



>ref|XP_006858075.1| hypothetical protein AMTR_s00062p00067400 [Amborella trichopoda]
 gb|ERN19542.1| hypothetical protein AMTR_s00062p00067400 [Amborella trichopoda]
Length=520

 Score =   294 bits (752),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR LHH+LGG LNPNAAY+IIRGMKTLHLRVQQ N TA+RMA +LEAHPK+ RVYYPGLP
Sbjct  359  VRALHHVLGGVLNPNAAYMIIRGMKTLHLRVQQHNLTAMRMARLLEAHPKITRVYYPGLP  418

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEHHIA +QMTGFGGVVSFE+ GDL TTAKFVDALKIPYIAPSFGGCESI+DQPAIMS
Sbjct  419  SHPEHHIASRQMTGFGGVVSFEVAGDLNTTAKFVDALKIPYIAPSFGGCESIIDQPAIMS  478

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWDL+  ERA YGI DNLVRFS G+EDFED++ DVLQAL++I
Sbjct  479  YWDLSPVERAQYGIKDNLVRFSLGIEDFEDLRMDVLQALDSI  520



>gb|KDO72635.1| hypothetical protein CISIN_1g0091671mg, partial [Citrus sinensis]
Length=148

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  658  NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  479
            NAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV+RV+YPGL SHPEHHIA +QMTG
Sbjct  1    NAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVKRVHYPGLKSHPEHHIATQQMTG  60

Query  478  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  299
            FGGVVSFE+DGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMSYWDL+Q+ER  YGI
Sbjct  61   FGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGI  120

Query  298  MDNLVRFSFGVEDFEDVKADVLQALETI  215
            MDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  121  MDNLVRFSFGVEDFEDLKADVLQALHAI  148



>gb|ABI34092.1| cystathionine gamma-synthase [Medicago sativa]
Length=536

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAHPKV+RVYYPG
Sbjct  373  SQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAHPKVKRVYYPG  432

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +A +QMTGFGGVVSFEIDGD+ TT KF+D+LKIPYIA SFGGCESIVDQPAI
Sbjct  433  LPSHPEHELAMRQMTGFGGVVSFEIDGDITTTIKFIDSLKIPYIAASFGGCESIVDQPAI  492

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL  +ERA + I DNLVRFSFG+EDFED+KADVLQALE I
Sbjct  493  LSYWDLPASERAKWKIYDNLVRFSFGIEDFEDLKADVLQALEAI  536



>ref|XP_010937206.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Elaeis guineensis]
Length=541

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  H+++GG LNPNAAY+I+RGMKTLHLRVQQQN TALRMA+ LE HPK+ RVYYPG
Sbjct  378  SKIRQYHNVIGGVLNPNAAYMILRGMKTLHLRVQQQNHTALRMAQFLEEHPKITRVYYPG  437

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK+QMTGFGGVVSFE+ GDL TT KF+D+LKIPYIAPSFGGCESIVDQPAI
Sbjct  438  LPSHPEHHIAKQQMTGFGGVVSFEVAGDLRTTMKFIDSLKIPYIAPSFGGCESIVDQPAI  497

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+ +ERA YGI D+LVRFSFGVEDFED+KAD++QALE I
Sbjct  498  MSYWDLSSSERATYGIKDSLVRFSFGVEDFEDLKADIVQALENI  541



>ref|XP_010939832.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Elaeis 
guineensis]
Length=539

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -3

Query  688  HHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPE  509
            HH++GG LNPNAAY+I+RGMKTLHLRVQQQN TALRMA+ LE HPK+ RVYYPGLPSHPE
Sbjct  382  HHVIGGVLNPNAAYMILRGMKTLHLRVQQQNHTALRMAQFLEEHPKIIRVYYPGLPSHPE  441

Query  508  HHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDL  329
            HHIAK+QMTGFGGVVSFE+ GDL TT KFVD+LKIPY+APSFGGCESIVDQPAIMSYWDL
Sbjct  442  HHIAKQQMTGFGGVVSFEVAGDLRTTMKFVDSLKIPYVAPSFGGCESIVDQPAIMSYWDL  501

Query  328  TQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            + +ERA YGI DNLVRFSFGVEDFED+KAD++QALE+I
Sbjct  502  SASERATYGIKDNLVRFSFGVEDFEDLKADIVQALESI  539



>gb|KDO72629.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis]
 gb|KDO72630.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis]
 gb|KDO72631.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis]
Length=148

 Score =   278 bits (712),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  658  NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  479
            NAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKV+RV+YPGL SHPEHHIA +QMTG
Sbjct  1    NAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTG  60

Query  478  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  299
            FGGVVSFE+DGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMSYWDL+Q+ER  YGI
Sbjct  61   FGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGI  120

Query  298  MDNLVRFSFGVEDFEDVKADVLQALETI  215
            MDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  121  MDNLVRFSFGVEDFEDLKADVLQALHAI  148



>ref|XP_010495203.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=418

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LH +LGGTLN NAAYL+IRGMKT+HLRVQQQNSTALRMA++LE HPKV RVYYPG
Sbjct  244  SEIRKLHRVLGGTLNSNAAYLLIRGMKTMHLRVQQQNSTALRMAQILETHPKVSRVYYPG  303

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHP+HHIAK+QMTGFGGVVSFE+ GDL TT KF+D+LKIPYIA SFGGCES+VDQPAI
Sbjct  304  LPSHPDHHIAKRQMTGFGGVVSFEVAGDLGTTIKFIDSLKIPYIATSFGGCESLVDQPAI  363

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             SYWDL Q ER  +GI DNLVRFSFGVEDF+DVKAD+L ALE I
Sbjct  364  SSYWDLPQEERLKHGIKDNLVRFSFGVEDFDDVKADILNALEVI  407



>ref|XP_003621272.1| Cystathionine gamma-synthase [Medicago truncatula]
 gb|AES77490.1| cystathionine gamma-synthase [Medicago truncatula]
Length=535

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHHILGG LNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAHPKV+RVYYPG
Sbjct  372  SEIRILHHILGGALNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAHPKVKRVYYPG  431

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +A +QMTGFGGVVSFEIDGD+ TT KF+D+LKIPYIA SFGGCESIVDQPAI
Sbjct  432  LPSHPEHELAMRQMTGFGGVVSFEIDGDITTTIKFIDSLKIPYIAASFGGCESIVDQPAI  491

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL  +ERA + I DNLVRFSFG+EDFED+KADVLQALE I
Sbjct  492  LSYWDLPASERAKWKIYDNLVRFSFGIEDFEDLKADVLQALEAI  535



>ref|XP_006400053.1| hypothetical protein EUTSA_v10015332mg [Eutrema salsugineum]
 gb|ESQ41506.1| hypothetical protein EUTSA_v10015332mg [Eutrema salsugineum]
Length=416

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR++H++LGG LNPNAAYL+IRG+KT+HLR++QQNSTALRMA VLEAHPKV RVYYPG
Sbjct  252  SKVRDMHYVLGGMLNPNAAYLLIRGIKTMHLRLKQQNSTALRMAHVLEAHPKVSRVYYPG  311

Query  526  LPSHPEHHIAKKQMTGFGGVVSFE-IDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPA  350
            LPSHPEHHIAK+QMTGFGGVVSFE I GDL  T KFVD+LKIPYIAPSFGGCESIVDQPA
Sbjct  312  LPSHPEHHIAKRQMTGFGGVVSFEIITGDLEITIKFVDSLKIPYIAPSFGGCESIVDQPA  371

Query  349  IMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            IMSYW+L + ER  +GI  NLVRFSFGVEDF+DVKADVLQAL+TI
Sbjct  372  IMSYWNLPEEERLTHGIKVNLVRFSFGVEDFDDVKADVLQALDTI  416



>gb|AGA60137.1| cystathionine gamma-synthase [Lens culinaris]
Length=535

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LHHILGG LNPNAAYL IRG+KTLHLRVQQQNST + MA+ LEAHPKV+RVYYPG
Sbjct  372  SEIRILHHILGGVLNPNAAYLFIRGLKTLHLRVQQQNSTGMGMAKFLEAHPKVKRVYYPG  431

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH +A +QMTGFGGVVSFEIDGDL TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct  432  LPSHPEHELAMRQMTGFGGVVSFEIDGDLETTIKFVDSLKIPYIAPSFGGCESIVDQPAI  491

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWDL  +ERA + I DNLVRFSFG+EDFED+KAD++QALE I
Sbjct  492  LSYWDLPASERAKWKIYDNLVRFSFGIEDFEDLKADIVQALEVI  535



>emb|CDX90997.1| BnaC02g06000D [Brassica napus]
Length=490

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 150/182 (82%), Gaps = 18/182 (10%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK--------  551
            S +RNLHH+LGGTLNPNAAYL+IRG+KT+HLR++QQNSTALRMA+VLEAHPK        
Sbjct  309  SAIRNLHHVLGGTLNPNAAYLLIRGIKTMHLRLKQQNSTALRMAQVLEAHPKALYFPPKK  368

Query  550  ----------VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIP  401
                      V RVYYPGL SHPEHHIAK+QM GFGGVVSFEI GDL TT KFVD+L IP
Sbjct  369  PFFLYIYIFLVSRVYYPGLISHPEHHIAKRQMNGFGGVVSFEIAGDLETTIKFVDSLNIP  428

Query  400  YIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  221
            YIAPSFGGCESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFG+EDF+DVKADVLQAL 
Sbjct  429  YIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGIEDFDDVKADVLQALG  488

Query  220  TI  215
            TI
Sbjct  489  TI  490



>ref|XP_009409044.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=541

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -3

Query  688  HHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPE  509
            HH++GG LNPNAAY+I+RGMKTLHLRVQ QNSTALRMA+ LE HPK+ RVYYPGLPSHPE
Sbjct  383  HHVIGGVLNPNAAYMILRGMKTLHLRVQNQNSTALRMAQFLEEHPKIIRVYYPGLPSHPE  442

Query  508  HHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDL  329
            HHIAK+QMTGFGGVVSFE+ GDL TT KFVD+LKIPYIAPSFGGCESIVDQPAIMSYWDL
Sbjct  443  HHIAKRQMTGFGGVVSFEVAGDLNTTKKFVDSLKIPYIAPSFGGCESIVDQPAIMSYWDL  502

Query  328  TQAERAA-YGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            + +ER A YGI DNLVRFSFGVE FED+KAD+LQALE I
Sbjct  503  SGSERVAKYGIKDNLVRFSFGVEGFEDLKADILQALEKI  541



>ref|XP_010424106.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=421

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNP---NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVY  536
            S +R LHH+LGGTLN    +AAYL+IRGMKT+HLRVQ+QNSTAL+MA+VLE HPKV RVY
Sbjct  244  SEIRKLHHVLGGTLNSVKVHAAYLLIRGMKTMHLRVQEQNSTALKMAQVLETHPKVSRVY  303

Query  535  YPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQ  356
            YPGLPSHP+HHIAK+QMTGFGGVVSFEI GDL TT KF+D+LKIPYIA SFGGCES+VDQ
Sbjct  304  YPGLPSHPDHHIAKRQMTGFGGVVSFEIAGDLGTTIKFIDSLKIPYIATSFGGCESLVDQ  363

Query  355  PAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            PAI SYWDL Q ER  +GI DNLVRFSFGVEDF+DVKAD+L ALE I
Sbjct  364  PAISSYWDLPQEERPKHGIKDNLVRFSFGVEDFDDVKADILHALEVI  410



>ref|XP_006400056.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
 gb|ESQ41509.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
Length=285

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LH++LGGTLNPNAAYL+IR MKT+HLRV+QQNSTALRMA+VLEAHPKV RVYYPG
Sbjct  105  SEIRILHNLLGGTLNPNAAYLLIRSMKTMHLRVKQQNSTALRMAQVLEAHPKVSRVYYPG  164

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK+QMTGFGG+V+FEI GDL TT KFVD+LKIPYIA SFGGCES VDQPA 
Sbjct  165  LPSHPEHHIAKRQMTGFGGLVTFEIAGDLETTFKFVDSLKIPYIATSFGGCESFVDQPAA  224

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             + W++ Q ER  YG+ DNLVRFSFGVEDF+D+KAD+LQALETI
Sbjct  225  RN-WEVPQEERLKYGLKDNLVRFSFGVEDFDDLKADILQALETI  267



>ref|XP_006400055.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
 gb|ESQ41508.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
Length=346

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LH++LGGTLNPNAAYL+IR MKT+HLRV+QQNSTALRMA+VLEAHPKV RVYYPG
Sbjct  166  SEIRILHNLLGGTLNPNAAYLLIRSMKTMHLRVKQQNSTALRMAQVLEAHPKVSRVYYPG  225

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK+QMTGFGG+V+FEI GDL TT KFVD+LKIPYIA SFGGCES VDQPA 
Sbjct  226  LPSHPEHHIAKRQMTGFGGLVTFEIAGDLETTFKFVDSLKIPYIATSFGGCESFVDQPAA  285

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             + W++ Q ER  YG+ DNLVRFSFGVEDF+D+KAD+LQALETI
Sbjct  286  RN-WEVPQEERLKYGLKDNLVRFSFGVEDFDDLKADILQALETI  328



>emb|CDX69530.1| BnaA10g18790D [Brassica napus]
Length=362

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RN+H++LGGTL+PNAAYL+IRG+KT+HLRV+QQNSTALRMA VLEAHPKV RVYYPG
Sbjct  184  SEIRNMHNLLGGTLSPNAAYLLIRGIKTMHLRVKQQNSTALRMAHVLEAHPKVSRVYYPG  243

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LP+HPEHHIAK+QMTGFGG+V+FEIDGDL TT KF+D+LKIPYIA SFGGCES VDQPA 
Sbjct  244  LPNHPEHHIAKRQMTGFGGLVTFEIDGDLETTIKFIDSLKIPYIATSFGGCESFVDQPAT  303

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET  218
             + WD+ Q ER  YG  DNLVRFSFGVEDFED+KAD+LQALET
Sbjct  304  RN-WDVPQEERLKYGHKDNLVRFSFGVEDFEDLKADILQALET  345



>ref|NP_001274915.1| cystathionine-gamma-synthase [Solanum tuberosum]
 gb|AAD31520.2|AF144102_1 cystathionine-gamma-synthase [Solanum tuberosum]
Length=583

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SV+RNLHHILGG LNPNAAYL IRG    HLR   +    LRMAE+LEAHPKV+ VYYPG
Sbjct  377  SVIRNLHHILGGALNPNAAYLAIRGRGLNHLRDSTKIQLHLRMAEILEAHPKVKHVYYPG  436

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IP IAPSF GC+SIVDQPAI
Sbjct  437  LPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPKIAPSFEGCKSIVDQPAI  496

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct  497  MSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI  540



>ref|XP_006400054.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
 gb|ESQ41507.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
Length=422

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LH++LGGTLNPNAAYL+IR MKT+HLRV+QQNSTALRMA+VLEAHPKV RVYYPG
Sbjct  242  SEIRILHNLLGGTLNPNAAYLLIRSMKTMHLRVKQQNSTALRMAQVLEAHPKVSRVYYPG  301

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK+QMTGFGG+V+FEI GDL TT KFVD+LKIPYIA SFGGCES VDQPA 
Sbjct  302  LPSHPEHHIAKRQMTGFGGLVTFEIAGDLETTFKFVDSLKIPYIATSFGGCESFVDQPAA  361

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             + W++ Q ER  YG+ DNLVRFSFGVEDF+D+KAD+LQALETI
Sbjct  362  RN-WEVPQEERLKYGLKDNLVRFSFGVEDFDDLKADILQALETI  404



>ref|XP_009122874.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Brassica 
rapa]
Length=439

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R +H++LGGTL+PNAAYL+IRG+KT+HLRV+QQNSTALRMA VLEAHPKV RVYYPG
Sbjct  261  SEIRIMHNLLGGTLSPNAAYLLIRGIKTMHLRVKQQNSTALRMAHVLEAHPKVSRVYYPG  320

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LP+HPEHHIAK+QMTGFGG+V+FEIDGDL TT KF+D+LKIPYIA SFGGCES VDQPA 
Sbjct  321  LPNHPEHHIAKRQMTGFGGLVTFEIDGDLETTIKFIDSLKIPYIATSFGGCESFVDQPAT  380

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET  218
             + WD+ Q ER  YG+ DNLVRFSFGVEDFED+KAD+LQALET
Sbjct  381  RN-WDVPQEERLKYGLKDNLVRFSFGVEDFEDLKADILQALET  422



>tpg|DAA45549.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
Length=234

 Score =   266 bits (681),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE HPK+ RVYYPG
Sbjct  72   SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEHPKIARVYYPG  131

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  132  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  191

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  192  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  234



>ref|XP_010937207.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Elaeis guineensis]
Length=512

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -3

Query  664  NPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQM  485
            N NAAY+I+RGMKTLHLRVQQQN TALRMA+ LE HPK+ RVYYPGLPSHPEHHIAK+QM
Sbjct  363  NDNAAYMILRGMKTLHLRVQQQNHTALRMAQFLEEHPKITRVYYPGLPSHPEHHIAKQQM  422

Query  484  TGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAY  305
            TGFGGVVSFE+ GDL TT KF+D+LKIPYIAPSFGGCESIVDQPAIMSYWDL+ +ERA Y
Sbjct  423  TGFGGVVSFEVAGDLRTTMKFIDSLKIPYIAPSFGGCESIVDQPAIMSYWDLSSSERATY  482

Query  304  GIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            GI D+LVRFSFGVEDFED+KAD++QALE I
Sbjct  483  GIKDSLVRFSFGVEDFEDLKADIVQALENI  512



>tpg|DAA45550.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
Length=277

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE HPK+ RVYYPG
Sbjct  115  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEHPKIARVYYPG  174

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  175  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  234

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  235  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  277



>ref|XP_008800507.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Phoenix 
dactylifera]
Length=144

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  646  LIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGV  467
            +I+RGMKTLHLRVQQQN TALRMA+ LE HPK+ RVYYPGLPSHPEHHIAK+QMTGFGGV
Sbjct  1    MILRGMKTLHLRVQQQNHTALRMAQFLEEHPKIIRVYYPGLPSHPEHHIAKQQMTGFGGV  60

Query  466  VSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNL  287
            VSFE+ GDL TT KFVD+LKIPYIAPSFGGCESIVDQPAIMSYWDL+ +ER  YGI DNL
Sbjct  61   VSFEVAGDLRTTMKFVDSLKIPYIAPSFGGCESIVDQPAIMSYWDLSASERVTYGIKDNL  120

Query  286  VRFSFGVEDFEDVKADVLQALETI  215
            +RFSFGVEDFED+KAD++QALE+I
Sbjct  121  IRFSFGVEDFEDLKADIIQALESI  144



>gb|EEC75352.1| hypothetical protein OsI_11784 [Oryza sativa Indica Group]
Length=220

 Score =   264 bits (675),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+ RVYYPG
Sbjct  58   SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPG  117

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  118  LPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCESIIDQPAI  177

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  178  MSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  220



>gb|ACF82119.1| unknown [Zea mays]
 gb|ACF83490.1| unknown [Zea mays]
 tpg|DAA45551.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
 tpg|DAA45552.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
 tpg|DAA45553.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
Length=322

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE HPK+ RVYYPG
Sbjct  160  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEHPKIARVYYPG  219

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  220  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  279

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  280  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  322



>ref|XP_009404092.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=540

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S ++  H+++GG LNPN AY+I+RGMKTLHLRVQ QNSTALRMA++LE HPK+  VYYPG
Sbjct  376  SKIQLYHNVVGGVLNPNDAYMILRGMKTLHLRVQNQNSTALRMAQLLEEHPKIIHVYYPG  435

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFEI GDL TT KF+D+LKIPYIAPSFGGCESI+DQPAI
Sbjct  436  LPSHPEHHIAKCQMTGFGGVVSFEIAGDLSTTKKFIDSLKIPYIAPSFGGCESIIDQPAI  495

Query  346  MSYWDLTQAERAA-YGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL++ ER A YGI DNLVRFSFGVE FED+ AD LQ+LE I
Sbjct  496  MSYWDLSRPERTAKYGIKDNLVRFSFGVEGFEDLNADNLQSLEKI  540



>gb|AAG51206.1|AC051630_3 cystathionine gamma-synthase, putative; 4884-7220 [Arabidopsis 
thaliana]
Length=373

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLH +LGGTLNPNAAYL+IRGMKT+HLRV+QQNST ++MA+VLEAHPKV RVYY G
Sbjct  211  SKIRNLHKLLGGTLNPNAAYLLIRGMKTMHLRVRQQNSTGMKMAQVLEAHPKVSRVYYLG  270

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH IAK+QMTG GG++SFEIDGDL TT KF+DALKIPY+A SFGGCES+VDQ A 
Sbjct  271  LPSHPEHLIAKRQMTGIGGLISFEIDGDLKTTIKFIDALKIPYLAASFGGCESLVDQLA-  329

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
               WD+ + ER   G  DNLVRFSFG+EDFED+KADVLQALETI
Sbjct  330  TGIWDIPREERLKDGFQDNLVRFSFGIEDFEDIKADVLQALETI  373



>ref|XP_002465206.1| hypothetical protein SORBIDRAFT_01g034130 [Sorghum bicolor]
 gb|EER92204.1| hypothetical protein SORBIDRAFT_01g034130 [Sorghum bicolor]
Length=322

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE HPK+ RVYYPG
Sbjct  160  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEHPKIARVYYPG  219

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  220  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDGTRRFIDSVKIPYHAPSFGGCESIIDQPAI  279

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  280  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  322



>gb|ABF96222.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
Length=322

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+ RVYYPG
Sbjct  160  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPG  219

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  220  LPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCESIIDQPAI  279

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  280  MSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  322



>gb|EEE59137.1| hypothetical protein OsJ_11031 [Oryza sativa Japonica Group]
Length=306

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+ RVYYPG
Sbjct  144  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPG  203

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  204  LPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCESIIDQPAI  263

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  264  MSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  306



>ref|NP_174600.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q9C876.1|CGS2_ARATH RecName: Full=Probable cystathionine gamma-synthase 2 [Arabidopsis 
thaliana]
 gb|AAG51279.1|AC027035_2 cystathionine gamma-synthase, putative [Arabidopsis thaliana]
 gb|AEE31583.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Arabidopsis thaliana]
Length=412

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLH +LGGTLNPNAAYL+IRGMKT+HLRV+QQNST ++MA+VLEAHPKV RVYY G
Sbjct  250  SKIRNLHKLLGGTLNPNAAYLLIRGMKTMHLRVRQQNSTGMKMAQVLEAHPKVSRVYYLG  309

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH IAK+QMTG GG++SFEIDGDL TT KF+DALKIPY+A SFGGCES+VDQ A 
Sbjct  310  LPSHPEHLIAKRQMTGIGGLISFEIDGDLKTTIKFIDALKIPYLAASFGGCESLVDQLA-  368

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
               WD+ + ER   G  DNLVRFSFG+EDFED+KADVLQALETI
Sbjct  369  TGIWDIPREERLKDGFQDNLVRFSFGIEDFEDIKADVLQALETI  412



>gb|AAG38873.1|AF076495_1 cystathionine gamma-synthase [Oryza sativa]
Length=360

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+ RVYYPG
Sbjct  198  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPG  257

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  258  LPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCESIIDQPAI  317

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  318  MSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  360



>gb|EMT23437.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=507

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNA+YLI+RGMKTLHLRVQ QNSTALRMA+ LE HPK+ RVYYPG
Sbjct  345  SKVRIYHHVVGGVLNPNASYLILRGMKTLHLRVQCQNSTALRMAQFLEEHPKIARVYYPG  404

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+DGD  +T KF+D +KIPY APSFGGCESI+DQPAI
Sbjct  405  LPSHPEHHIAKSQMTGFGGVVSFEVDGDFDSTRKFIDYVKIPYHAPSFGGCESIIDQPAI  464

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QAL  I
Sbjct  465  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDIVQALNKI  507



>ref|NP_001050220.1| Os03g0376100 [Oryza sativa Japonica Group]
 dbj|BAF12134.1| Os03g0376100, partial [Oryza sativa Japonica Group]
Length=360

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+ RVYYPG
Sbjct  198  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPG  257

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  258  LPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCESIIDQPAI  317

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  318  MSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  360



>ref|XP_010499872.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=386

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LH +LGGTLNPNAAYL+IR MKT+HLRV+Q NS ALRMA+VLEAHPKV RVYYPG
Sbjct  224  SKIRILHQLLGGTLNPNAAYLLIRSMKTMHLRVKQHNSNALRMAQVLEAHPKVSRVYYPG  283

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH IAK+QMTGFGG+V+FE+ GDL TT KFVD+LKIPYIA SFGGCES VDQPA 
Sbjct  284  LPSHPEHLIAKRQMTGFGGLVTFEVAGDLKTTIKFVDSLKIPYIATSFGGCESFVDQPAT  343

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             + WD+ + ER  Y + DNLVRFSFG+EDF+D+KADVLQAL+TI
Sbjct  344  RN-WDVPREERLKYELKDNLVRFSFGIEDFDDIKADVLQALDTI  386



>gb|ACF83809.1| unknown [Zea mays]
 gb|ACL52497.1| unknown [Zea mays]
 gb|ACN34605.1| unknown [Zea mays]
 gb|AFW87951.1| hypothetical protein ZEAMMB73_590146 [Zea mays]
Length=322

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H K+ RVYYPG
Sbjct  160  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEHLKIARVYYPG  219

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  220  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  279

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  280  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  322



>gb|KEH25015.1| cystathionine gamma-synthase [Medicago truncatula]
Length=457

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR+ H ILGGTL+PN+AYL+IRGMKTLHLRVQ QNSTA++MA++LE HPKV RVYYPG
Sbjct  294  SQVRSFHFILGGTLSPNSAYLVIRGMKTLHLRVQHQNSTAMKMAQLLETHPKVTRVYYPG  353

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPE+ +AK+QMTGFGGVV F+IDGD+M T KFVD+LKIPYIAPSFGG ES+V+QPAI
Sbjct  354  LPSHPEYALAKRQMTGFGGVVCFDIDGDIMRTIKFVDSLKIPYIAPSFGGVESVVNQPAI  413

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL + ER  Y I DN VRF FGVE +ED+K DVLQAL+ I
Sbjct  414  MSYWDLPRKEREKYRIYDNTVRFCFGVEGYEDLKDDVLQALDAI  457



>ref|XP_003618534.1| Cystathionine-gamma-synthase [Medicago truncatula]
 gb|AES74752.1| cystathionine gamma-synthase [Medicago truncatula]
Length=477

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR+ H ILGGTL+PN+AYL+IRGMKTLHLRVQ QNSTA++MA++LE HPKV RVYYPG
Sbjct  314  SQVRSFHFILGGTLSPNSAYLVIRGMKTLHLRVQHQNSTAMKMAQLLETHPKVTRVYYPG  373

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPE+ +AK+QMTGFGGVV F+IDGD+M T KFVD+LKIPYIAPSFGG ES+V+QPAI
Sbjct  374  LPSHPEYALAKRQMTGFGGVVCFDIDGDIMRTIKFVDSLKIPYIAPSFGGVESVVNQPAI  433

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL + ER  Y I DN VRF FGVE +ED+K DVLQAL+ I
Sbjct  434  MSYWDLPRKEREKYRIYDNTVRFCFGVEGYEDLKDDVLQALDAI  477



>ref|XP_003557832.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Brachypodium 
distachyon]
Length=507

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNA+YLI+RGMKTLHLRVQ QN+TALRMA+ LE HPK+ RVYYPG
Sbjct  345  SKVRIYHHVVGGVLNPNASYLILRGMKTLHLRVQCQNNTALRMAQFLEEHPKIARVYYPG  404

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE++GD  +T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  405  LPSHPEHHIAKSQMTGFGGVVSFEVNGDFDSTRKFIDSVKIPYHAPSFGGCESIIDQPAI  464

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QAL+ I
Sbjct  465  MSYWD-SKEQRDIYGIKDNLIRFSVGVEDFEDLKNDIVQALDKI  507



>gb|AAL82522.1|AC084766_8 putative cystathionine gamma synthase [Oryza sativa Japonica 
Group]
Length=446

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+ RVYYPG
Sbjct  284  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPG  343

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  344  LPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCESIIDQPAI  403

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  404  MSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  446



>ref|NP_001104875.1| cystathionine gamma-synthase1 [Zea mays]
 gb|AAB61347.1| cystathionine gamma-synthase [Zea mays]
Length=509

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE HPK+ RVYYPG
Sbjct  347  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEHPKIARVYYPG  406

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  407  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  466

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  467  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  509



>dbj|BAJ84799.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNA+YLI+RGMKTLHLRVQ QN+TALRMA+ LE HPK+ RVYYPG
Sbjct  345  SKVRIYHHVVGGVLNPNASYLILRGMKTLHLRVQCQNNTALRMAQFLEEHPKIARVYYPG  404

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+DGD  +T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  405  LPSHPEHHIAKSQMTGFGGVVSFEVDGDFDSTRRFIDSVKIPYHAPSFGGCESIIDQPAI  464

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDF D+K D++QAL+ I
Sbjct  465  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFGDLKNDIVQALDKI  507



>gb|ABR16369.1| unknown [Picea sitchensis]
 gb|ABR18082.1| unknown [Picea sitchensis]
Length=521

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR LH++LGG L+PNAAYLI+RG+KTLHLRVQQQNSTALR+A  LEAHPKV RV+YPGL 
Sbjct  360  VRALHNVLGGVLSPNAAYLILRGIKTLHLRVQQQNSTALRIARTLEAHPKVSRVHYPGLE  419

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEHHIAK+QM+GFGGVVSFEI GDL  T++F+D+LKIPYIAPS GGCES+V+QP I+S
Sbjct  420  SHPEHHIAKRQMSGFGGVVSFEIVGDLQATSRFIDSLKIPYIAPSLGGCESLVEQPTIIS  479

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWD +  ERA  GI DNLVRFS GVE F+D+++DVLQALE +
Sbjct  480  YWDQSSEERARLGIKDNLVRFSCGVEAFDDIESDVLQALEAV  521



>ref|XP_010478750.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010478751.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=402

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LH +LGGTLNPNAAYL+IR MKT+HLRV+Q NS ALRMA+VLEAHPKV RVYYPG
Sbjct  240  SKIRILHQLLGGTLNPNAAYLLIRSMKTMHLRVKQHNSNALRMAQVLEAHPKVSRVYYPG  299

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH IAK+QMTGFGG+V+FE+ GDL  T KF+D+LKIPYIA SFGGCES VDQPA 
Sbjct  300  LPSHPEHLIAKRQMTGFGGLVTFEVAGDLKKTIKFIDSLKIPYIATSFGGCESFVDQPAT  359

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             + WD+ + ER  Y + DNLVRFSFG+EDF+D+KADVLQAL+TI
Sbjct  360  RN-WDVPREERLKYELNDNLVRFSFGIEDFDDIKADVLQALDTI  402



>gb|ABF96221.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
Length=502

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+ RVYYPG
Sbjct  340  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPG  399

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  400  LPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCESIIDQPAI  459

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  460  MSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  502



>ref|XP_010461154.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Camelina sativa]
 ref|XP_010461155.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=402

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LH +LGGTLNPNAAYL+IR MKT+HLRV+Q NS ALRMA+VLEAHPKV RVYYPG
Sbjct  240  SKIRILHQLLGGTLNPNAAYLLIRSMKTMHLRVKQHNSNALRMAQVLEAHPKVSRVYYPG  299

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH IAK+QMTGFGG+V+FE+ GDL  T KF+D+LKIPYIA SFGGCES VDQPA 
Sbjct  300  LPSHPEHLIAKRQMTGFGGLVTFEVAGDLKKTIKFIDSLKIPYIATSFGGCESFVDQPAT  359

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             + WD+ + ER  Y + DNLVRFSFG+EDF+D+KADVLQAL+TI
Sbjct  360  RN-WDVPREERLNYELNDNLVRFSFGIEDFDDIKADVLQALDTI  402



>ref|XP_004172088.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Cucumis 
sativus]
Length=139

 Score =   253 bits (646),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  631  MKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI  452
            MKT+HLRVQQQNS+ L+MA +LEAHPK++ VYYPGLPSHPEH++AK+QMTGFGGVVSFE+
Sbjct  1    MKTMHLRVQQQNSSGLKMAMLLEAHPKIKCVYYPGLPSHPEHNLAKRQMTGFGGVVSFEV  60

Query  451  DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSF  272
            DGDLMTTAKF+D+LKIPYIAPSFGGCESI+DQPAIMSYWDL Q ER  YGI DNLVRFS 
Sbjct  61   DGDLMTTAKFIDSLKIPYIAPSFGGCESIIDQPAIMSYWDLNQTERLKYGIKDNLVRFSI  120

Query  271  GVEDFEDVKADVLQALETI  215
            G+EDFED+KAD+LQAL+ I
Sbjct  121  GIEDFEDLKADILQALDAI  139



>ref|NP_001130426.1| uncharacterized protein LOC100191523 [Zea mays]
 gb|ACF78628.1| unknown [Zea mays]
Length=481

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H K+ RVYYPG
Sbjct  319  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEHLKIARVYYPG  378

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  379  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  438

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  439  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  481



>ref|XP_004984247.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Setaria 
italica]
Length=511

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+ RVYYPG
Sbjct  349  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKIARVYYPG  408

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T +F+D++KIPY APSFGGCESI+DQPAI
Sbjct  409  LPSHPEHHIAKTQMTGFGGVVSFEVAGDFDGTRRFIDSVKIPYHAPSFGGCESIIDQPAI  468

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE +
Sbjct  469  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKV  511



>gb|AFW87953.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_590146 [Zea 
mays]
Length=485

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H K+ RVYYPG
Sbjct  323  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEHLKIARVYYPG  382

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  383  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  442

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  443  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  485



>ref|XP_010461152.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010461153.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=429

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R LH +LGGTLNPNAAYL+IR MKT+HLRV+Q NS ALRMA+VLEAHPKV RVYYPG
Sbjct  267  SKIRILHQLLGGTLNPNAAYLLIRSMKTMHLRVKQHNSNALRMAQVLEAHPKVSRVYYPG  326

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEH IAK+QMTGFGG+V+FE+ GDL  T KF+D+LKIPYIA SFGGCES VDQPA 
Sbjct  327  LPSHPEHLIAKRQMTGFGGLVTFEVAGDLKKTIKFIDSLKIPYIATSFGGCESFVDQPAT  386

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             + WD+ + ER  Y + DNLVRFSFG+EDF+D+KADVLQAL+TI
Sbjct  387  RN-WDVPREERLNYELNDNLVRFSFGIEDFDDIKADVLQALDTI  429



>gb|AAB61348.1| cystathionine gamma-synthase [Zea mays]
Length=509

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H K+ RVYYPG
Sbjct  347  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEHLKIARVYYPG  406

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  407  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  466

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  467  MSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  509



>ref|XP_009772869.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase, 
chloroplastic-like, partial [Nicotiana sylvestris]
Length=445

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNS AL MAE+LEAHPKV+ V +PG
Sbjct  301  SVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSNALSMAEILEAHPKVKHVXFPG  360

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDL-MTTAKFVDALKIPYIAPSFGGCESIVDQPA  350
            LPSHPE+HIAKKQMTGFGGVVSFE    + +TTAKFVDAL+IPYIAPSFGGCESIVDQPA
Sbjct  361  LPSHPEYHIAKKQMTGFGGVVSFEATFFVRLTTAKFVDALRIPYIAPSFGGCESIVDQPA  420

Query  349  IMSYWDLTQAERAAYGIMDNLVRFS  275
            IMSYWDL+Q++RA YGIMDNLVRFS
Sbjct  421  IMSYWDLSQSDRAKYGIMDNLVRFS  445



>ref|XP_001761633.1| predicted protein [Physcomitrella patens]
 gb|EDQ73701.1| predicted protein [Physcomitrella patens]
Length=526

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR LH+ILGG ++PNAAYLI+RG+KTL LRV+QQN TA  +A+ LEAHPKV RV+YPG
Sbjct  363  SAVRALHNILGGVVDPNAAYLILRGLKTLDLRVKQQNKTAYLLAQNLEAHPKVARVHYPG  422

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH IAK+QMTGFGGV+SFEIDGDL TT+KF+D L+IPYIAPS GG ES+V+QP I
Sbjct  423  LESHPEHQIAKRQMTGFGGVISFEIDGDLETTSKFIDGLRIPYIAPSLGGVESLVEQPTI  482

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWD + AERA  GI DNLVRFS GVED+ED+  DV+Q+L+ +
Sbjct  483  ISYWDQSPAERARIGIKDNLVRFSCGVEDYEDILNDVMQSLDAL  526



>ref|XP_002965872.1| hypothetical protein SELMODRAFT_143363 [Selaginella moellendorffii]
 gb|EFJ33292.1| hypothetical protein SELMODRAFT_143363 [Selaginella moellendorffii]
Length=466

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -3

Query  703  VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGL  524
             VR LH++LGG ++ +AAYLI RG+KTL LRV+QQNS ALR+A  LE+HPK+ RV+YPGL
Sbjct  304  TVRKLHNVLGGVVDAHAAYLIGRGLKTLDLRVRQQNSNALRLARALESHPKIARVHYPGL  363

Query  523  PSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
             SHPE HIA KQM GFGGVVSFEIDGDL  T+KF+D L+IPYIAPS GGCES+V+QP I+
Sbjct  364  ESHPEFHIASKQMRGFGGVVSFEIDGDLALTSKFIDGLRIPYIAPSLGGCESLVEQPTII  423

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            SYWD + AERA  GI DNLVRFS G+ED+ED+ ADV+Q+L ++
Sbjct  424  SYWDQSPAERAKMGIKDNLVRFSCGIEDYEDIYADVMQSLASL  466



>ref|XP_002983120.1| hypothetical protein SELMODRAFT_155550 [Selaginella moellendorffii]
 gb|EFJ15929.1| hypothetical protein SELMODRAFT_155550 [Selaginella moellendorffii]
Length=467

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -3

Query  703  VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGL  524
             VR LH++LGG ++ +AAYLI RG+KTL LRV+QQNS ALR+A  LE+HPK+ RV+YPGL
Sbjct  305  TVRKLHNVLGGVVDAHAAYLIGRGLKTLDLRVRQQNSNALRLARALESHPKIARVHYPGL  364

Query  523  PSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
             SHPE HIA KQM GFGGVVSFEIDGDL  T+KF+D L+IPYIAPS GGCES+V+QP I+
Sbjct  365  ESHPEFHIASKQMRGFGGVVSFEIDGDLALTSKFIDGLRIPYIAPSLGGCESLVEQPTII  424

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            SYWD + AERA  GI DNLVRFS G+ED+ED+ ADV+Q+L ++
Sbjct  425  SYWDQSPAERAKMGIKDNLVRFSCGIEDYEDIYADVMQSLASL  467



>ref|XP_001772529.1| predicted protein [Physcomitrella patens]
 gb|EDQ62571.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR LH+ILGG ++PNAAYLI+RG+KTL LRV+QQN TAL +A+ LEAHPKV RV+YPG
Sbjct  369  SAVRALHNILGGVVDPNAAYLILRGLKTLDLRVKQQNRTALLLAQKLEAHPKVARVHYPG  428

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEH IAK+QM+GFGGV+SFEI+GDL TT+ F+D L+IPYIAPS GG ES+V+QP I
Sbjct  429  LESHPEHQIAKRQMSGFGGVISFEINGDLETTSNFIDGLRIPYIAPSLGGVESLVEQPTI  488

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWD + AERA  GI DNLVRFS G+ED+ED+  DV+Q+L  +
Sbjct  489  ISYWDQSPAERARLGIKDNLVRFSCGIEDYEDILNDVMQSLNAL  532



>gb|KJB75687.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=519

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP+V+RVYYPGLP
Sbjct  377  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPRVKRVYYPGLP  436

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHPEH IAK+QMTGFGGVVSFE+DGDL TT KFVDALKIPYIAPSFGGCESIVD PAIMS
Sbjct  437  SHPEHEIAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGGCESIVDPPAIMS  496

Query  340  YW  335
            YW
Sbjct  497  YW  498



>gb|EMS45856.1| Cystathionine gamma-synthase, chloroplastic [Triticum urartu]
Length=723

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = -3

Query  658  NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  479
            NA+YLI+RGMKTLHLRVQ QNSTALRMA+ LE HPK+ RVYYPGLPSHPEHHIAK QMTG
Sbjct  577  NASYLILRGMKTLHLRVQCQNSTALRMAQFLEEHPKIARVYYPGLPSHPEHHIAKSQMTG  636

Query  478  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  299
            FGGVVSFE+DGD  +T KF+D++KIPY APSFGGCESI+DQPAIMSYWD ++ +R  YGI
Sbjct  637  FGGVVSFEVDGDFDSTRKFIDSVKIPYHAPSFGGCESIIDQPAIMSYWD-SKEQRDIYGI  695

Query  298  MDNLVRFSFGVEDFEDVKADVLQALETI  215
             DNL+RFS GVEDFED+K D++QAL  I
Sbjct  696  KDNLIRFSIGVEDFEDLKNDIVQALNKI  723



>ref|XP_003057119.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58764.1| predicted protein [Micromonas pusilla CCMP1545]
Length=374

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
             R  H+I+GG L+P+AAYL++RGMKTL LRV + N  A+R+A +LEAHPK+  V+YPGLP
Sbjct  212  CRQFHNIMGGVLDPHAAYLVLRGMKTLSLRVARHNDNAMRLATLLEAHPKIDVVHYPGLP  271

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP+H +AK+ M+GFGGVVSFE+ GDL  TAKF+DA  +PYIAPS GG ES+++QP I+S
Sbjct  272  SHPDHEVAKRYMSGFGGVVSFEVKGDLWATAKFIDACNLPYIAPSLGGVESLIEQPTIVS  331

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWD    +RA  GI DNLVR++ G+EDFED+ +DVLQALE I
Sbjct  332  YWDYGAEQRAELGIKDNLVRYACGIEDFEDIASDVLQALEQI  373



>ref|XP_003561880.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Brachypodium 
distachyon]
Length=467

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QN TALRMA +LE HPK+ RVYYPG
Sbjct  304  SRIRAWHHDLGGAISPDAAYMIIRGLKTMALRVETQNRTALRMARLLENHPKIERVYYPG  363

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P HH+AK QMTGFGGV+SFE+  DL    +FVDAL+IP+IA S GGCES+V QPA+
Sbjct  364  LKSSPWHHVAKSQMTGFGGVISFEVASDLRGVMRFVDALEIPFIATSLGGCESLVQQPAV  423

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W  +  E++  GI DNLVRFSFG+E FED++ D+LQALE +
Sbjct  424  MSFWGQSDEEKSKNGITDNLVRFSFGIEKFEDLRDDILQALEKV  467



>ref|XP_009602125.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Nicotiana tomentosiformis]
Length=565

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 124/164 (76%), Gaps = 36/164 (22%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            SV+RNLHHILGG LNP                                    VR VYYPG
Sbjct  438  SVIRNLHHILGGALNP------------------------------------VRHVYYPG  461

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  462  LQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAI  521

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  522  MSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  565



>ref|XP_009775846.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Nicotiana sylvestris]
Length=502

 Score =   231 bits (590),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 123/164 (75%), Gaps = 36/164 (22%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +RNLHHILGG LNP                                    VR VYYPG
Sbjct  375  SEIRNLHHILGGALNP------------------------------------VRHVYYPG  398

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGGCESIVDQPAI
Sbjct  399  LQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCESIVDQPAI  458

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  459  MSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  502



>gb|EMT09613.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=457

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QN TALRMA +LE HPK+ +VYYPG
Sbjct  294  SRIRAWHHDLGGAISPDAAYMIIRGLKTMALRVETQNHTALRMARLLENHPKIEQVYYPG  353

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H IAK+QMTGFGGV+SFE+  DL     FVDAL+IP+IA S GGCES+V QPA+
Sbjct  354  LLSSPWHDIAKRQMTGFGGVISFEVASDLHGVMMFVDALEIPFIATSLGGCESLVQQPAV  413

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W  +  E+A  GI DNLVRFSFG+E+FED++ D+LQALE I
Sbjct  414  MSFWGQSGEEKAKNGIKDNLVRFSFGIENFEDLRDDILQALEKI  457



>ref|XP_003081090.1| O-succinylhomoserine (ISS) [Ostreococcus tauri]
Length=301

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            +  R  H+ILGG ++P+AAYL++RG+KTL LRV++ N +A+++A+ LEAHPK+ +V+YPG
Sbjct  138  AACRQFHNILGGVIDPHAAYLVLRGLKTLSLRVERHNESAMKLAQFLEAHPKIDKVHYPG  197

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSH +H +AKK M GFGGVVSFE+ GDL  TAKF+D+ KIPYIAPS GG ES+++QP I
Sbjct  198  LPSHCDHEVAKKYMKGFGGVVSFEVKGDLWKTAKFIDSCKIPYIAPSLGGVESLIEQPTI  257

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWD     RA  GI DNLVR+S G+ED+ D++AD+ QAL+ I
Sbjct  258  VSYWDYAPEVRAEIGIKDNLVRYSTGIEDYADIEADMAQALDQI  301



>dbj|BAJ93384.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QN T+LRMA +LE HPK+ RVYYPG
Sbjct  297  SRIRAWHHDLGGAISPDAAYMIIRGLKTMALRVETQNRTSLRMARLLENHPKIERVYYPG  356

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H IAK QMTGFGGV+SFE+  DL    +F+DAL+IP+IA S GGCES+V QPA+
Sbjct  357  LLSSPWHDIAKSQMTGFGGVISFEVASDLHGVMRFIDALEIPFIATSLGGCESLVQQPAV  416

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W  ++ E++  GI DNLVRFSFG+E FED++ D++QALE I
Sbjct  417  MSFWGQSEEEKSKNGIKDNLVRFSFGIEKFEDLRDDIIQALEKI  460



>ref|XP_007510517.1| cystathionine gamma-synthase [Bathycoccus prasinos]
 emb|CCO18050.1| cystathionine gamma-synthase [Bathycoccus prasinos]
Length=453

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  H+I+GG L+P+AAYLI+RG+KTL LRV++ NS A R+AE LEAHPK+ +V+YPG
Sbjct  290  SKVRAFHNIVGGVLDPHAAYLILRGLKTLSLRVERHNSNAQRLAEWLEAHPKIAKVHYPG  349

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SH +H +AKK MTGFGGVVSFE+DGDL  TAKF+D  ++PYIAPS GG ES+++QP +
Sbjct  350  LKSHQDHEVAKKYMTGFGGVVSFEVDGDLWQTAKFIDECRLPYIAPSLGGVESLIEQPTV  409

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWD    +RAA GI DNLVRF+ G+ED+ D++AD  QAL+ I
Sbjct  410  VSYWDQGPEKRAAIGIKDNLVRFACGIEDYADIEADFKQALDKI  453



>gb|EMS47533.1| Cystathionine gamma-synthase, chloroplastic [Triticum urartu]
Length=460

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QNSTALRMA +LE HPK+ RVYYPG
Sbjct  297  SRIRAWHHDLGGAISPDAAYMIIRGLKTMVLRVETQNSTALRMARLLENHPKIERVYYPG  356

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P HHIA  QMTG GGV+SF++  DL    +F+DAL+IP+IA S GGCES+V QPA+
Sbjct  357  LISSPWHHIANSQMTGCGGVISFKVASDLHGVMRFIDALEIPFIATSLGGCESLVQQPAV  416

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W     E+A  GI DNLVRFSFGVE FED++ D+LQALE I
Sbjct  417  MSFWGENDEEKAKNGIKDNLVRFSFGVEKFEDLRDDILQALEKI  460



>ref|XP_005651362.1| cystathionine gamma-synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE26818.1| cystathionine gamma-synthase [Coccomyxa subellipsoidea C-169]
Length=477

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            + VR++H++LGGT++P+AAYL++RGMKTL +RVQ+QN+TA+ +A  LE HP++ RV+YPG
Sbjct  313  AAVRSMHNVLGGTIDPHAAYLLLRGMKTLDVRVQRQNTTAMELARRLEEHPRITRVHYPG  372

Query  526  LPSHPEHHIAKKQMTG-FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPA  350
            LPSHP+HHIA  QM G FGGVVSFE+D DL  TAKFVD++++PYIAPS GG +S+++QP 
Sbjct  373  LPSHPDHHIAVDQMLGGFGGVVSFEVDADLWGTAKFVDSVRLPYIAPSLGGVDSLIEQPT  432

Query  349  IMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            ++SYWD    +RA YGI DNL+RFS G+E  ED+  D+LQAL  I
Sbjct  433  VISYWDQGPEKRAEYGIKDNLIRFSCGIESMEDIWQDLLQALAKI  477



>ref|XP_004983123.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Setaria 
italica]
 ref|XP_004983124.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Setaria 
italica]
Length=448

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+  N TAL MA +LE HPK+ RV+YPG
Sbjct  285  SKIRAWHHDLGGAISPNAAYMIIRGLKTMALRVEAHNRTALDMARLLELHPKIERVHYPG  344

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S+P H +AK QMTG+GGVVSFE+  DL  T +FVDAL+IP IA S GGCES+V QPA+
Sbjct  345  LESNPWHQVAKSQMTGYGGVVSFEVKSDLCGTMRFVDALEIPLIATSLGGCESLVQQPAV  404

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W  +  E+A  GI DNLVRFSFG+E FED++ D+LQALE I
Sbjct  405  MSFWGKSDDEKAKNGIKDNLVRFSFGIEKFEDLRDDILQALEKI  448



>ref|NP_001064539.1| Os10g0399200 [Oryza sativa Japonica Group]
 gb|AAK50405.1|AC021891_6 Putative cystathionine gamma synthase (O-succinylhomoserine (thiol)-lyase) 
[Oryza sativa Japonica Group]
 gb|AAP53634.1| Cys/Met metabolism PLP-dependent enzyme family protein [Oryza 
sativa Japonica Group]
 dbj|BAF26453.1| Os10g0399200 [Oryza sativa Japonica Group]
 gb|EAZ15991.1| hypothetical protein OsJ_31435 [Oryza sativa Japonica Group]
Length=472

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KTL LRV+ QN TALRMA +LE HPK+ RVYYPG
Sbjct  309  SRIRAWHHDLGGAISPNAAYMIIRGLKTLALRVEAQNRTALRMARLLEKHPKIERVYYPG  368

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A +QM G GGVVSFE+  D+    +FVDAL++P IA S GGCES+V QPA+
Sbjct  369  LESSPWHGVATRQMAGAGGVVSFEVASDMRGVMRFVDALELPLIATSLGGCESLVQQPAV  428

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYW  ++ E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct  429  MSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI  472



>ref|XP_001419722.1| cystathione gamma synthase [Ostreococcus lucimarinus CCE9901]
 gb|ABO98015.1| cystathione gamma synthase [Ostreococcus lucimarinus CCE9901]
Length=433

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            +  R  H+ILGG ++P+AAYL++RG+KTL LRV++ N +A+R+A+ LE HPK+ +V+YPG
Sbjct  270  AACRQFHNILGGVIDPHAAYLVLRGLKTLSLRVERHNDSAMRLAQYLEKHPKIDKVHYPG  329

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSH +H +AKK M GFGGVVSFE+ GDL  TAKF+D+ ++PYIAPS GG ES+++QP +
Sbjct  330  LPSHCDHEVAKKYMKGFGGVVSFEVKGDLWATAKFIDSCELPYIAPSLGGVESLIEQPTV  389

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWD    +RA  GI DNLVRFS G+ED+ D++AD+ QALE I
Sbjct  390  VSYWDQGPEKRAEIGIKDNLVRFSTGIEDYVDIEADIAQALEKI  433



>emb|CEF98968.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Ostreococcus tauri]
Length=430

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            +  R  H+ILGG ++P+AAYL++RG+KTL LRV++ N +A+++A+ LEAHPK+ +V+YPG
Sbjct  267  AACRQFHNILGGVIDPHAAYLVLRGLKTLSLRVERHNESAMKLAQFLEAHPKIDKVHYPG  326

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSH +H +AKK M GFGGVVSFE+ GDL  TAKF+D+ KIPYIAPS GG ES+++QP I
Sbjct  327  LPSHCDHEVAKKYMKGFGGVVSFEVKGDLWKTAKFIDSCKIPYIAPSLGGVESLIEQPTI  386

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWD     RA  GI DNLVR+S G+ED+ D++AD+ QAL+ I
Sbjct  387  VSYWDYAPEVRAEIGIKDNLVRYSTGIEDYADIEADMAQALDQI  430



>ref|XP_002467292.1| hypothetical protein SORBIDRAFT_01g023050 [Sorghum bicolor]
 gb|EER94290.1| hypothetical protein SORBIDRAFT_01g023050 [Sorghum bicolor]
Length=468

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH +GG ++PNAAY++IRG+KT+ LRV+  NSTALRMA +LE HPK+ RV+YPG
Sbjct  305  SRIRAWHHDIGGAISPNAAYMVIRGLKTMALRVEAHNSTALRMARILERHPKIERVHYPG  364

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A  QM+G+GGVVSFE+  DL  T  FVDAL+IP+IA S GGCES+V QPA+
Sbjct  365  LESSPWHEVATSQMSGYGGVVSFELKADLHGTMSFVDALEIPFIATSLGGCESLVQQPAV  424

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W  +Q E+A  GI DN+VRFSFG+E F+D++ D+LQAL  I
Sbjct  425  MSFWGQSQEEKAKNGIKDNMVRFSFGIEKFQDLRDDILQALNRI  468



>gb|EMT09614.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=466

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++P++AY+IIRG+KT+ LRV+ QN TALRMA +LE HPK+ RVYYPG
Sbjct  303  SRIRAWHHDLGGAISPDSAYMIIRGLKTMGLRVETQNRTALRMARLLENHPKIERVYYPG  362

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H IAK QMTGFGGV+SFE+  DL    +F+DAL+IP+IA S GGCES+V QPA+
Sbjct  363  LLSSPWHDIAKSQMTGFGGVISFEVASDLHGIMRFIDALEIPFIATSLGGCESLVQQPAV  422

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W  +  E+A  GI DNLVR  FG+E FED+K D+LQALE I
Sbjct  423  MSFWGQSYEEKANNGIKDNLVRLIFGIEKFEDLKDDILQALEKI  466



>gb|EAY78389.1| hypothetical protein OsI_33476 [Oryza sativa Indica Group]
Length=486

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE HPK+ RVYYPG
Sbjct  323  SRIRAWHHDLGGAISPNAAYMIIRGLKTIALRVEAQNRTALRMARLLEKHPKIERVYYPG  382

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A +QM G GGVVSF++  DL    +FVDAL++P IA S GGCES+V QPA+
Sbjct  383  LESSPWHGVATRQMAGAGGVVSFDVASDLRGVMRFVDALELPLIATSLGGCESLVQQPAV  442

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYW  ++ E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct  443  MSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI  486



>ref|XP_002506028.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67286.1| predicted protein [Micromonas sp. RCC299]
Length=376

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR  H+ILGG ++P+AAYL++RG+KTL LRV++ N  A+++A  LE HP + +V+YPGLP
Sbjct  202  VRQFHNILGGVIDPHAAYLVMRGIKTLQLRVERHNENAMKLATALEKHPMIEKVHYPGLP  261

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP+H +AKK M GFGGVVSFE+ GDL  TAKF+D  ++PYIAPS GG ES+++QP ++S
Sbjct  262  SHPDHEVAKKYMNGFGGVVSFEVKGDLWATAKFIDNCRLPYIAPSLGGVESLIEQPTVVS  321

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YWD     RA  GI DNLVR + G+ED+ D++AD++QAL++I
Sbjct  322  YWDQGPERRAEIGIKDNLVRMACGIEDYADIEADIIQALDSI  363



>ref|XP_008666693.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Zea 
mays]
 tpg|DAA50062.1| TPA: hypothetical protein ZEAMMB73_527983 [Zea mays]
Length=467

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R  HH LGG ++P+AAY++IRG+KT+ LRV+  NSTALRMA +LE HPK+ RV+YPGL 
Sbjct  306  IRAWHHHLGGVISPSAAYMVIRGLKTMALRVEAHNSTALRMARMLERHPKIERVHYPGLE  365

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            S P H +A+ +M+G+GGVVSFE+  DL  T +FVDAL+IP+IA S GGCES+V QPA+MS
Sbjct  366  SSPWHELARTRMSGYGGVVSFELKADLRGTMRFVDALEIPFIATSLGGCESLVQQPAVMS  425

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +W  ++ ++A  GI DNLVRFSFG+E FED++ D+LQAL  I
Sbjct  426  FWGHSEEDKAKNGIKDNLVRFSFGIEKFEDLRDDILQALNKI  467



>gb|KDD72103.1| Cys/Met metabolism PLP-dependent enzyme, partial [Helicosporidium 
sp. ATCC 50920]
Length=172

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            + VR +H++LGGTL+P+AAYL++RG+KTL LRVQ+ +++AL +A  LE HPKV+RV+YPG
Sbjct  8    AAVRAMHNVLGGTLDPHAAYLLLRGLKTLDLRVQRADASALELARRLEEHPKVQRVHYPG  67

Query  526  LPSHPEHHIAKKQMTG-FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPA  350
            L SHP+  +A++QM G +GG+VSFE+ GDL T A+ VDA+++PYIAPS GG ES+++QP 
Sbjct  68   LDSHPDAAVARRQMAGGYGGLVSFEVRGDLWTAARVVDAVRLPYIAPSLGGVESLIEQPT  127

Query  349  IMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  221
            ++SYWD T  +RA  GI D L+RFS GVE+FED+  D+ QALE
Sbjct  128  VVSYWDHTPQQRADLGISDQLIRFSVGVENFEDLWQDLAQALE  170



>ref|XP_008666694.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Zea 
mays]
Length=468

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY +IRG+KT+ LRV+  NSTALRMA +LE HPK+ RV+YPG
Sbjct  305  SRIRAWHHQLGGAISPNAAYTVIRGLKTMALRVEAHNSTALRMARMLERHPKIERVHYPG  364

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A+ QM+G+GGVV  E+  DL  T  FVDAL+IP+IA S GGCES+V QPA+
Sbjct  365  LESSPWHEVARTQMSGYGGVVRLELKADLRGTMSFVDALEIPFIATSLGGCESLVQQPAV  424

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W  +Q ++   GI DNLVRFSFG+E FED++ D+LQAL  I
Sbjct  425  MSFWGRSQEDKTKNGIKDNLVRFSFGIEKFEDLQDDILQALNRI  468



>tpg|DAA50063.1| TPA: hypothetical protein ZEAMMB73_244612 [Zea mays]
Length=473

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY +IRG+KT+ LRV+  NSTALRMA +LE HPK+ RV+YPG
Sbjct  310  SRIRAWHHQLGGAISPNAAYTVIRGLKTMALRVEAHNSTALRMARMLERHPKIERVHYPG  369

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A+ QM+G+GGVV  E+  DL  T  FVDAL+IP+IA S GGCES+V QPA+
Sbjct  370  LESSPWHEVARTQMSGYGGVVRLELKADLRGTMSFVDALEIPFIATSLGGCESLVQQPAV  429

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+W  +Q ++   GI DNLVRFSFG+E FED++ D+LQAL  I
Sbjct  430  MSFWGRSQEDKTKNGIKDNLVRFSFGIEKFEDLQDDILQALNRI  473



>gb|EAY78386.1| hypothetical protein OsI_33473 [Oryza sativa Indica Group]
Length=473

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KTL LRVQ QN TALRMA++LE HPK+ RVYYPG
Sbjct  310  SRIRTWHHDLGGAISPNAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKHPKIERVYYPG  369

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GGCES+V QPAI
Sbjct  370  LESSPWHGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGGCESLVQQPAI  429

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYW     E+A  GI DN VRFSFG+E FED++ D+LQAL  I
Sbjct  430  MSYWGKCDEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALGKI  473



>ref|XP_005846526.1| hypothetical protein CHLNCDRAFT_24830 [Chlorella variabilis]
 gb|EFN54424.1| hypothetical protein CHLNCDRAFT_24830 [Chlorella variabilis]
Length=412

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            + VR +H++LGGT++P+A+YL++RGMKTL LRVQ+QN+TA  +A  LEAHP V RV+YPG
Sbjct  249  AAVRAMHNVLGGTIDPHASYLLLRGMKTLDLRVQRQNATATDIAARLEAHPLVTRVHYPG  308

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHP+H IA  QM+G+GGVVSFE+DGDL  TA+FVD++++PYIAPS GG ES+++QP +
Sbjct  309  LASHPDHAIAAAQMSGYGGVVSFEVDGDLWRTARFVDSVQLPYIAPSLGGVESLIEQPTV  368

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWD    +RA  GI DNL+RFS G+E  +D+ AD  QA   I
Sbjct  369  ISYWDQGAEKRAQVGIKDNLIRFSCGIESADDIWADFEQAFAKI  412



>ref|NP_001064540.1| Os10g0399700 [Oryza sativa Japonica Group]
 gb|AAK50410.1|AC021891_11 Putative cystathionine gamma synthase (O-succinylhomoserine (thiol)-lyase) 
[Oryza sativa Japonica Group]
 gb|AAP53639.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26454.1| Os10g0399700 [Oryza sativa Japonica Group]
 gb|EAZ15992.1| hypothetical protein OsJ_31436 [Oryza sativa Japonica Group]
Length=486

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE HPK+ RVYYPG
Sbjct  323  SRIRAWHHDLGGAISPNAAYMIIRGLKTIALRVEAQNRTALRMARLLEKHPKIERVYYPG  382

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S   H +A +QM G GGVVSF++  DL    +FVDAL++P IA S GGCES+V QPA+
Sbjct  383  LESSLWHGVATRQMAGAGGVVSFDVASDLRGVMRFVDALELPLIATSLGGCESLVQQPAV  442

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYW  ++ E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct  443  MSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI  486



>gb|AAK50404.1|AC021891_5 Putative O-succinylhomoserine (thiol)-lyase (cystathionine gamma 
synthase) [Oryza sativa Japonica Group]
Length=508

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KTL LRVQ QN TALRMA++LE HPK+ RVYYPG
Sbjct  345  SRIRTWHHDLGGAISPNAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKHPKIERVYYPG  404

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GGCES+V QPAI
Sbjct  405  LESSPWHGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGGCESLVQQPAI  464

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYW     E+A  GI DN VRFSFG+E FED++ D+LQAL  I
Sbjct  465  MSYWGKCDEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALGKI  508



>ref|XP_006661751.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Oryza 
brachyantha]
Length=485

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 125/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE HPK+ RVYYPG
Sbjct  323  SRIRAWHHDLGGAISPNAAYMIIRGLKTMALRVEAQNRTALRMARLLENHPKIERVYYPG  382

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A+KQM G GGV+S E+  DL    +FVDAL++P IA S GGCES+V QPA+
Sbjct  383  LESSPWHGVARKQMAGGGGVISLEVASDLRGAMRFVDALELPLIATSLGGCESLVQQPAV  442

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYW   + E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct  443  MSYWG-REEEKAKNGIKDNFVRFSFGIEKFEDLREDILQALEKI  485



>gb|KIZ06880.1| cystathionine gamma-synthase [Monoraphidium neglectum]
Length=1211

 Score =   226 bits (577),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -3

Query  703   VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGL  524
              VR  H++LGG ++P+AAYL++RGMKTL LRV++QN +AL +A  LEAHPK+ RV+YPGL
Sbjct  1049  TVRQAHNVLGGVIDPHAAYLLLRGMKTLDLRVERQNKSALELARRLEAHPKIARVHYPGL  1108

Query  523   PSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
             PSHP+H IA  QM+GFGGVVSFE+DGDL  TA F+DA+++P IAPS GG ES+++QP I+
Sbjct  1109  PSHPDHEIAVAQMSGFGGVVSFEVDGDLWRTAAFIDAVRLPRIAPSLGGVESLIEQPTII  1168

Query  343   SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             SYWD     RA  GI D+LVRFS GVE FED+ ADV QAL+ I
Sbjct  1169  SYWDQGPEARAKIGIKDSLVRFSVGVEAFEDIWADVEQALDQI  1211



>ref|XP_006662330.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Oryza 
brachyantha]
Length=478

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 125/164 (76%), Gaps = 1/164 (1%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE HPK+ RV+YPG
Sbjct  316  SRIRAWHHDLGGAISPNAAYMIIRGLKTMALRVEAQNRTALRMARLLENHPKIERVHYPG  375

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H + +KQM G GGV+SFE+  D+    +FVDAL++P IA S GGCES+V QPA+
Sbjct  376  LESSPWHGVGRKQMAGGGGVISFEVASDMDGATRFVDALELPLIATSLGGCESLVQQPAV  435

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MSYW  +  E+   GI DNLVRFSFG+E +ED++ D+LQALE I
Sbjct  436  MSYWGKSD-EKTKNGIKDNLVRFSFGIEKYEDLRDDILQALEKI  478



>gb|AFW87952.1| hypothetical protein ZEAMMB73_590146 [Zea mays]
Length=314

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H K+ RVYYPG
Sbjct  160  SKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEHLKIARVYYPG  219

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCESI+DQPAI
Sbjct  220  LPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCESIIDQPAI  279

Query  346  MSYWDL  329
            MSY  +
Sbjct  280  MSYCSV  285



>gb|EEC80304.1| hypothetical protein OsI_22339 [Oryza sativa Indica Group]
Length=380

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -3

Query  658  NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  479
            NAAY+IIRG+KT+ LRV+ QN TALR+A +LE HPKV RVYYP L S P H +A++QMTG
Sbjct  233  NAAYMIIRGLKTMALRVEAQNRTALRVARLLERHPKVERVYYPWLESSPWHGVARRQMTG  292

Query  478  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  299
             GGV+SFE+  D+    +FVDAL++P+IA S GGCES+V QPAIMSYW  + AE+A  GI
Sbjct  293  AGGVISFEVASDMRGAMRFVDALELPFIATSLGGCESLVQQPAIMSYWGKSDAEKAENGI  352

Query  298  MDNLVRFSFGVEDFEDVKADVLQALETI  215
             DNLVRFSFG+E FED+K D+LQALE I
Sbjct  353  KDNLVRFSFGIEKFEDLKDDILQALEKI  380



>ref|XP_001695742.1| cystathionine gamma-synthase [Chlamydomonas reinhardtii]
 gb|EDP01529.1| cystathionine gamma-synthase [Chlamydomonas reinhardtii]
Length=466

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR  HHI+GG ++P+AAYL++RG+KTL LRV + N++A+ +A  LE+HPKV RV+YPGL 
Sbjct  304  VREFHHIMGGVVDPHAAYLLLRGLKTLELRVTRHNASAMEIARRLESHPKVVRVWYPGLE  363

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP+H IAK+QM+GFGGVVSFE  G L     F+D +K+PYIAPS GG ES+++ PA+ S
Sbjct  364  SHPDHAIAKRQMSGFGGVVSFETRGGLNECISFIDNVKLPYIAPSLGGVESLIEMPAVQS  423

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YW      RA  GI +NL+RFS GVED ED+ AD++QALE +
Sbjct  424  YWGFGPERRAQIGIKENLIRFSIGVEDVEDIWADLVQALEYV  465



>ref|XP_007024260.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26882.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein, putative [Theobroma cacao]
Length=266

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  586  LRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALK  407
            ++  +VLEAHP V+R Y+PGLPSH EH IAK+QMTGFGGVVSFE+D DLMTT KFVDA K
Sbjct  92   IKDGKVLEAHPWVKRFYHPGLPSHSEHEIAKQQMTGFGGVVSFEVDRDLMTTIKFVDAFK  151

Query  406  IPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQA  227
            IP IAPS GGCESI DQP IMSYWDLTQAER  YGI DNLVRFSFGVEDF+D+KAD+LQA
Sbjct  152  IPNIAPSLGGCESIADQPTIMSYWDLTQAERRKYGIEDNLVRFSFGVEDFKDLKADILQA  211



>ref|XP_002953537.1| hypothetical protein VOLCADRAFT_75793 [Volvox carteri f. nagariensis]
 gb|EFJ45510.1| hypothetical protein VOLCADRAFT_75793 [Volvox carteri f. nagariensis]
Length=473

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR  HHI+GG ++P+AAYL++RG+KTL LRV++ N +A+ +A  LE HPK+ RV+YPGL 
Sbjct  311  VREFHHIMGGVVDPHAAYLLLRGLKTLDLRVERHNRSAMEIARRLEQHPKIDRVWYPGLE  370

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP+H IAK+QM+GFGGVVSFE+ G L     F+D +K+PYIAPS GG ES+++ PA+ S
Sbjct  371  SHPDHAIAKRQMSGFGGVVSFEVRGGLQECISFIDNVKLPYIAPSLGGVESLIEMPAVQS  430

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            YW      RA  GI +NLVRFS G+ED +D+ AD++QALE +
Sbjct  431  YWGFGPERRAQIGIKENLVRFSIGIEDVDDIWADLVQALEYV  472



>gb|EEE65425.1| hypothetical protein OsJ_20780 [Oryza sativa Japonica Group]
Length=380

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = -3

Query  658  NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  479
            NAAY+IIRG+KT+ LRV+ QN TALR+A +LE HPKV RV YP L S P H +A+KQMTG
Sbjct  233  NAAYMIIRGLKTMALRVEAQNRTALRVARLLERHPKVERVNYPWLESSPWHGVARKQMTG  292

Query  478  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  299
             GGV+SFE+  D+    +FVDAL++P+IA S GGCES+V QPAIMSYW  ++AE+   GI
Sbjct  293  AGGVISFEVASDMRGAMRFVDALELPFIATSLGGCESLVQQPAIMSYWGKSEAEKTENGI  352

Query  298  MDNLVRFSFGVEDFEDVKADVLQALETI  215
             DNLVRFSFG+E FED+K D+LQALE I
Sbjct  353  KDNLVRFSFGIEKFEDLKDDILQALEKI  380



>gb|EMT05299.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=499

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 128/197 (65%), Gaps = 33/197 (17%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH +GGT++P+AAY+IIRG+KT+ LRV  QN TALRMA +LE HP + RVYYPG
Sbjct  303  SRIRVWHHDIGGTISPDAAYMIIRGLKTMALRVDTQNRTALRMARLLENHPMIERVYYPG  362

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L + P HHIAK QMTG GG++SFE+  DL    +F+DAL+IP+IA S GGCES+V QPA+
Sbjct  363  LTTSPWHHIAKSQMTGSGGIISFEVASDLHGVMRFIDALEIPFIAMSLGGCESLVQQPAV  422

Query  346  MSYW---------------------------------DLTQAERAAYGIMDNLVRFSFGV  266
            MS+W                                   +  E+A  GI DNLVRFSFG+
Sbjct  423  MSFWYAFGFLSLQRTICNSNIVRRIGHSIAWFSVYIRGQSGEEKANNGIKDNLVRFSFGI  482

Query  265  EDFEDVKADVLQALETI  215
            E FED+K DVLQAL+ I
Sbjct  483  EKFEDLKDDVLQALKKI  499



>ref|XP_011397361.1| Cystathionine gamma-synthase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM24473.1| Cystathionine gamma-synthase, chloroplastic [Auxenochlorella 
protothecoides]
Length=390

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            + VR +H++LGG ++P+AAYL++RGMKTL LRV + N+TA  +A  LE HP+V RV+YPG
Sbjct  227  AAVRAMHNVLGGVMDPHAAYLLLRGMKTLDLRVARANATAATLAARLEEHPRVARVHYPG  286

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SHP+H IA  QM GFGG+VSFE+ GDL  TA+FVDA ++PYIAPS GG ES+++QP I
Sbjct  287  LTSHPDHAIAAAQMDGFGGMVSFEVAGDLWATARFVDACRLPYIAPSMGGVESLIEQPTI  346

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +SYWD    ERA  GI D+LVRFS GVE  ED+ AD+ QALE +
Sbjct  347  VSYWDQGPEERARLGIRDSLVRFSCGVEAAEDIWADLAQALEAV  390



>dbj|BAD37853.1| putative O-succinylhomoserine (thiol)-lyase [Oryza sativa Japonica 
Group]
Length=425

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -3

Query  652  AYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFG  473
            AY+IIRG+KT+ LRV+ QN TALR+A +LE HPKV RV YP L S P H +A+KQMTG G
Sbjct  280  AYMIIRGLKTMALRVEAQNRTALRVARLLERHPKVERVNYPWLESSPWHGVARKQMTGAG  339

Query  472  GVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMD  293
            GV+SFE+  D+    +FVDAL++P+IA S GGCES+V QPAIMSYW  ++AE+   GI D
Sbjct  340  GVISFEVASDMRGAMRFVDALELPFIATSLGGCESLVQQPAIMSYWGKSEAEKTENGIKD  399

Query  292  NLVRFSFGVEDFEDVKADVLQALETI  215
            NLVRFSFG+E FED+K D+LQALE I
Sbjct  400  NLVRFSFGIEKFEDLKDDILQALEKI  425



>gb|EAZ15990.1| hypothetical protein OsJ_31434 [Oryza sativa Japonica Group]
Length=449

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 115/158 (73%), Gaps = 3/158 (2%)
 Frame = -3

Query  688  HHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPE  509
            H ++ G    NAAY+IIRG+KTL LRVQ QN TALRMA++LE HPK+ RVYYPGL S P 
Sbjct  295  HDVIAGC---NAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKHPKIERVYYPGLESSPW  351

Query  508  HHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDL  329
            H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GGCES+V QPAIMSYW  
Sbjct  352  HGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGGCESLVQQPAIMSYWGK  411

Query  328  TQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
               E+A  GI DN VRFSFG+E FED++ D+LQAL  I
Sbjct  412  CDEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALGKI  449



>ref|WP_012828513.1| cystathionine gamma-synthase [Haliangium ochraceum]
 ref|YP_003267806.1| cystathionine gamma-synthase [Haliangium ochraceum DSM 14365]
 gb|ACY15913.1| Cystathionine gamma-synthase [Haliangium ochraceum DSM 14365]
Length=395

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R    +LGG L+ ++ YL+IRG+KTL LRV +QN TA+ +A  LEAHP V RVYYPGL 
Sbjct  234  LREFRGVLGGILDAHSGYLLIRGLKTLQLRVARQNQTAMAVARALEAHPHVERVYYPGLE  293

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP+H IAK+ M GFGGVVSF + GDL +T++F+DA  +P I PS GG ES+++QPA+MS
Sbjct  294  SHPDHEIAKRHMRGFGGVVSFLVKGDLDSTSRFIDACTLPVIGPSLGGVESLIEQPALMS  353

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  221
            +++L+  +R A GI DNLVR S GVE+ ED+ AD+ QAL+
Sbjct  354  FYELSTEQRLAIGIRDNLVRLSVGVEETEDLIADLTQALD  393



>gb|ETW97684.1| hypothetical protein ETSY2_44200, partial [Candidatus Entotheonella 
sp. TSY2]
Length=206

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R    ILGG  +PN+AYL++RG+K+  LR+ Q N+    +A  LE+HPKVRRVYYPGL 
Sbjct  44   LRESQSILGGITDPNSAYLLLRGLKSFALRMAQHNANGAALAAFLESHPKVRRVYYPGLK  103

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP H +A+ QM GFGG+VSFE+D  +     F+DAL++PY+APS GG ES+V+QPAI+S
Sbjct  104  SHPSHAVARAQMRGFGGLVSFELDATMAQAGAFIDALELPYMAPSLGGVESLVEQPAIVS  163

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            Y+++   ER   GI D+LVR++ G+ED +D+  DV QAL+ +
Sbjct  164  YYEMAPEERQKIGISDSLVRYAAGIEDTDDLLTDVEQALKVL  205



>ref|WP_006563164.1| cystathionine gamma-synthase [Oscillochloris trichoides]
 gb|EFO79475.1| cystathionine gamma-synthase [Oscillochloris trichoides DG-6]
Length=399

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R    I+G   +P +A+L++RG+KT  LR+++ N   L +A+ LE HP+V RV+YPGLP
Sbjct  235  LRQEQGIVGAISDPQSAFLLLRGLKTFGLRMERHNQNGLAVAQFLERHPRVTRVHYPGLP  294

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP+H +A  QM GFGGVVSFEI+GDL  TA+ +D +KIPYIAPS GG ES+++QPAI+S
Sbjct  295  SHPDHAVASAQMRGFGGVVSFEIEGDLEATARMLDLVKIPYIAPSLGGVESLIEQPAIIS  354

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  221
            Y+++T  +R A GI DNLVRF+ GVED +D+ AD+ QALE
Sbjct  355  YYEMTTEQRNAIGIYDNLVRFACGVEDAQDLIADLAQALE  394



>ref|WP_029671929.1| cystathionine gamma-synthase [Candidatus Hydrogenedens terephthalicus]
Length=389

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR LH  +GG ++P+  YL++RG+KT  LR+++QN+TA+ +A+ LE HP++++VYYPGL 
Sbjct  225  VRKLHKAMGGVIDPHCCYLLLRGLKTFSLRMERQNNTAMLIAKFLEGHPQIKKVYYPGLE  284

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP HHIAK QM GFGGVV+F+I G+L T  KF+D+L++ YIAPS GG E+++  PA++S
Sbjct  285  SHPHHHIAKAQMKGFGGVVTFDIKGNLNTAKKFMDSLQLCYIAPSLGGVETLITHPALVS  344

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  221
            Y+D T+ ER   GI D L R + G+E+ ED+ AD+ QAL+
Sbjct  345  YYDYTRKERYELGITDTLFRLAVGIEEPEDIIADIDQALK  384



>ref|WP_015940702.1| cystathionine gamma-synthase [Chloroflexus aggregans]
 gb|ACL24843.1| Cystathionine gamma-synthase [Chloroflexus aggregans DSM 9485]
Length=398

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R    ILGG  +P+AAYL+ RG+KT  LR+++ N     +AE L  HP+V RV+YPGLP
Sbjct  237  LRETQGILGGICDPHAAYLLGRGLKTFALRMERHNQNGQAVAEFLAHHPRVTRVHYPGLP  296

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
             HP+H IA+ QM GFGGVVSFE+ GDL +    VD L++PYIAPSFGG ES+V+QPA+MS
Sbjct  297  DHPDHTIARAQMRGFGGVVSFEVAGDLTSAMAVVDKLRLPYIAPSFGGVESLVEQPALMS  356

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            Y++L+  ER A GI DNL+R S G+ED +D+ AD+ QAL
Sbjct  357  YYELSSEERLAVGIRDNLIRLSCGIEDADDLIADLQQAL  395



>ref|WP_012257342.1| MULTISPECIES: cystathionine gamma-synthase [Chloroflexus]
 ref|YP_001635075.1| cystathionine gamma-synthase [Chloroflexus aurantiacus J-10-fl]
 gb|ABY34686.1| Cystathionine gamma-synthase [Chloroflexus aurantiacus J-10-fl]
 gb|ACM52999.1| Cystathionine gamma-synthase [Chloroflexus sp. Y-400-fl]
Length=398

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 0/161 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R    ILGG  +P+ AYL+ RG+KT  LR+++ N     +AE L  HP+V RV+YPG
Sbjct  235  SALRETQGILGGICDPHTAYLLGRGLKTFALRMERHNHNGQAVAEFLARHPRVSRVHYPG  294

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LP HP+H +A+ QM GFGGVVSFE+ GDL +    VD L++PYIAPSFGG ES+V+QPA+
Sbjct  295  LPEHPDHAVARAQMRGFGGVVSFEVVGDLQSAMAVVDRLRLPYIAPSFGGVESLVEQPAL  354

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            MSY++L+  ER A GI DNL+R S G+ED  D+ AD+ QAL
Sbjct  355  MSYYELSSEERLAVGIRDNLIRLSCGIEDVSDLIADLQQAL  395



>ref|WP_034419446.1| cystathionine gamma-synthase [Candidatus Entotheonella sp. TSY1]
 gb|ETW97960.1| cystathionine gamma-synthase [Candidatus Entotheonella sp. TSY1]
Length=396

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R    ILGG  +PN+AYL++RG+K+  LR+ + N+    +A  LEAHPKVRRVYYPGL 
Sbjct  234  LRESQGILGGITDPNSAYLLLRGLKSFALRMARHNANGAALASFLEAHPKVRRVYYPGLK  293

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP H +A+ QM GFGG+VSFE+D  +  T  F+DAL++PY+APS GG ES+V+QPAI+S
Sbjct  294  SHPSHAVARAQMRGFGGLVSFELDATMAQTGAFIDALELPYMAPSLGGVESLVEQPAIVS  353

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            Y+++   ER   GI D+LVR++ G+ED +D+  DV QAL+ +
Sbjct  354  YYEMAPEERHQIGISDSLVRYAAGIEDTDDLLTDVEQALKVL  395



>ref|WP_028458069.1| cystathionine gamma-synthase [Chloroflexus sp. Y-396-1]
Length=398

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 0/161 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R    ILGG  +P+ AYL+ RG+KT  LR+++ N     +AE L  HP+V RV+YPG
Sbjct  235  SALRETQGILGGICDPHTAYLLGRGLKTFALRMERHNQNGQAVAEFLSRHPRVSRVHYPG  294

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHP+H IA+ QM GFGGVVSFE+ GDL +    VD +++ YIAPSFGG ES+V+QPA+
Sbjct  295  LPSHPDHAIARAQMRGFGGVVSFEVVGDLQSAMAVVDRMRLAYIAPSFGGVESLVEQPAL  354

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            MSY++L+  ER A GI DNL+R S G+ED  D+ AD+ QAL
Sbjct  355  MSYYELSSEERLAVGIRDNLIRLSCGIEDASDLIADLQQAL  395



>ref|WP_031459521.1| cystathionine gamma-synthase [Chloroflexus sp. MS-G]
Length=398

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R    ILGG  +P+ AYL+ RG+KT  LR+++ N     +AE L  HP+V RV+YPG
Sbjct  235  SALRETQGILGGICDPHTAYLLGRGLKTFALRMERHNQNGQAVAEFLSRHPRVSRVHYPG  294

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHP+H IA+ QM GFGGVVSFE+ GDL T    VD +++ YIAPSFGG ES+V+QPA+
Sbjct  295  LPSHPDHAIARAQMRGFGGVVSFEVVGDLQTAMAVVDRMRLAYIAPSFGGVESLVEQPAL  354

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            MSY++L+  ER A GI DNL+R S G+ED  D+ AD+ QA 
Sbjct  355  MSYYELSSEERLAVGIRDNLIRLSCGIEDASDLIADLQQAF  395



>gb|EMT09615.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=517

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QN T+LRMA +LE HPK+ RVYYPG
Sbjct  297  SRIRAWHHDLGGAISPDAAYMIIRGLKTMALRVETQNQTSLRMARLLENHPKIERVYYPG  356

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H IAK QMTGFGGV+SFE+  DL    +FVDAL+IP+IA S GGCES+V QPA+
Sbjct  357  LLSSPWHDIAKSQMTGFGGVISFEVASDLHGVMRFVDALEIPFIATSLGGCESLVQQPAV  416

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVK  245
            MS+W  +  E+A  GI DNL      ++  E V+
Sbjct  417  MSFWGQSDEEKAKNGIKDNLAALVHQLDQLEVVE  450



>ref|WP_020740637.1| cystathionine beta-lyase [Sorangium cellulosum]
 ref|YP_008155135.1| cystathionine beta-lyase [Sorangium cellulosum So0157-2]
 gb|AGP32869.1| cystathionine beta-lyase [Sorangium cellulosum So0157-2]
Length=387

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S+VR++  +LGG ++P+AA LI RGMKTL LRV++QN+T L +A  LEAHP V RV+YPG
Sbjct  221  SLVRDMRSVLGGVIDPHAAALIGRGMKTLALRVERQNATGLAVARALEAHPAVERVFYPG  280

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHP+H IA  QM GFGGVVSF + G     A+ VD  +I  IAPSFGG E++++QP I
Sbjct  281  LPSHPDHEIAAAQMRGFGGVVSFIVRGGREAAARVVDGTRIAAIAPSFGGVETLIEQPCI  340

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            MS+ +L+  + AA GI   L+R S GVE+ EDV  DVL AL+ +
Sbjct  341  MSFHELSDEQLAAIGISPALIRLSVGVEETEDVVKDVLAALDAL  384



>ref|WP_012240206.1| cystathionine gamma-synthase [Sorangium cellulosum]
 ref|YP_001618247.1| cystathionine gamma-synthase [Sorangium cellulosum So ce56]
 emb|CAN97767.1| Cystathionine gamma-synthase [Sorangium cellulosum So ce56]
Length=398

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S++R+L  +LGG ++P+AA LI RGMKTL LR+++QN+T L +A  LEAHP V RV+YPG
Sbjct  232  SLIRDLRSVLGGIMDPHAAALIGRGMKTLALRIERQNATGLAVARALEAHPAVERVFYPG  291

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            LPSHP+H +A +QM GFGGVVSF + G     ++ VD  ++  IAPSFGG E++++QP I
Sbjct  292  LPSHPDHKVAAEQMRGFGGVVSFTVRGGREAASRVVDGTRVAAIAPSFGGVETLIEQPCI  351

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI*G  209
            MS+ +L+  + AA GI   L+R S G+E+ EDV  DVL AL+ + G
Sbjct  352  MSFHELSDEQLAAIGISPALIRLSVGIEETEDVVRDVLGALDALGG  397



>ref|WP_041903797.1| cystathionine gamma-synthase [Latescibacteria bacterium SCGC 
AAA252-B13]
Length=391

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 119/160 (74%), Gaps = 0/160 (0%)
 Frame = -3

Query  694  NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSH  515
            +   I+GG ++P+ AYL+IRG+KT  +R+++ N +   +A  LE+HPK+RR YYP L SH
Sbjct  232  DFQKIMGGVIDPHCAYLLIRGLKTFCVRMEKLNRSGEEVARWLESHPKIRRCYYPSLDSH  291

Query  514  PEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYW  335
            P   +AK++M+GFG VV+FE+DGDL+ + +F+D LK+ YI PS GGCE+++  PA ++Y+
Sbjct  292  PHQDVAKREMSGFGAVVTFELDGDLVDSNRFLDNLKLCYIGPSLGGCETLITHPATVTYY  351

Query  334  DLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            + T+AER   GI+DNL R S G+ED ED+ AD+ QA++ I
Sbjct  352  NCTRAERYELGILDNLFRLSVGLEDPEDIIADLDQAMKAI  391



>ref|WP_012174821.1| cystathionine gamma-synthase [Desulfococcus oleovorans]
 gb|ABW67205.1| Cystathionine gamma-synthase [Desulfococcus oleovorans Hxd3]
Length=392

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR    I GG ++PN+AYL+IRG+KT  LR+++ N     +AE LE HPK+ RVYYPGLP
Sbjct  233  VREFLKITGGVIDPNSAYLLIRGLKTFGLRMERLNENGQIVAEGLERHPKISRVYYPGLP  292

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP H +AK QM GFG VV+FE++GD      F+  LKI  I PS GG ES++  PA +S
Sbjct  293  SHPHHDVAKAQMKGFGAVVTFEVEGDCEYVLNFLSRLKIINIGPSLGGVESLITHPATIS  352

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            Y+D T+ ER A GI D L+R + GVE+ ED+ AD+ QAL
Sbjct  353  YYDKTRKERLALGIKDGLIRLAVGVENAEDIIADIEQAL  391



>ref|WP_002653306.1| cystathionine gamma-synthase [Blastopirellula marina]
 gb|EAQ77909.1| cystathionine gamma-synthase [Blastopirellula marina DSM 3645]
Length=402

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 117/163 (72%), Gaps = 1/163 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR L  I+GG  +P+  YL++RG+KT  LR+++ N     +AE LE+HPKV +VYYPGLP
Sbjct  240  VRKLRGIMGGINSPHNIYLLLRGLKTFSLRMERHNQNGQAIAEFLESHPKVEKVYYPGLP  299

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SH    IAK+ M GFGG+++F + D D   TA  +DA+KIP IAPS GG ES+++QP +M
Sbjct  300  SHKYFDIAKQTMRGFGGLITFLVKDADWRKTADVIDAVKIPRIAPSLGGVESLIEQPLVM  359

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            SY+ L   ERA +GI DN++R + G+ED ED+ AD+ QAL++I
Sbjct  360  SYYQLAPEERAKFGIYDNMIRMACGIEDAEDLIADLKQALDSI  402



>ref|WP_007334081.1| cystathionine gamma-synthase [Rhodopirellula baltica]
 gb|EKK00234.1| methionine gamma-lyase [Rhodopirellula baltica SH28]
Length=417

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 114/163 (70%), Gaps = 1/163 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  HPK+ RVYYPGLP
Sbjct  255  IRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQHPKIDRVYYPGLP  314

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS GG ES+++QP +M
Sbjct  315  SHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLGGTESLIEQPLVM  374

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            SY+  +  ERA +GI DN++RFS G+ED  D+ AD+ QAL  I
Sbjct  375  SYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDQALAAI  417



>ref|WP_007324756.1| cystathionine gamma-synthase [Rhodopirellula baltica]
 gb|EGF29210.1| methionine gamma-lyase [Rhodopirellula baltica WH47]
Length=417

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 114/163 (70%), Gaps = 1/163 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  HPK+ RVYYPGLP
Sbjct  255  IRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQHPKIDRVYYPGLP  314

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS GG ES+++QP +M
Sbjct  315  SHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLGGTESLIEQPLVM  374

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            SY+  +  ERA +GI DN++RFS G+ED  D+ AD+ QAL  I
Sbjct  375  SYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDQALAAI  417



>ref|WP_011120920.1| cystathionine gamma-synthase [Rhodopirellula baltica]
 ref|NP_867259.1| cystathionine gamma-synthase [Rhodopirellula baltica SH 1]
 emb|CAD74805.1| cystathionine gamma-synthase [Rhodopirellula baltica SH 1]
Length=434

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 114/163 (70%), Gaps = 1/163 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  HPK+ RVYYPGLP
Sbjct  272  IRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQHPKIDRVYYPGLP  331

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS GG ES+++QP +M
Sbjct  332  SHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLGGTESLIEQPLVM  391

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            SY+  +  ERA +GI DN++RFS G+ED  D+ AD+ QAL  I
Sbjct  392  SYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDQALAAI  434



>ref|WP_008655459.1| methionine gamma-lyase [Rhodopirellula europaea]
 gb|EMB17591.1| methionine gamma-lyase [Rhodopirellula europaea 6C]
 gb|EMI28500.1| methionine gamma-lyase [Rhodopirellula europaea SH398]
Length=417

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 1/163 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  HPK+ RVYYPGLP
Sbjct  255  IRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQHPKIERVYYPGLP  314

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IAK+QM GFGG+++F + D D  TT++ VD  KI  IAPS GG ES+++QP +M
Sbjct  315  SHPTHAIAKEQMLGFGGLITFTVKDADWKTTSRVVDGAKIARIAPSLGGTESLIEQPLVM  374

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            SY+  +  ERA +GI DN++R+S G+ED  D+ AD+ QAL  I
Sbjct  375  SYFHYSPEERACFGIADNMIRYSCGIEDSADLIADLDQALAAI  417



>ref|WP_007339059.1| methionine gamma-lyase [Rhodopirellula baltica]
 gb|ELP31787.1| methionine gamma-lyase [Rhodopirellula baltica SWK14]
Length=417

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 1/163 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  HPK+ RVYYPGLP
Sbjct  255  IRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQHPKIDRVYYPGLP  314

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS GG ES+++QP +M
Sbjct  315  SHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLGGTESLIEQPLVM  374

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            SY+  +  ERA +GI DN++RFS G+ED  D+ AD+  AL  I
Sbjct  375  SYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDSALAAI  417



>ref|WP_037466783.1| cystathionine gamma-synthase [Smithella sp. F21]
 gb|KFN37872.1| cystathionine gamma-synthase [Smithella sp. F21]
Length=395

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 112/157 (71%), Gaps = 0/157 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S VR LH  +GG ++P+  YL++RG+KT  LRV+ QN +AL++AE LE HPK+ R YYP 
Sbjct  232  SKVRELHKSMGGVIDPHCCYLLLRGLKTFPLRVKAQNESALKIAEYLERHPKIERAYYPF  291

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L SH  + IAK+QM G GGVV+F I GDL    +F+DAL++ YIAPS GG E+++  PA 
Sbjct  292  LKSHDHYSIAKEQMKGGGGVVTFTIKGDLDAAKRFMDALEMIYIAPSLGGVETLITHPAT  351

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV  236
            ++Y+  ++ +R   GI+DNL R + G+ED ED+ AD+
Sbjct  352  VTYYRYSREQRYDLGIVDNLFRLAVGIEDVEDIIADL  388



>ref|WP_014432877.1| cystathionine gamma-synthase [Caldilinea aerophila]
 dbj|BAL99638.1| cystathionine gamma-lyase [Caldilinea aerophila DSM 14535 = NBRC 
104270]
Length=407

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 113/162 (70%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R +  +LG    P  AYLI+RG+KTL LR+++QN++ L +A  LE HPKVRRV+YP L 
Sbjct  246  LRQMQGLLGNIAAPQTAYLILRGIKTLALRMERQNASGLAVARFLEGHPKVRRVWYPFLE  305

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP++ +A+  + G GGVVSFEI+GD     +F+DAL+IP I PS GG ESIV   A+M 
Sbjct  306  SHPDYAVARATLRGGGGVVSFEIEGDAGRAHRFIDALRIPVIGPSLGGVESIVSPLALMG  365

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            Y +L+  ER A GI D LVR   G+ED E++ AD+ QAL+ I
Sbjct  366  YANLSPEERLALGIRDELVRLCIGIEDTENLIADLAQALDQI  407



>gb|ABB47533.1| Cys/Met metabolism PLP-dependent enzyme family protein [Oryza 
sativa Japonica Group]
Length=433

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -3

Query  706  SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG  527
            S +R  HH LGG ++PNAAY+IIRG+KTL LRVQ QN TALRMA++LE HPK+ RVYYPG
Sbjct  310  SRIRTWHHDLGGAISPNAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKHPKIERVYYPG  369

Query  526  LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI  347
            L S P H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GGCES+V QPAI
Sbjct  370  LESSPWHGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGGCESLVQQPAI  429

Query  346  MSYW  335
            MSYW
Sbjct  430  MSYW  433



>ref|WP_008695126.1| methionine gamma-lyase [Rhodopirellula maiorica]
 gb|EMI20813.1| methionine gamma-lyase [Rhodopirellula maiorica SM1]
Length=393

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 112/161 (70%), Gaps = 1/161 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR+L  +LGG  +P+  YL+ RG+KT  LR+Q+ N   L +AE LE HP+V RVYYPGL 
Sbjct  232  VRSLRGVLGGVNSPHNLYLLERGLKTFALRMQRHNENGLAIAEFLENHPRVDRVYYPGLK  291

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H  A  QM G+GG+++F + D D   T++ VDA KIP IA S GG ES+++QP +M
Sbjct  292  SHPSHDSAAAQMRGYGGLITFTVKDADWEETSRIVDAAKIPRIAASLGGVESLIEQPLVM  351

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  221
            SY+  T  +R  +GI DN++R S G+ED +D+ AD+ QAL+
Sbjct  352  SYYHCTPEDRVRFGIADNMIRMSCGIEDTDDLIADLKQALQ  392



>ref|WP_036745737.1| hypothetical protein [Paenibacillus sp. UNC451MF]
Length=393

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R+   I+GGT+ P  AY + RG+KTL LR+++ N+TALR+A+ L+AHPKVR+VYYPGLP
Sbjct  231  MRDSLEIMGGTIQPMMAYWVTRGLKTLGLRMERHNATALRVAQFLDAHPKVRKVYYPGLP  290

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI--  347
            SHP++ IA  QM G+GGVV+FE+D  L    + VDA++IP +A S GG ES++   A+  
Sbjct  291  SHPDYAIALSQMRGYGGVVTFEVD-HLEQARQVVDAMRIPRLASSLGGVESLISVTAMSA  349

Query  346  MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            M+Y+ +TQ ER    I D ++RFS G+ED +D+ AD+ QAL+ +
Sbjct  350  MAYFFMTQEERMERAIPDGMIRFSIGIEDPDDIIADLAQALDKL  393



>gb|EMS50136.1| Cystathionine gamma-synthase, chloroplastic [Triticum urartu]
Length=126

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = -3

Query  580  MAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIP  401
            MA +LE HPK+ RVYYP L S P H IAK QMT  GGV+SFEI  DL    +FVDAL+IP
Sbjct  1    MARLLENHPKIERVYYPWLLSSPWHDIAKSQMTSCGGVISFEIASDLHGVMRFVDALEIP  60

Query  400  YIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  221
            +IA S GGCES+V QPA+MS+W  +  E+A   I DNLVRFSFG+E FED+K D+LQALE
Sbjct  61   FIATSLGGCESLVQQPAVMSFWGQSDEEKAKNRIKDNLVRFSFGIEKFEDLKDDILQALE  120

Query  220  TI  215
             I
Sbjct  121  KI  122



>ref|WP_012912576.1| cystathionine gamma-synthase [Pirellula staleyi]
 gb|ADB18315.1| Cystathionine gamma-synthase [Pirellula staleyi DSM 6068]
Length=401

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 113/161 (70%), Gaps = 1/161 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR L  I+G   +P+  YL+ RG+KT  LR+Q+ N   L +A+ L AHP+V +VYYPGL 
Sbjct  236  VRKLRGIMGAINSPHNLYLLERGLKTFELRMQRHNENGLAVAKFLAAHPRVSKVYYPGLE  295

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            +HP + IA+KQM GFGG+++FEI D D   TA  VDA  I  IAPS GG ES+++QP +M
Sbjct  296  THPYYEIARKQMRGFGGLITFEIKDADWKETAAIVDASTIARIAPSLGGAESLIEQPLVM  355

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  221
            SY+++   +R  +GI DN++R + G+E+ ED+ AD+ QALE
Sbjct  356  SYFEVPPEDRKRFGIYDNMIRLACGIENSEDLIADLAQALE  396



>ref|WP_044251002.1| cystathionine gamma-synthase [Rhodopirellula sp. SWK7]
Length=417

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR L   LG   +P++ YL+ RG+KT  LR+ + N   L +A+ LE+HP+V RV+YPGL 
Sbjct  253  VRALRGCLGSVSSPHSLYLLERGLKTFALRMARHNENGLAVAQFLESHPRVDRVFYPGLE  312

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IA++QM GFGG+++F + D D   T++ VDA K+  IAPS GG ES+++QP +M
Sbjct  313  SHPTHAIAREQMKGFGGLITFTVKDADWRATSRVVDAAKLARIAPSLGGVESLIEQPLVM  372

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            SY+  +  +R ++GI DN++RFS G+ED  D+ AD+ QAL
Sbjct  373  SYFGYSPEQRESFGIADNMIRFSCGIEDSADLIADLDQAL  412



>gb|EMI46706.1| methionine gamma-lyase [Rhodopirellula sp. SWK7]
Length=431

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            VR L   LG   +P++ YL+ RG+KT  LR+ + N   L +A+ LE+HP+V RV+YPGL 
Sbjct  267  VRALRGCLGSVSSPHSLYLLERGLKTFALRMARHNENGLAVAQFLESHPRVDRVFYPGLE  326

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IA++QM GFGG+++F + D D   T++ VDA K+  IAPS GG ES+++QP +M
Sbjct  327  SHPTHAIAREQMKGFGGLITFTVKDADWRATSRVVDAAKLARIAPSLGGVESLIEQPLVM  386

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            SY+  +  +R ++GI DN++RFS G+ED  D+ AD+ QAL
Sbjct  387  SYFGYSPEQRESFGIADNMIRFSCGIEDSADLIADLDQAL  426



>ref|XP_005702997.1| cystathionine gamma-synthase [Galdieria sulphuraria]
 gb|EME26477.1| cystathionine gamma-synthase [Galdieria sulphuraria]
Length=554

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 114/169 (67%), Gaps = 7/169 (4%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R+LH ILGG ++P+++YL++RGMKTL LR++  N  A  +A+ L  HPK+ +V+YP L 
Sbjct  386  IRSLHGILGGVVDPHSSYLLLRGMKTLPLRMRAHNENAAALAQELSQHPKIAKVHYPSLS  445

Query  520  SHPEHHIAKKQM-TGFGGVVSFEIDGD------LMTTAKFVDALKIPYIAPSFGGCESIV  362
            +HP++ +AK     GFGGV+SFEI GD           +FVDAL IP+I PS GG ES+V
Sbjct  446  NHPDYSVAKAHFKNGFGGVLSFEICGDPFGMDTFAAGIRFVDALSIPHIGPSLGGVESLV  505

Query  361  DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +Q  IM Y+D  Q  R   GI + L+RFS GVED  D+  DVLQALE +
Sbjct  506  EQVCIMGYFDQPQKVRRELGITNGLIRFSCGVEDKTDLLNDVLQALEAV  554



>ref|WP_044302136.1| cystathionine gamma-synthase [Rhodopirellula sallentina]
Length=393

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 111/160 (69%), Gaps = 1/160 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R L   LG   +P+  YL+ RG+KT  LR+ + N   L +A+ LE HP++ RV+YPGL 
Sbjct  229  IRALRGCLGSVSSPHNLYLLERGLKTFALRMARHNDNGLAVAQFLENHPRIERVFYPGLA  288

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IA +QM GFGG+++F + D D   +++ VDA ++  IAPS GG ES+++QP +M
Sbjct  289  SHPTHAIASQQMRGFGGLITFTVKDADWKASSRVVDAARLARIAPSLGGVESLIEQPLVM  348

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            SY+  +  ERA++GI DN++RFS G+ED  D+ AD+ QAL
Sbjct  349  SYFSYSPEERASFGIADNMIRFSCGIEDPADLIADLDQAL  388



>gb|KJB75686.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=468

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP+V+RVYYPGLP
Sbjct  377  IRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPRVKRVYYPGLP  436

Query  520  SHPEHHIAKKQMTGFGGVVSFEI  452
            SHPEH IAK+QMTGFGGVVSFE+
Sbjct  437  SHPEHEIAKRQMTGFGGVVSFEV  459



>gb|EMI56348.1| cystathionine gamma synthase [Rhodopirellula sallentina SM41]
Length=442

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 111/160 (69%), Gaps = 1/160 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R L   LG   +P+  YL+ RG+KT  LR+ + N   L +A+ LE HP++ RV+YPGL 
Sbjct  278  IRALRGCLGSVSSPHNLYLLERGLKTFALRMARHNDNGLAVAQFLENHPRIERVFYPGLA  337

Query  520  SHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            SHP H IA +QM GFGG+++F + D D   +++ VDA ++  IAPS GG ES+++QP +M
Sbjct  338  SHPTHAIASQQMRGFGGLITFTVKDADWKASSRVVDAARLARIAPSLGGVESLIEQPLVM  397

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            SY+  +  ERA++GI DN++RFS G+ED  D+ AD+ QAL
Sbjct  398  SYFSYSPEERASFGIADNMIRFSCGIEDPADLIADLDQAL  437



>gb|KHD07814.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Candidatus 
Thiomargarita nelsonii]
 gb|KHD11747.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Candidatus 
Thiomargarita nelsonii]
Length=384

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 110/160 (69%), Gaps = 1/160 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +RN  ++ G  ++PN A+ + RGMKTL LR+   N   L++A  LEAH KVR+VYY  LP
Sbjct  222  IRNYRNVTGAIVDPNTAFFLNRGMKTLPLRMNHLNEVGLKLARYLEAHDKVRQVYYTALP  281

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SHP H +AKK +T  GGVVSFE++     T +FVDAL+IP++  +FG  +S+++Q AI +
Sbjct  282  SHPHHALAKKYLTDHGGVVSFELEAGEKETTQFVDALQIPFMGTNFGLADSMIEQCAIFT  341

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVE-DFEDVKADVLQAL  224
            Y+ LT  ERA  GI D+LVR+S G E D ED+  D+ QAL
Sbjct  342  YYQLTPQERAEIGITDSLVRYSIGYEDDVEDIIQDLEQAL  381



>dbj|BAL55052.1| cystathionine gamma-lyase [uncultured Acidobacteria bacterium]
Length=392

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 112/156 (72%), Gaps = 0/156 (0%)
 Frame = -3

Query  682  ILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHH  503
            + G TL+P  A+L+IRGMKT  LR+++QN+ A R+AE L+AHPKV RV+YPGLPSHP+H 
Sbjct  236  LFGPTLSPFDAWLLIRGMKTFGLRLERQNANAQRIAEFLDAHPKVARVFYPGLPSHPQHD  295

Query  502  IAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQ  323
            +A++QM GFGG+V+FE+ G      + V++L++  +A S GG  S++  PA MS+  + +
Sbjct  296  LARRQMRGFGGMVAFELKGGREAGRQLVESLRVITLAVSLGGVTSLIQHPASMSHGPIPE  355

Query  322  AERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             ER A GI + L+R S G+ED ED+ AD+ QAL  +
Sbjct  356  EERQATGITEGLIRLSVGIEDAEDLIADLEQALRRL  391



>gb|KIG18323.1| Cystathionine gamma-synthase [Enhygromyxa salina]
Length=395

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 114/162 (70%), Gaps = 0/162 (0%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R     LG   +P+ A+L+ RG+KTL LR+++ N +AL +A +LE HPKV +V+YP L 
Sbjct  234  IREQVGTLGAVCDPHNAFLLGRGLKTLALRIERHNRSALAIATMLEEHPKVAQVWYPLLA  293

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SH +H  A++ ++G GGVVSFE+ G L    K VDA++IP +APS GG ES+++QPA+MS
Sbjct  294  SHQDHATARRYLSGGGGVVSFEVHGGLEAGTKLVDAVRIPKLAPSLGGVESLIEQPALMS  353

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            ++D     RA  GI + L+R S G+ED ED++AD+L AL+ +
Sbjct  354  FYDQGPEGRAQLGIREGLIRLSVGIEDLEDLRADLLAALDQM  395



>ref|WP_009709642.1| cystathionine gamma-synthase [Desmospora sp. 8437]
 gb|EGK12254.1| methionine gamma-lyase [Desmospora sp. 8437]
Length=408

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = -3

Query  703  VVRNLHH---ILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYY  533
            +VR ++H   I GGTL+P AAYL++RGMKTLHLRV+QQN +AL +A  LE+ P+V RVYY
Sbjct  233  LVRKVYHYREINGGTLHPMAAYLLLRGMKTLHLRVRQQNESALTIARWLESQPQVDRVYY  292

Query  532  PGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQP  353
            PGL SHP +  A+KQM GFGGV+SF ++G       F+  L++ ++A + G  E++   P
Sbjct  293  PGLESHPHYETARKQMRGFGGVLSFSLEGGFDAVRSFLPHLRLAHLAANLGSVETVAGPP  352

Query  352  AIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
               S+ + T+ ER A GI + L+R+S G+E+ ED+ AD+ QAL+ +
Sbjct  353  RTTSHVECTEEERRAMGIPEGLIRYSVGIEETEDLLADLKQALDRL  398



>ref|WP_034152361.1| cystathionine beta-lyase [Pseudomonas fluorescens]
 gb|KII36496.1| cystathionine beta-lyase [Pseudomonas fluorescens]
Length=390

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V+RVYYPGLPSHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLEQQPQVKRVYYPGLPSHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMRGFGGMISVDLNSDLAGARRFLENVKIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  352  IPADTRAKLGIGDGLVRLSVGVEDVEDLRADLAQALQSI  390



>ref|WP_016987095.1| cystathionine beta-lyase [Pseudomonas fluorescens]
Length=390

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V+RVYYPGLPSHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLEQQPQVKRVYYPGLPSHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMRGFGGMISVDLNSDLAGARRFLENVKIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  352  IPADTRAKLGIGDGLVRLSVGVEDVEDLRADLAQALQSI  390



>ref|WP_013905610.1| cystathionine beta-lyase [Pyrococcus yayanosii]
 ref|YP_004623825.1| cystathionine gamma-lyase [Pyrococcus yayanosii CH1]
 gb|AEH24553.1| cystathionine gamma-lyase [Pyrococcus yayanosii CH1]
Length=387

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -3

Query  679  LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI  500
            +G  L+P  ++L++RG+KTL +R+++    A+R+AE LE HP V +VYYPGLPSHP+H +
Sbjct  229  VGAILSPFDSWLVMRGIKTLAVRMERHEKNAMRIAEYLEEHPLVEKVYYPGLPSHPQHEL  288

Query  499  AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA  320
            AK+QM GFGG++SFE+ G L    KFV++L+I  +A S GG ES+++ PA+M++  L + 
Sbjct  289  AKRQMRGFGGMLSFELKGGLKEAVKFVESLEIFALAESLGGVESLIELPALMTHASLPKE  348

Query  319  ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            ER   GI D+L+R S G+ED ED+  D+ +  E +
Sbjct  349  EREKVGIKDSLIRVSVGIEDVEDLIEDLERGFEAV  383



>ref|WP_043248620.1| cystathionine beta-lyase [Pseudomonas knackmussii]
 emb|CDF81797.1| Cystathionine beta-lyase [Pseudomonas knackmussii B13]
Length=390

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+ +  S AL +A+ LE  P+V+RV+YPGLPSHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMDRHCSNALELAQWLERQPQVKRVHYPGLPSHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGGV+S ++  DL    +F++ ++I  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMNGFGGVISIDLATDLAGAKRFLENVQIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +  A RA  GI D LVR S GVED ED++AD+ QAL TI
Sbjct  352  IPPATRAELGIGDGLVRLSVGVEDVEDLRADLAQALATI  390



>ref|WP_018150728.1| methionine gamma-lyase [Leeia oryzae]
Length=389

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = -3

Query  688  HHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPE  509
            H  LG  L+P  ++L++RG++T  +R+ + N   L +A+ LEAHPKV+RV YPGL SHP+
Sbjct  232  HITLGSVLSPMDSWLLLRGLRTFPMRMNRVNQNGLSLAQTLEAHPKVQRVLYPGLASHPQ  291

Query  508  HHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDL  329
            H +AK+QM GFGG+VSF IDGD  T ++FV  LK+P  APS GG +S+V   A M    L
Sbjct  292  HELAKRQMKGFGGIVSFMIDGDYDTASRFVSLLKLPVNAPSLGGVDSLVIHAAAMWAGTL  351

Query  328  TQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            T  +    GI  NLVR++ G+E  +D+ AD+LQAL+ +
Sbjct  352  TPEQMKTAGIPVNLVRYAIGIEHSDDINADILQALDQL  389



>ref|WP_012501926.1| cystathionine beta-lyase [Chlorobaculum parvum]
 gb|ACF11093.1| Cystathionine gamma-synthase [Chlorobaculum parvum NCIB 8327]
Length=380

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 109/163 (67%), Gaps = 0/163 (0%)
 Frame = -3

Query  703  VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGL  524
             +RN     G    P   +L++RG+KTL +R+++   +AL +A  LEAHP V RV YPGL
Sbjct  218  TIRNYQGAAGAVPGPWDCWLVLRGLKTLKIRMEEHQKSALHLARALEAHPAVSRVIYPGL  277

Query  523  PSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIM  344
            PSHP+H +AK QM+GFGG+V+  + G L  T+K +++LK+  IA S GG ES+V  PA M
Sbjct  278  PSHPQHELAKSQMSGFGGMVTIALKGGLPATSKLLNSLKLFVIADSLGGVESLVASPARM  337

Query  343  SYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            ++  L+Q ER      D+LVR S G+E+ ED++ D+LQAL TI
Sbjct  338  TFGPLSQEERDRRACTDDLVRLSVGLENAEDLEQDLLQALATI  380



>ref|WP_004068005.1| cystathionine beta-lyase [Thermococcus litoralis]
 ref|YP_008429540.1| cystathionine beta-lyase [Thermococcus litoralis DSM 5473]
 gb|EHR78732.1| cystathionine beta-lyase [Thermococcus litoralis DSM 5473]
Length=385

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = -3

Query  679  LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI  500
            +G  L+P  ++L++RG+KTL LR+++    A+ +A+ LE HP V+RVYYPGLPSHP+H +
Sbjct  229  VGAVLSPFDSWLVMRGIKTLSLRMERHEKNAMAIAKYLEGHPLVKRVYYPGLPSHPQHEL  288

Query  499  AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA  320
            AK+QM+GFGG++SFE+ G L    KFV++L+I  +A S GG ES+++ PAIM++  + + 
Sbjct  289  AKRQMSGFGGMLSFELKGGLEKAIKFVESLEIFALAESLGGVESLIELPAIMTHASVPKE  348

Query  319  ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            ER   GI D+L+R S G+ED ED+  D+ +  + +
Sbjct  349  ERERVGIRDSLIRVSVGIEDVEDLIEDLERGFQAV  383



>ref|WP_042681523.1| cystathionine gamma-synthase [Thermococcus sp. ES1]
 gb|AHF80774.1| cystathionine gamma-lyase [Thermococcus sp. ES1]
Length=386

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -3

Query  679  LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI  500
            +G  L+P  ++L++RG+KTL +R+++    A+R+A+ LE HP V RVYYPGLPSHP+H +
Sbjct  230  VGAILSPFDSWLVMRGIKTLAVRMERHEKNAIRIAKYLEEHPLVERVYYPGLPSHPQHEL  289

Query  499  AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA  320
            A++QM GFGG++SFE+ G L    KFV++L+I  +A S GG ES+++ PA+M++  L + 
Sbjct  290  ARRQMRGFGGMLSFELKGGLKEAIKFVESLEIFALAESLGGVESLIELPALMTHASLPKE  349

Query  319  ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            ER   GI D+L+R S G+ED ED+  D+ +  E +
Sbjct  350  EREKVGIKDSLIRVSVGIEDVEDLIEDLERGFEAV  384



>ref|WP_009034610.1| cystathionine gamma-synthase [Indibacter alkaliphilus]
 gb|EOZ97091.1| Cystathionine gamma-synthase [Indibacter alkaliphilus LW1]
Length=396

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 109/156 (70%), Gaps = 0/156 (0%)
 Frame = -3

Query  682  ILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHH  503
            I G TL+ N+AY+++RG+KTL LRV +QN  A+++ E LE HPK+  V+YPGL SHP H 
Sbjct  241  INGATLHANSAYMLLRGIKTLELRVLRQNENAMKLGEYLEGHPKIDSVFYPGLKSHPSHE  300

Query  502  IAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQ  323
            IAKKQMTGFGGV+SF + GD      F+++L++ ++A S G   +++  P + S+ + T+
Sbjct  301  IAKKQMTGFGGVLSFSLVGDFENVKLFLNSLELAHLAASLGSVGTLIGPPKVTSHVEATE  360

Query  322  AERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
             ER A GI ++L+R + G+E+ ED+ AD  QAL  I
Sbjct  361  EERKALGIPESLIRCAVGIENIEDIIADFDQALSKI  396



>ref|WP_027178852.1| cystathionine gamma-synthase [Desulfovibrio bastinii]
Length=392

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = -3

Query  688  HHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPE  509
              I+GGT++P AAYL+IRGMKTL LRV++QN  A+ +A+ LE HP V RV+YPGL +HP 
Sbjct  236  REIVGGTMHPMAAYLMIRGMKTLKLRVEKQNENAMEIAKFLENHPGVERVFYPGLENHPG  295

Query  508  HHIAKKQMTGFGGVVSFEIDGDLMTTA-KFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            H +A KQM+GFGG++SF + G+    A + +  LKI   A + G  E+I   PA  S+ +
Sbjct  296  HDVAVKQMSGFGGMLSFMVKGNTYEDACRCLTRLKIVRRAANLGSVETIAGPPATTSHVE  355

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
             T  ERAA GI ++L+R+S G+ED ED+KAD+ QAL
Sbjct  356  CTAEERAAMGIPESLIRYSVGIEDVEDLKADLDQAL  391



>ref|WP_027621174.1| cystathionine beta-lyase [Pseudomonas sp. URHB0015]
Length=392

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S +++ DL    +F++A++I  +A S GG ES+++QPAIM++  
Sbjct  294  QHALAQRQMRGFGGMISLDLNSDLAGARRFLEAVQIFALAESLGGVESLIEQPAIMTHAS  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +  A RA  GI D LVR S GVE  ED++AD+ QAL  I
Sbjct  354  IPAATRAQIGIGDALVRLSVGVEGIEDLRADLAQALAQI  392



>ref|WP_007999877.1| cystathionine beta-lyase [Pseudomonas sp. GM49]
 gb|EJM61025.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM49]
Length=392

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVSRVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S +++ DL  T +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAQRQMRGFGGMISLDLNSDLAGTKRFLESVQIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPADTRAQLGIGDGLVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_038368044.1| cystathionine beta-lyase [Pseudomonas chlororaphis]
 gb|KHA70669.1| cystathionine beta-lyase [Pseudomonas chlororaphis]
Length=390

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V+RVYYPGL SHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLEQQPQVKRVYYPGLASHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMRGFGGMISVDLNSDLAGARRFLENVKIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  352  IPAETRAKLGIGDGLVRLSVGVEDVEDLRADLAQALKSI  390



>ref|WP_007931537.1| cystathionine beta-lyase [Pseudomonas sp. GM17]
 gb|EJL97510.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM17]
Length=392

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S ++D DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHALARRQMHGFGGMISLDLDCDLAGARRFLESVRIFALAESLGGVESLIEHPAIMTHAS  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPADTRAQLGIGDGLVRLSVGVEDVEDLRADLAQALTRI  392



>ref|WP_018926010.1| MULTISPECIES: cystathionine beta-lyase [Pseudomonas]
Length=398

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S E++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISVELNSDLTGARRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPAETRAQLGISDALVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_009042798.1| cystathionine beta-lyase [Pseudomonas chlororaphis]
 gb|EJL09088.1| Cystathionine beta-lyase [Pseudomonas chlororaphis subsp. aureofaciens 
30-84]
Length=392

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S ++D DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHALARRQMHGFGGMISLDLDCDLAGARRFLESVRIFALAESLGGVESLIEHPAIMTHAS  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPADTRAQLGIGDGLVRLSVGVEDVEDLRADLAQALTRI  392



>ref|WP_028940547.1| cystathionine beta-lyase [Pseudomonas umsongensis]
Length=398

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S E++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISVELNSDLTGARRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPAETRAQLGISDALVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_019649893.1| cystathionine beta-lyase [Pseudomonas sp. 45MFCol3.1]
Length=398

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S E++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISVELNSDLTGARRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPAETRAQLGISDALVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_008039031.1| cystathionine beta-lyase [Pseudomonas sp. GM67]
 gb|EJM89819.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM67]
Length=392

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNSVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S ++  DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAKRQMRGFGGMISVDLKSDLAGATRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPAETRAQLGIGDGLVRLSVGVEDVEDLRADLAQALTRI  392



>ref|WP_009858211.1| cystathionine beta-lyase [Rubrivivax benzoatilyticus]
 gb|EGJ11646.1| cystathionine gamma-lyase [Rubrivivax benzoatilyticus JA2 = ATCC 
BAA-35]
Length=397

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  ++L +RG+KTL LRV++ N+ AL +A  LEA P+V RV+YPGL SHP
Sbjct  239  LQNAVGAIAGPFDSFLALRGVKTLALRVERHNANALELARWLEAQPQVARVHYPGLESHP  298

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM+GFGG++S ++  DL    +F++A+++  +A S GG ES+++ PAIM++  
Sbjct  299  QHALARRQMSGFGGMISLDLATDLAGARRFLEAVRLFALAESLGGVESLIEHPAIMTHAT  358

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RAA GI+D+LVR S G+ED ED++AD+ QAL  I
Sbjct  359  IPPETRAALGIVDSLVRLSVGIEDVEDLRADLAQALAAI  397



>ref|WP_008027244.1| cystathionine beta-lyase [Pseudomonas sp. GM60]
 gb|EJM84370.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM60]
Length=392

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNSVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S ++  DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAKRQMRGFGGMISVDLKSDLAGATRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPAETRAQLGIGDGLVRLSVGVEDVEDLRADLAQALTRI  392



>ref|WP_043269495.1| cystathionine beta-lyase [Pseudomonas sp. AAC]
 gb|KES23992.1| cystathionine beta-lyase [Pseudomonas sp. AAC]
Length=390

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  + AL +A+ LE  P+V RV+YPGLPSHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCANALELAQWLERQPQVARVHYPGLPSHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S ++  DL  + +F++ ++I  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMNGFGGMISMDLATDLAGSKRFLENVRIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +  A RA  GI D LVR S GVED ED++AD+ QAL TI
Sbjct  352  IPPATRAELGIGDALVRLSVGVEDVEDLRADLAQALATI  390



>ref|WP_008019625.1| cystathionine beta-lyase [Pseudomonas sp. GM55]
 gb|EJM72235.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM55]
Length=392

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLERQPQVSRVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S +++ DL  T +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAQRQMRGFGGMISLDLNSDLAGTKRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  224
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPPDTRAELGIGDGLVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_043317852.1| cystathionine beta-lyase [Pseudomonas sp. PI1]
Length=390

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  + AL +A+ LE  P+V RV+YPGLPSHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCANALELAQWLERQPQVARVHYPGLPSHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S ++  DL  + +F++ ++I  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMNGFGGMISMDLATDLAGSKRFLENVRIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +  A RA  GI D LVR S GVED ED++AD+ QAL TI
Sbjct  352  IPPATRAELGIGDALVRLSVGVEDVEDLRADLAQALATI  390



>ref|WP_010169730.1| cystathionine beta-lyase [Pseudomonas sp. PAMC 25886]
Length=388

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A  LE  P+V RVYYPGL SHP
Sbjct  230  LQNSVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELATWLEQQPQVARVYYPGLASHP  289

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S ++  DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  290  QHELARRQMRGFGGMISVDLKSDLAGATRFLENVKIFALAESLGGVESLIEHPAIMTHAS  349

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +  A RA  GI D LVR S GVED ED++AD+ QAL TI
Sbjct  350  IPAATRAQLGIGDGLVRLSVGVEDVEDLRADLAQALSTI  388



>ref|WP_017338177.1| cystathionine beta-lyase [Pseudomonas fluorescens]
 gb|ERP41250.1| cystathionine beta-lyase [Pseudomonas fluorescens NCIMB 11764]
Length=392

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNSVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S ++  DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAKRQMRGFGGMISVDLKSDLAGATRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPADTRAQLGIGDGLVRLSVGVEDVEDLRADLAQALARI  392



>ref|WP_008006048.1| cystathionine beta-lyase [Pseudomonas sp. GM50]
 gb|EJM70495.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM50]
Length=393

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S +++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISLDLNSDLAGAKRFLESVRIFALAESLGGVESLIEHPAIMTHAS  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPAETRAQLGIGDALVRLSVGVEDVEDLRADLAQALLLI  392



>ref|WP_007918059.1| MULTISPECIES: cystathionine beta-lyase [Pseudomonas]
 gb|EJL97810.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM16]
 gb|EJM35574.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM24]
Length=390

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V+RVYYPGL SHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLEQQPQVKRVYYPGLASHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMRGFGGMISVDLNSDLDGARRFLENVKIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  352  IPADTRAKLGIGDGLVRLSVGVEDVEDLRADLAQALQSI  390



>ref|WP_008085129.1| cystathionine beta-lyase [Pseudomonas sp. GM80]
 gb|EJN24164.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM80]
Length=390

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A  LE  P+++RVYYPGL SHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLARWLEQQPQIKRVYYPGLESHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMRGFGGMISVDLNSDLAGARRFLENVKIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  352  IPADTRAKLGIGDGLVRLSVGVEDIEDLRADLAQALQSI  390



>ref|WP_027613062.1| cystathionine beta-lyase [Pseudomonas sp. URIL14HWK12:I6]
Length=390

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V+RVYYPGLPSHP
Sbjct  232  LQNAVGAISGPFDAFLTLRGVKTLALRMERHCSNALELAKWLEQQPQVKRVYYPGLPSHP  291

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMHGFGGMISVDLNSDLEGARRFLENVKIFALAESLGGVESLIEHPAIMTHAT  351

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+  AL  I
Sbjct  352  IPAETRAKLGIGDGLVRLSVGVEDLEDLRADLAHALTKI  390



>ref|WP_034633929.1| cystathionine gamma-synthase, partial [Bacillus okhensis]
 gb|KHF37963.1| cystathionine gamma-synthase, partial [Bacillus okhensis]
Length=174

 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 112/167 (67%), Gaps = 3/167 (2%)
 Frame = -3

Query  706  SVVRNLHH---ILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVY  536
            S+V++++H   I G T++P AAYLI+RGMKTL LRV++Q   A+++A+ LE H KV  VY
Sbjct  6    SLVKDIYHYREINGATMDPMAAYLILRGMKTLRLRVEKQQENAMKVAQFLEMHEKVEHVY  65

Query  535  YPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQ  356
            YPGL +H  H IAKKQM GFGG++SF + G+L    +F+  L+  + A + G  E+ V  
Sbjct  66   YPGLTTHTNHDIAKKQMKGFGGMLSFALKGELEAVRQFLPKLEYAHRAANLGAVETTVGP  125

Query  355  PAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
                S+ + T  ERAA GI + LVR+S G+ED +D+  D+ QAL+ I
Sbjct  126  ARTTSHVENTPEERAALGIPEGLVRYSAGIEDIDDLLHDLKQALDEI  172



>ref|WP_016979942.1| cystathionine beta-lyase [Pseudomonas fluorescens]
Length=388

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A  LE  P+V RVYYPGL SHP
Sbjct  230  LQNSVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLATWLEQQPQVARVYYPGLTSHP  289

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A+KQM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  290  QHELARKQMRGFGGMISIDLNSDLAGATRFLENVKIFALAESLGGVESLIEHPAIMTHAS  349

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +  A RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  350  IPAATRAQLGIGDGLVRLSVGVEDVEDLRADLAQALSRI  388



>gb|AIF70130.1| cystathionine beta-lyase [Palaeococcus pacificus DY20341]
Length=385

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -3

Query  679  LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI  500
            +G  L+P  ++L++RG+KTL +R+++    A+R+A+ LE HP V RVYYPGLPSHP+H +
Sbjct  229  VGAILSPFDSWLVMRGIKTLAVRMERHEKNAMRIAKYLEEHPLVERVYYPGLPSHPQHEL  288

Query  499  AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA  320
            A++QM GFGG++SFE+ G L    KFV++L+I  +A S GG ES+++ PAIM++  + + 
Sbjct  289  ARRQMHGFGGMLSFELKGGLKEAVKFVESLEIFALAESLGGVESLIELPAIMTHASVPKE  348

Query  319  ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            ER   GI D+L+R S G+ED ED+  D+ +    I
Sbjct  349  EREKVGIKDSLIRVSVGIEDVEDLIEDLEKGFRGI  383



>ref|WP_008069856.1| cystathionine beta-lyase [Pseudomonas sp. GM79]
 gb|EJN25196.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM79]
Length=393

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S +++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISLDLNSDLAGAKRFLESVRIFALAESLGGVESLIEHPAIMTHAS  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPVETRAQLGIGDALVRLSVGVEDVEDLRADLAQALMRI  392



>ref|WP_025856711.1| cystathionine beta-lyase [Pseudomonas sp. CHM02]
Length=388

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A  LE  P+V RVYYPGL SHP
Sbjct  230  LQNSVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLATWLEQQPQVARVYYPGLASHP  289

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A+KQM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++ PAIM++  
Sbjct  290  QHELARKQMRGFGGMISIDLNSDLAGATRFLENVKIFALAESLGGVESLIEHPAIMTHAS  349

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +  A RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  350  IPAATRAQLGIGDGLVRLSVGVEDVEDLRADLAQALAKI  388



>ref|WP_006976115.1| cystathionine gamma-synthase [Plesiocystis pacifica]
 gb|EDM74743.1| cystathionine gamma-synthase [Plesiocystis pacifica SIR-1]
Length=369

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 113/162 (70%), Gaps = 1/162 (1%)
 Frame = -3

Query  700  VRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLP  521
            +R     LG   +P+ AYL+ RG+KTL LRV++ N +AL +A VLEAHPKV +V+YP L 
Sbjct  209  IREQVGTLGAVCDPHNAYLLSRGLKTLALRVERHNHSALALARVLEAHPKVAKVWYPLLE  268

Query  520  SHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMS  341
            SH ++  A++ + G GGV+SFE++G L    + VDAL++P +APS GG ES+V+QPA+MS
Sbjct  269  SHQDYGHARRLLRGGGGVISFEVEG-LEAGTRLVDALRVPKLAPSLGGVESLVEQPALMS  327

Query  340  YWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            ++D     RAA GI + L+R++ G+ED  D++AD+   L  +
Sbjct  328  FYDQGPEGRAALGIREGLIRYAVGIEDLADLRADLESGLAAL  369



>ref|WP_007896198.1| cystathionine beta-lyase [Pseudomonas sp. GM102]
 gb|EJM06105.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM102]
Length=393

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +A++QM GFGG++S +++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISLDLNSDLAGAKRFLESVRIFALAESLGGVESLIEHPAIMTHAS  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPVETRAQLGIGDALVRLSVGVEDVEDLRADLAQALMRI  392



>ref|WP_011334626.1| cystathionine beta-lyase [Pseudomonas fluorescens]
 gb|ABA74987.1| putative cystathionine gamma-synthase [Pseudomonas fluorescens 
Pf0-1]
Length=392

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  691  LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  512
            L + +G    P  A+L +RG+KTL LR+++  S AL +A  LE  P+V+RVYYPGL SHP
Sbjct  234  LQNAVGAISGPFDAFLTLRGVKTLALRMERHCSNALELARWLEQQPQVKRVYYPGLESHP  293

Query  511  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  332
            +H +AK+QM GFGG++S +++ DL    +F++ ++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAKRQMRGFGGMISLDLNSDLAGARRFLENVQIFALAESLGGVESLIEHPAIMTHAT  353

Query  331  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  215
            +    RA  GI D+LVR S GVED ED++AD+ QAL +I
Sbjct  354  IPAETRAKLGIGDSLVRLSVGVEDIEDLRADLAQALASI  392



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365