BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002N06

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFR66645.1|  MIP1.1a                                                 325   4e-106   Nicotiana benthamiana
gb|AGY48883.1|  MIP1.1b                                                 323   3e-105   Nicotiana benthamiana
ref|XP_009588725.1|  PREDICTED: dnaJ protein homolog                    323   3e-105   
ref|XP_009760224.1|  PREDICTED: dnaJ protein homolog                    322   6e-105   Nicotiana sylvestris
ref|XP_007010484.1|  DNAJ                                               322   9e-105   Theobroma cacao [chocolate]
ref|XP_011032891.1|  PREDICTED: dnaJ protein homolog                    321   2e-104   Populus euphratica
dbj|BAC53943.1|  DnaJ homolog                                           318   2e-104   Nicotiana tabacum [American tobacco]
gb|AAG24642.1|AF308737_1  J1P                                           319   1e-103   Daucus carota [carrots]
ref|XP_010319287.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    316   2e-103   Solanum lycopersicum
ref|XP_006365673.1|  PREDICTED: dnaJ protein homolog isoform X2         318   2e-103   
ref|XP_006365672.1|  PREDICTED: dnaJ protein homolog isoform X1         318   2e-103   
gb|KHG16063.1|  DnaJ protein                                            314   2e-103   Gossypium arboreum [tree cotton]
gb|KJB84159.1|  hypothetical protein B456_N007500                       317   8e-103   Gossypium raimondii
gb|AAN87055.1|  tuber-induction protein                                 313   8e-103   Solanum tuberosum [potatoes]
dbj|BAA35121.1|  DnaJ homolog                                           317   8e-103   Salix gilgiana
ref|XP_009397426.1|  PREDICTED: dnaJ protein homolog                    317   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004236804.1|  PREDICTED: dnaJ protein homolog isoform X1         317   1e-102   Solanum lycopersicum
ref|XP_002310999.1|  DnaJ family protein                                316   1e-102   Populus trichocarpa [western balsam poplar]
gb|AGY48885.1|  MIP1.3                                                  316   2e-102   Nicotiana benthamiana
ref|XP_009793842.1|  PREDICTED: dnaJ protein homolog isoform X2         316   2e-102   Nicotiana sylvestris
gb|KJB60379.1|  hypothetical protein B456_009G302500                    316   2e-102   Gossypium raimondii
gb|KDO48714.1|  hypothetical protein CISIN_1g015695mg                   313   2e-102   Citrus sinensis [apfelsine]
gb|KDO48709.1|  hypothetical protein CISIN_1g015695mg                   314   2e-102   Citrus sinensis [apfelsine]
ref|XP_010907714.1|  PREDICTED: dnaJ protein homolog                    315   3e-102   Elaeis guineensis
gb|KHG01500.1|  Chaperone dnaJ 3 -like protein                          312   3e-102   Gossypium arboreum [tree cotton]
ref|XP_009793841.1|  PREDICTED: dnaJ protein homolog isoform X1         315   3e-102   Nicotiana sylvestris
ref|XP_006345881.1|  PREDICTED: dnaJ protein homolog                    315   3e-102   Solanum tuberosum [potatoes]
sp|P42824.1|DNJH2_ALLPO  RecName: Full=DnaJ protein homolog 2; Fl...    315   4e-102   Allium ampeloprasum
gb|KDO48708.1|  hypothetical protein CISIN_1g015695mg                   313   5e-102   Citrus sinensis [apfelsine]
ref|XP_010263053.1|  PREDICTED: dnaJ protein homolog                    315   5e-102   Nelumbo nucifera [Indian lotus]
gb|KDO48707.1|  hypothetical protein CISIN_1g015695mg                   313   7e-102   Citrus sinensis [apfelsine]
ref|XP_009600920.1|  PREDICTED: dnaJ protein homolog                    314   7e-102   Nicotiana tomentosiformis
gb|KDO48711.1|  hypothetical protein CISIN_1g015695mg                   314   8e-102   Citrus sinensis [apfelsine]
ref|XP_011024143.1|  PREDICTED: dnaJ protein homolog                    314   1e-101   Populus euphratica
ref|XP_006485485.1|  PREDICTED: dnaJ protein homolog                    314   1e-101   Citrus sinensis [apfelsine]
ref|XP_004249937.1|  PREDICTED: dnaJ protein homolog                    314   1e-101   
ref|XP_006445792.1|  hypothetical protein CICLE_v10015385mg             314   1e-101   Citrus clementina [clementine]
gb|KDO48710.1|  hypothetical protein CISIN_1g015695mg                   313   1e-101   Citrus sinensis [apfelsine]
ref|XP_009623415.1|  PREDICTED: dnaJ protein homolog                    313   2e-101   Nicotiana tomentosiformis
ref|XP_002316479.1|  DnaJ family protein                                313   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_004306421.1|  PREDICTED: dnaJ protein homolog                    313   3e-101   Fragaria vesca subsp. vesca
gb|KCW50581.1|  hypothetical protein EUGRSUZ_J00292                     308   3e-101   Eucalyptus grandis [rose gum]
emb|CAA63965.1|  DnaJ protein                                           312   5e-101   Solanum tuberosum [potatoes]
ref|XP_010263054.1|  PREDICTED: dnaJ protein homolog                    312   5e-101   Nelumbo nucifera [Indian lotus]
ref|XP_008787761.1|  PREDICTED: dnaJ protein homolog                    312   6e-101   Phoenix dactylifera
ref|XP_010694477.1|  PREDICTED: dnaJ protein homolog                    312   7e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009418972.1|  PREDICTED: dnaJ protein homolog isoform X2         312   8e-101   
ref|XP_009418971.1|  PREDICTED: dnaJ protein homolog isoform X1         312   8e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP22008.1|  hypothetical protein JCGZ_03128                         308   8e-101   Jatropha curcas
ref|XP_006367021.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    309   9e-101   Solanum tuberosum [potatoes]
ref|XP_006378828.1|  hypothetical protein POPTR_0010s24930g             313   1e-100   
ref|XP_002514419.1|  Chaperone protein dnaJ, putative                   311   1e-100   
ref|XP_011084248.1|  PREDICTED: dnaJ protein homolog                    311   1e-100   Sesamum indicum [beniseed]
ref|XP_010907982.1|  PREDICTED: dnaJ protein homolog                    311   2e-100   Elaeis guineensis
ref|XP_004239737.1|  PREDICTED: dnaJ protein homolog                    311   2e-100   Solanum lycopersicum
ref|XP_010090486.1|  DnaJ-like protein                                  310   2e-100   Morus notabilis
emb|CAN82708.1|  hypothetical protein VITISV_000291                     310   2e-100   Vitis vinifera
ref|XP_009398344.1|  PREDICTED: dnaJ protein homolog 2-like             310   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002263156.1|  PREDICTED: dnaJ protein homolog                    310   3e-100   Vitis vinifera
gb|ABX57881.1|  DnaJ                                                    310   3e-100   Viola baoshanensis
ref|XP_006367020.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    310   5e-100   Solanum tuberosum [potatoes]
ref|XP_004982304.1|  PREDICTED: dnaJ protein homolog 2-like             309   7e-100   Setaria italica
gb|KHG17902.1|  Chaperone dnaJ 3 -like protein                          309   8e-100   Gossypium arboreum [tree cotton]
gb|KJB35426.1|  hypothetical protein B456_006G117100                    309   9e-100   Gossypium raimondii
ref|XP_007211787.1|  hypothetical protein PRUPE_ppa006330mg             308   1e-99    Prunus persica
gb|ABB16980.1|  DnaJ-like protein                                       308   2e-99    Solanum tuberosum [potatoes]
gb|AFW68139.1|  putative dnaJ chaperone family protein                  305   3e-99    
ref|XP_008231805.1|  PREDICTED: dnaJ protein homolog                    308   3e-99    Prunus mume [ume]
gb|ABI83623.1|  DnaJ-like protein                                       307   4e-99    Setaria italica
ref|XP_009766164.1|  PREDICTED: dnaJ protein homolog 2-like             307   4e-99    Nicotiana sylvestris
ref|XP_008375557.1|  PREDICTED: dnaJ protein homolog                    307   5e-99    
gb|KCW50580.1|  hypothetical protein EUGRSUZ_J00292                     305   9e-99    Eucalyptus grandis [rose gum]
ref|XP_010031320.1|  PREDICTED: dnaJ protein homolog                    306   1e-98    Eucalyptus grandis [rose gum]
ref|XP_008345828.1|  PREDICTED: dnaJ protein homolog                    306   2e-98    Malus domestica [apple tree]
ref|NP_001146715.1|  uncharacterized protein LOC100280317               306   2e-98    
gb|AFW68140.1|  putative dnaJ chaperone family protein isoform 1        306   2e-98    
ref|NP_001130317.1|  chaperone DNA J2                                   305   3e-98    Zea mays [maize]
gb|AGY48884.1|  MIP1.2                                                  305   3e-98    Nicotiana benthamiana
ref|XP_009408521.1|  PREDICTED: dnaJ protein homolog isoform X2         305   4e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010651845.1|  PREDICTED: dnaJ protein homolog isoform X2         305   4e-98    
ref|XP_002270362.1|  PREDICTED: dnaJ protein homolog isoform X1         305   4e-98    Vitis vinifera
ref|XP_004169945.1|  PREDICTED: dnaJ protein homolog                    305   5e-98    
ref|XP_002466747.1|  hypothetical protein SORBIDRAFT_01g013390          305   5e-98    Sorghum bicolor [broomcorn]
ref|XP_009408520.1|  PREDICTED: dnaJ protein homolog isoform X1         304   6e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004166311.1|  PREDICTED: dnaJ protein homolog                    300   8e-98    
ref|XP_004981504.1|  PREDICTED: dnaJ protein homolog                    303   2e-97    Setaria italica
ref|XP_009341572.1|  PREDICTED: dnaJ protein homolog                    303   2e-97    Pyrus x bretschneideri [bai li]
ref|NP_001238341.1|  seed maturation protein PM37                       302   4e-97    Glycine max [soybeans]
ref|NP_001168650.1|  putative dnaJ chaperone family protein             302   4e-97    Zea mays [maize]
ref|XP_008446732.1|  PREDICTED: dnaJ protein homolog                    302   5e-97    Cucumis melo [Oriental melon]
ref|NP_001149958.1|  dnaJ protein                                       299   7e-97    
gb|EMT20603.1|  DnaJ protein-like protein                               302   7e-97    
gb|AAX95135.1|  DnaJ protein, putative                                  301   9e-97    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050779.1|  Os03g0648400                                       301   9e-97    
ref|XP_009406563.1|  PREDICTED: dnaJ protein homolog                    301   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010089798.1|  DnaJ-like protein                                  302   1e-96    
gb|AGY48886.1|  MIP1.4a                                                 300   2e-96    Nicotiana benthamiana
gb|KCW50936.1|  hypothetical protein EUGRSUZ_J00583                     298   2e-96    Eucalyptus grandis [rose gum]
ref|NP_001267695.1|  dnaJ protein homolog                               300   3e-96    Cucumis sativus [cucumbers]
gb|EMT10718.1|  DnaJ protein-like protein                               300   3e-96    
gb|ABA46776.1|  DnaJ-like protein                                       301   3e-96    Solanum tuberosum [potatoes]
ref|XP_004139085.1|  PREDICTED: dnaJ protein homolog                    300   4e-96    Cucumis sativus [cucumbers]
gb|KDO48966.1|  hypothetical protein CISIN_1g014903mg                   296   5e-96    Citrus sinensis [apfelsine]
ref|XP_008443634.1|  PREDICTED: dnaJ protein homolog                    299   6e-96    Cucumis melo [Oriental melon]
ref|XP_010031575.1|  PREDICTED: dnaJ protein homolog                    299   7e-96    Eucalyptus grandis [rose gum]
ref|XP_006650350.1|  PREDICTED: dnaJ protein homolog 2-like             299   8e-96    
ref|XP_006826444.1|  hypothetical protein AMTR_s00004p00172570          298   1e-95    Amborella trichopoda
ref|XP_003561819.1|  PREDICTED: dnaJ protein homolog                    298   2e-95    Brachypodium distachyon [annual false brome]
emb|CDO99946.1|  unnamed protein product                                298   2e-95    Coffea canephora [robusta coffee]
sp|Q03363.1|DNJH1_ALLPO  RecName: Full=DnaJ protein homolog 1; Sh...    297   2e-95    Allium ampeloprasum
gb|AAF64454.1|AF239932_1  DnaJ protein                                  298   2e-95    Euphorbia esula [wolf's milk]
ref|XP_004506241.1|  PREDICTED: dnaJ protein homolog ANJ1-like          298   3e-95    Cicer arietinum [garbanzo]
ref|XP_006424068.1|  hypothetical protein CICLE_v10028531mg             298   3e-95    Citrus clementina [clementine]
gb|ABI18985.1|  molecular chaperone DjA2                                298   3e-95    Allium ampeloprasum
ref|XP_003596917.1|  DnaJ                                               292   3e-95    
ref|NP_001242510.1|  uncharacterized protein LOC100808604               297   4e-95    
ref|XP_006590333.1|  PREDICTED: uncharacterized protein LOC100808...    297   5e-95    
gb|KJB09149.1|  hypothetical protein B456_001G126200                    297   5e-95    Gossypium raimondii
ref|XP_008385581.1|  PREDICTED: dnaJ protein homolog                    296   6e-95    
ref|NP_001234241.1|  DnaJ-like protein                                  296   7e-95    
ref|XP_008359180.1|  PREDICTED: dnaJ protein homolog                    296   9e-95    
ref|XP_009789005.1|  PREDICTED: dnaJ protein homolog                    296   1e-94    Nicotiana sylvestris
ref|XP_007015641.1|  DNAJ isoform 2                                     295   2e-94    
emb|CDP15561.1|  unnamed protein product                                295   3e-94    Coffea canephora [robusta coffee]
ref|XP_007132506.1|  hypothetical protein PHAVU_011G100000g             295   3e-94    Phaseolus vulgaris [French bean]
gb|AFK38714.1|  unknown                                                 289   3e-94    Lotus japonicus
gb|AAD12055.1|  DnaJ protein                                            295   4e-94    Hevea brasiliensis [jebe]
gb|KDP42967.1|  hypothetical protein JCGZ_23909                         295   4e-94    Jatropha curcas
gb|AHA84223.1|  seed maturation protein PM37                            295   4e-94    Phaseolus vulgaris [French bean]
gb|KJB35429.1|  hypothetical protein B456_006G117100                    295   5e-94    Gossypium raimondii
gb|KHG16062.1|  Chaperone protein dnaJ 3                                291   7e-94    Gossypium arboreum [tree cotton]
ref|XP_009368443.1|  PREDICTED: dnaJ protein homolog                    294   9e-94    Pyrus x bretschneideri [bai li]
ref|XP_011090296.1|  PREDICTED: dnaJ protein homolog                    293   9e-94    Sesamum indicum [beniseed]
ref|XP_008230416.1|  PREDICTED: dnaJ protein homolog                    293   1e-93    Prunus mume [ume]
gb|AFK48086.1|  unknown                                                 286   2e-93    Medicago truncatula
gb|AFK37703.1|  unknown                                                 293   2e-93    Medicago truncatula
ref|XP_003596916.1|  DnaJ                                               293   2e-93    Medicago truncatula
gb|EYU37228.1|  hypothetical protein MIMGU_mgv1a006942mg                293   2e-93    Erythranthe guttata [common monkey flower]
gb|ACJ84348.1|  unknown                                                 287   2e-93    Medicago truncatula
gb|AGY48887.1|  MIP1.4b                                                 292   5e-93    Nicotiana benthamiana
ref|XP_007205259.1|  hypothetical protein PRUPE_ppa006299mg             291   6e-93    Prunus persica
gb|KHN36510.1|  DnaJ protein like                                       287   7e-93    Glycine soja [wild soybean]
ref|XP_002313505.1|  seed maturation protein PM37                       291   8e-93    Populus trichocarpa [western balsam poplar]
gb|AFW67420.1|  putative dnaJ chaperone family protein                  291   8e-93    
gb|AFW67421.1|  putative dnaJ chaperone family protein                  291   9e-93    
gb|AFK46626.1|  unknown                                                 285   9e-93    Medicago truncatula
gb|EYU36023.1|  hypothetical protein MIMGU_mgv1a007093mg                291   1e-92    Erythranthe guttata [common monkey flower]
gb|ADK35105.1|  DnaJ-like protein 1                                     285   1e-92    Astragalus sinicus
ref|XP_009336413.1|  PREDICTED: dnaJ protein homolog                    291   1e-92    Pyrus x bretschneideri [bai li]
ref|XP_008361658.1|  PREDICTED: dnaJ protein homolog                    290   2e-92    
ref|XP_002515865.1|  Chaperone protein dnaJ, putative                   290   2e-92    Ricinus communis
ref|XP_009592511.1|  PREDICTED: dnaJ protein homolog                    289   4e-92    Nicotiana tomentosiformis
ref|XP_004291531.1|  PREDICTED: dnaJ protein homolog                    290   5e-92    Fragaria vesca subsp. vesca
ref|NP_001240264.1|  uncharacterized protein LOC100818805               289   5e-92    Glycine max [soybeans]
gb|AHA84264.1|  seed maturation protein PM37                            289   6e-92    Phaseolus vulgaris [French bean]
gb|KHN17991.1|  DnaJ protein like                                       288   1e-91    Glycine soja [wild soybean]
ref|XP_008670357.1|  PREDICTED: dnaJ protein homolog 2-like             283   2e-91    
ref|XP_003605981.1|  DnaJ                                               287   2e-91    
tpg|DAA40640.1|  TPA: putative dnaJ chaperone family protein            283   2e-91    
ref|XP_003605980.1|  DnaJ                                               287   2e-91    Medicago truncatula
ref|XP_003540271.1|  PREDICTED: dnaJ protein homolog                    286   7e-91    Glycine max [soybeans]
ref|XP_008661261.1|  PREDICTED: dnaJ protein homolog 2-like             283   7e-91    Zea mays [maize]
gb|AFW89867.1|  putative dnaJ chaperone family protein                  283   1e-90    
gb|EYU36024.1|  hypothetical protein MIMGU_mgv1a007013mg                285   2e-90    Erythranthe guttata [common monkey flower]
ref|XP_006650701.1|  PREDICTED: dnaJ protein homolog 2-like             285   2e-90    Oryza brachyantha
ref|XP_006340319.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    282   2e-90    Solanum tuberosum [potatoes]
ref|XP_008666814.1|  PREDICTED: dnaJ protein homolog 1-like             288   2e-90    
ref|XP_010685460.1|  PREDICTED: dnaJ protein homolog ANJ1               284   4e-90    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU37227.1|  hypothetical protein MIMGU_mgv1a006922mg                285   4e-90    Erythranthe guttata [common monkey flower]
gb|EAY92107.1|  hypothetical protein OsI_13813                          284   5e-90    Oryza sativa Indica Group [Indian rice]
ref|NP_001051497.1|  Os03g0787300                                       284   6e-90    
ref|XP_004291528.1|  PREDICTED: dnaJ protein homolog                    284   7e-90    Fragaria vesca subsp. vesca
ref|XP_006340318.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    283   9e-90    Solanum tuberosum [potatoes]
ref|XP_007150008.1|  hypothetical protein PHAVU_005G118100g             283   1e-89    Phaseolus vulgaris [French bean]
ref|XP_007015640.1|  DNAJ isoform 1                                     283   1e-89    
ref|XP_002874044.1|  hypothetical protein ARALYDRAFT_489058             282   3e-89    
ref|NP_001275059.1|  DnaJ-like protein                                  281   2e-88    Solanum tuberosum [potatoes]
ref|XP_008660777.1|  PREDICTED: dnaJ protein homolog 2-like             275   1e-87    Zea mays [maize]
ref|XP_003558043.1|  PREDICTED: dnaJ protein homolog                    278   2e-87    Brachypodium distachyon [annual false brome]
gb|ABK21047.1|  unknown                                                 269   3e-87    Picea sitchensis
ref|XP_011008852.1|  PREDICTED: dnaJ protein homolog isoform X1         276   4e-87    Populus euphratica
ref|XP_011008853.1|  PREDICTED: dnaJ protein homolog isoform X2         276   5e-87    Populus euphratica
ref|XP_010544327.1|  PREDICTED: dnaJ protein homolog                    276   5e-87    Tarenaya hassleriana [spider flower]
sp|P43644.1|DNJH_ATRNU  RecName: Full=DnaJ protein homolog ANJ1; ...    275   1e-86    Atriplex nummularia
ref|NP_568412.1|  chaperone protein dnaJ 2                              275   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004251216.1|  PREDICTED: dnaJ protein homolog                    275   2e-86    Solanum lycopersicum
ref|XP_006400711.1|  hypothetical protein EUTSA_v10013655mg             274   3e-86    Eutrema salsugineum [saltwater cress]
emb|CAC12824.1|  putative DNAJ protein                                  274   5e-86    Nicotiana tabacum [American tobacco]
gb|EMS60670.1|  DnaJ protein-like protein                               273   2e-85    Triticum urartu
ref|XP_001782829.1|  predicted protein                                  272   2e-85    
gb|AAB86799.1|  putative                                                272   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010919645.1|  PREDICTED: dnaJ protein homolog                    272   2e-85    Elaeis guineensis
gb|ACN39991.1|  unknown                                                 272   3e-85    Picea sitchensis
ref|XP_010521621.1|  PREDICTED: dnaJ protein homolog ANJ1-like          271   5e-85    Tarenaya hassleriana [spider flower]
gb|ABG78615.1|  J-domain protein                                        271   5e-85    Triticum aestivum [Canadian hard winter wheat]
gb|AFW86285.1|  putative dnaJ chaperone family protein                  277   9e-85    
gb|KFK26344.1|  hypothetical protein AALP_AA8G235700                    270   1e-84    Arabis alpina [alpine rockcress]
ref|XP_001774283.1|  predicted protein                                  270   2e-84    
ref|XP_002275918.1|  PREDICTED: dnaJ protein homolog 2                  270   2e-84    Vitis vinifera
ref|XP_009120689.1|  PREDICTED: chaperone protein dnaJ 3-like           270   3e-84    Brassica rapa
emb|CDX92385.1|  BnaA10g14240D                                          269   3e-84    
ref|XP_002969107.1|  hypothetical protein SELMODRAFT_267228             269   4e-84    Selaginella moellendorffii
ref|XP_009120690.1|  PREDICTED: chaperone protein dnaJ 3-like           269   4e-84    Brassica rapa
emb|CDX92386.1|  BnaA10g14250D                                          269   6e-84    
gb|AAK74013.1|  AT3g44110/F26G5_60                                      268   8e-84    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189997.1|  chaperone protein dnaJ 3                              268   8e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088982.1|  PREDICTED: dnaJ protein homolog                    268   9e-84    Sesamum indicum [beniseed]
ref|XP_010420996.1|  PREDICTED: chaperone protein dnaJ 2 isoform X1     268   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_002877319.1|  hypothetical protein ARALYDRAFT_905503             268   1e-83    Arabidopsis lyrata subsp. lyrata
ref|XP_010454471.1|  PREDICTED: chaperone protein dnaJ 2                268   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_006292339.1|  hypothetical protein CARUB_v10018551mg             268   1e-83    Capsella rubella
ref|XP_010089281.1|  DnaJ-like protein                                  267   2e-83    Morus notabilis
ref|XP_006404506.1|  hypothetical protein EUTSA_v10010407mg             267   2e-83    Eutrema salsugineum [saltwater cress]
dbj|BAJ91943.1|  predicted protein                                      267   2e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010427107.1|  PREDICTED: chaperone protein dnaJ 3 isoform X1     266   3e-83    
ref|XP_010514755.1|  PREDICTED: chaperone protein dnaJ 3-like           266   3e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010535721.1|  PREDICTED: chaperone protein dnaJ 3                266   3e-83    Tarenaya hassleriana [spider flower]
gb|AAB49030.1|  DnaJ homolog                                            266   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126521.1|  PREDICTED: chaperone protein dnaJ 3                266   3e-83    Brassica rapa
emb|CDY09117.1|  BnaA02g05430D                                          266   4e-83    Brassica napus [oilseed rape]
ref|XP_006287824.1|  hypothetical protein CARUB_v10001042mg             266   4e-83    Capsella rubella
ref|XP_010520679.1|  PREDICTED: chaperone protein dnaJ 3-like           268   6e-83    
emb|CDY16617.1|  BnaC09g36560D                                          258   2e-82    Brassica napus [oilseed rape]
ref|XP_010493266.1|  PREDICTED: chaperone protein dnaJ 2-like iso...    265   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010933633.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    263   7e-82    Elaeis guineensis
ref|XP_010933632.1|  PREDICTED: dnaJ protein homolog isoform X1         263   8e-82    Elaeis guineensis
ref|XP_001755408.1|  predicted protein                                  263   1e-81    
ref|XP_008803820.1|  PREDICTED: dnaJ protein homolog 2-like             262   2e-81    
ref|XP_006445374.1|  hypothetical protein CICLE_v10020330mg             256   3e-80    
emb|CBI28261.3|  unnamed protein product                                258   5e-80    Vitis vinifera
ref|XP_001768102.1|  predicted protein                                  258   7e-80    
ref|XP_006445376.1|  hypothetical protein CICLE_v10020330mg             257   1e-79    Citrus clementina [clementine]
ref|XP_010248011.1|  PREDICTED: dnaJ protein homolog 2-like             256   2e-79    Nelumbo nucifera [Indian lotus]
emb|CDY65546.1|  BnaCnng47600D                                          256   3e-79    Brassica napus [oilseed rape]
ref|XP_009779099.1|  PREDICTED: dnaJ protein homolog                    256   4e-79    Nicotiana sylvestris
tpg|DAA50892.1|  TPA: putative dnaJ chaperone family protein            268   4e-79    
tpg|DAA41085.1|  TPA: putative dnaJ chaperone family protein            257   5e-79    
ref|XP_009622737.1|  PREDICTED: dnaJ protein homolog 2-like             256   6e-79    Nicotiana tomentosiformis
ref|XP_002983333.1|  hypothetical protein SELMODRAFT_118063             254   3e-78    Selaginella moellendorffii
gb|ACJ83716.1|  unknown                                                 243   1e-77    Medicago truncatula
ref|XP_009382439.1|  PREDICTED: dnaJ protein homolog                    252   1e-77    Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI16632.3|  unnamed protein product                                259   1e-77    Vitis vinifera
ref|XP_002963792.1|  hypothetical protein SELMODRAFT_230221             251   4e-77    Selaginella moellendorffii
ref|XP_010258833.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    248   4e-77    Nelumbo nucifera [Indian lotus]
ref|XP_008232370.1|  PREDICTED: dnaJ protein homolog 2-like             251   4e-77    Prunus mume [ume]
ref|XP_003521084.1|  PREDICTED: dnaJ protein homolog 2-like             249   2e-76    Glycine max [soybeans]
ref|XP_007220469.1|  hypothetical protein PRUPE_ppa006364mg             249   2e-76    
ref|XP_010258832.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    249   2e-76    Nelumbo nucifera [Indian lotus]
ref|XP_002446897.1|  hypothetical protein SORBIDRAFT_06g024520          248   5e-76    Sorghum bicolor [broomcorn]
ref|XP_002974881.1|  hypothetical protein SELMODRAFT_232411             248   5e-76    Selaginella moellendorffii
tpg|DAA45534.1|  TPA: putative dnaJ chaperone family protein            240   9e-76    
ref|XP_009131855.1|  PREDICTED: chaperone protein dnaJ 3-like           247   1e-75    Brassica rapa
ref|XP_007052233.1|  DNAJ                                               247   1e-75    Theobroma cacao [chocolate]
gb|ACU24346.1|  unknown                                                 247   1e-75    Glycine max [soybeans]
ref|XP_004976432.1|  PREDICTED: dnaJ protein homolog 2-like             245   5e-75    Setaria italica
gb|AGR45906.1|  DnaJ protein 2-like protein                             244   1e-74    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001136581.1|  putative dnaJ chaperone family protein             244   1e-74    Zea mays [maize]
ref|XP_004229763.1|  PREDICTED: dnaJ protein homolog 2-like             244   1e-74    Solanum lycopersicum
gb|ABY52936.1|  DnaJ family heat shock protein                          244   2e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003529049.1|  PREDICTED: dnaJ protein homolog 2-like             244   2e-74    Glycine max [soybeans]
ref|XP_006347934.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    242   8e-74    
ref|XP_004953339.1|  PREDICTED: dnaJ protein homolog 2-like             242   1e-73    Setaria italica
emb|CDX70980.1|  BnaC03g10640D                                          241   2e-73    
ref|XP_006345526.1|  PREDICTED: dnaJ protein homolog isoform X1         241   3e-73    Solanum tuberosum [potatoes]
ref|XP_008375745.1|  PREDICTED: dnaJ protein homolog 2-like             241   4e-73    Malus domestica [apple tree]
ref|XP_003570021.1|  PREDICTED: dnaJ protein homolog 2-like             239   1e-72    Brachypodium distachyon [annual false brome]
emb|CDP09461.1|  unnamed protein product                                239   1e-72    Coffea canephora [robusta coffee]
ref|XP_010692097.1|  PREDICTED: dnaJ protein homolog 2-like             238   3e-72    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001053485.1|  Os04g0549600                                       238   3e-72    
gb|EPS61572.1|  hypothetical protein M569_13222                         230   3e-72    Genlisea aurea
emb|CAH67501.1|  OSIGBa0134H18.3                                        238   4e-72    Oryza sativa [red rice]
ref|XP_011457522.1|  PREDICTED: dnaJ protein homolog                    237   5e-72    Fragaria vesca subsp. vesca
dbj|BAA76883.1|  DnaJ homolog protein                                   238   6e-72    Salix gilgiana
gb|KJB84164.1|  hypothetical protein B456_N007500                       237   9e-72    Gossypium raimondii
ref|XP_009411580.1|  PREDICTED: dnaJ protein homolog                    235   5e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007134513.1|  hypothetical protein PHAVU_010G053900g             235   7e-71    Phaseolus vulgaris [French bean]
ref|XP_006647627.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    234   2e-70    Oryza brachyantha
ref|XP_004307004.1|  PREDICTED: dnaJ protein homolog 2-like             234   2e-70    Fragaria vesca subsp. vesca
ref|XP_006647626.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    234   2e-70    Oryza brachyantha
dbj|BAD25681.1|  putative DnaJ-like protein MsJ1                        233   3e-70    
ref|NP_001047626.1|  Os02g0656500                                       233   4e-70    
gb|EEC73725.1|  hypothetical protein OsI_08334                          233   4e-70    
emb|CAD41609.2|  OSJNBb0034G17.1                                        239   5e-70    
gb|EEE57509.1|  hypothetical protein OsJ_07792                          233   1e-69    
gb|AGY48888.1|  MIP1L1                                                  229   7e-69    
gb|KHF97331.1|  Chaperone dnaJ 3 -like protein                          229   8e-69    
ref|XP_001774301.1|  predicted protein                                  228   2e-68    
gb|KJB41004.1|  hypothetical protein B456_007G087000                    226   2e-68    
ref|XP_009596179.1|  PREDICTED: dnaJ protein homolog                    227   7e-68    
gb|KJB41003.1|  hypothetical protein B456_007G087000                    226   2e-67    
ref|XP_008671675.1|  PREDICTED: dnaJ protein homolog                    218   2e-67    
ref|XP_010053981.1|  PREDICTED: dnaJ protein homolog                    224   7e-67    
ref|XP_011093285.1|  PREDICTED: chaperone protein dnaJ 3-like           224   1e-66    
ref|XP_004510114.1|  PREDICTED: dnaJ protein homolog 2-like             222   7e-66    
gb|KDP28841.1|  hypothetical protein JCGZ_14612                         219   6e-65    
ref|XP_002454540.1|  hypothetical protein SORBIDRAFT_04g032970          219   9e-65    
ref|XP_011017420.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    216   1e-64    
ref|XP_006386554.1|  hypothetical protein POPTR_0002s14200g             218   2e-64    
ref|XP_002301248.1|  DnaJ family protein                                218   2e-64    
gb|AHH02353.1|  putative DnaJ-like protein                              207   3e-64    
ref|XP_002511620.1|  Chaperone protein dnaJ, putative                   216   7e-64    
ref|XP_011017419.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    216   8e-64    
tpg|DAA39063.1|  TPA: putative dnaJ chaperone family protein            213   1e-63    
gb|AFK35446.1|  unknown                                                 210   9e-63    
tpg|DAA39850.1|  TPA: putative dnaJ chaperone family protein            206   1e-62    
gb|ACJ84518.1|  unknown                                                 211   7e-62    
ref|XP_003626730.1|  DnaJ protein-like protein                          211   7e-62    
gb|AFK48766.1|  unknown                                                 211   8e-62    
emb|CAA04447.1|  DnaJ-like protein                                      210   3e-61    
gb|EPS67712.1|  hypothetical protein M569_07062                         203   3e-60    
emb|CAN64325.1|  hypothetical protein VITISV_005641                     205   2e-59    
ref|XP_010098885.1|  DnaJ-like protein                                  188   2e-56    
gb|AFW72108.1|  putative dnaJ chaperone family protein                  201   7e-56    
gb|AFW76668.1|  putative dnaJ chaperone family protein                  199   8e-55    
tpg|DAA45343.1|  TPA: putative dnaJ chaperone family protein            202   9e-55    
ref|XP_006369376.1|  hypothetical protein POPTR_0001s22240g             183   3e-52    
ref|XP_003058583.1|  predicted protein                                  186   5e-52    
ref|XP_002507968.1|  predicted protein                                  185   6e-52    
ref|XP_001419206.1|  predicted protein                                  182   1e-50    
ref|XP_003080911.1|  DnaJ-like protein (ISS)                            179   1e-49    
gb|AAD09512.1|  ATFP9                                                   163   2e-47    
emb|CAD29846.1|  putative DnaJ protein                                  162   2e-46    
gb|ACJ83768.1|  unknown                                                 150   4e-42    
ref|NP_850653.1|  chaperone protein dnaJ 3                              156   1e-41    
gb|ADW66143.1|  DnaJ like-protein                                       149   2e-41    
gb|EHJ78745.1|  DnaJ-like protein 2                                     151   2e-41    
ref|XP_005822285.1|  hypothetical protein GUITHDRAFT_97880              157   2e-41    
ref|XP_006375228.1|  hypothetical protein POPTR_0014s05470g             152   4e-41    
gb|AEA86323.1|  DnaJ-like protein                                       146   8e-41    
ref|XP_002900006.1|  conserved hypothetical protein                     155   2e-40    
ref|XP_008874481.1|  hypothetical protein H310_10021                    155   2e-40    
gb|KDO27150.1|  hypothetical protein SPRG_07857                         154   2e-40    
ref|XP_005645695.1|  DnaJ-like protein                                  154   3e-40    
ref|XP_009525521.1|  hypothetical protein PHYSODRAFT_345922             154   3e-40    
ref|XP_008890293.1|  hypothetical protein PPTG_00631                    154   4e-40    
ref|XP_007515206.1|  predicted protein                                  154   4e-40    
gb|KDO27145.1|  hypothetical protein SPRG_07853                         153   6e-40    
ref|XP_008607516.1|  hypothetical protein SDRG_03657                    153   9e-40    
ref|XP_008612573.1|  DnaJ like subfamily A member 2                     152   1e-39    
dbj|BAM19149.1|  DnaJ-like-2 protein                                    152   1e-39    
dbj|BAG30793.1|  similar to DnaJ protein                                152   2e-39    
ref|XP_971446.1|  PREDICTED: dnaJ homolog subfamily A member 1          151   3e-39    
ref|XP_008885880.1|  DnaJ family chaperone, putative                    152   3e-39    
tpg|DAA62360.1|  TPA: putative dnaJ chaperone family protein            148   3e-39    
ref|XP_005107829.1|  PREDICTED: dnaJ homolog subfamily A member 2...    151   4e-39    
ref|XP_011400324.1|  DnaJ protein-like protein 2                        148   5e-39    
ref|XP_002364366.1|  DnaJ domain-containing protein                     152   5e-39    
ref|XP_002778410.1|  conserved hypothetical protein                     149   5e-39    
ref|XP_008607517.1|  hypothetical protein SDRG_03658                    150   5e-39    
gb|ENN74728.1|  hypothetical protein YQE_08695                          148   7e-39    
gb|ENN83357.1|  hypothetical protein YQE_00284                          148   7e-39    
ref|XP_783184.2|  PREDICTED: dnaJ homolog subfamily A member 2-like     150   1e-38    
gb|AIS40015.1|  DnaJ 3-like protein                                     141   1e-38    
gb|KDO19151.1|  hypothetical protein SPRG_15718                         147   2e-38    
ref|XP_667910.1|  DNAJ domain protein                                   149   3e-38    
ref|XP_627269.1|  DNAJ like chaperone                                   149   4e-38    
ref|NP_001157380.1|  DnaJ (Hsp40) homolog 1                             147   6e-38    
gb|EFX77852.1|  hypothetical protein DAPPUDRAFT_305330                  147   7e-38    
gb|AFW57798.1|  putative dnaJ chaperone family protein                  142   7e-38    
gb|ERL94599.1|  hypothetical protein D910_11876                         147   8e-38    
ref|XP_005851097.1|  hypothetical protein CHLNCDRAFT_29444              148   8e-38    
gb|EHJ70691.1|  DnaJ-like protein 1                                     147   1e-37    
ref|XP_970724.1|  PREDICTED: dnaJ homolog subfamily A member 2          146   2e-37    
ref|XP_008552261.1|  PREDICTED: dnaJ homolog subfamily A member 1       146   2e-37    
ref|XP_005707879.1|  molecular chaperone DnaJ                           146   2e-37    
gb|AHA86298.1|  DnaJ                                                    145   3e-37    
emb|CDJ42592.1|  DnaJ domain-containing protein, putative               146   4e-37    
gb|AFW72107.1|  putative dnaJ chaperone family protein                  137   4e-37    
emb|CDJ35967.1|  hypothetical protein EMH_0019910                       139   4e-37    
gb|KDR14838.1|  DnaJ-like protein subfamily A member 2                  146   5e-37    
gb|KDO16638.1|  hypothetical protein SPRG_17375                         144   5e-37    
ref|XP_003699212.1|  PREDICTED: dnaJ homolog subfamily A member 1...    145   6e-37    
ref|XP_002768280.1|  chaperone protein DnaJ, putative                   145   6e-37    
gb|KFM76618.1|  DnaJ-like protein subfamily A member 1                  144   8e-37    
gb|EFX86347.1|  hypothetical protein DAPPUDRAFT_187536                  144   1e-36    
ref|XP_002142012.1|  DnaJ domain-containing protein                     144   1e-36    
gb|EFN71101.1|  DnaJ-like protein subfamily A member 1                  141   2e-36    
ref|NP_001040292.1|  DnaJ (Hsp40) homolog 2                             143   3e-36    
ref|XP_008874469.1|  hypothetical protein H310_10010                    142   5e-36    
ref|XP_004487721.1|  PREDICTED: dnaJ protein homolog                    141   6e-36    
ref|XP_003885120.1|  DnaJ domain containing protein, related            142   7e-36    
emb|CCA21495.1|  conserved hypothetical protein                         142   8e-36    
ref|XP_004067524.1|  PREDICTED: dnaJ homolog subfamily A member 2       142   9e-36    
ref|XP_010503071.1|  PREDICTED: chaperone protein dnaJ 3-like           133   2e-35    
ref|XP_009830477.1|  hypothetical protein H257_06808                    141   2e-35    
ref|XP_011252179.1|  PREDICTED: dnaJ homolog subfamily A member 1       141   2e-35    
emb|CCI48829.1|  unnamed protein product                                144   2e-35    
ref|XP_005852710.1|  DnaJ subfamily A member 2-like protein             140   2e-35    
emb|CCI48832.1|  unnamed protein product                                144   2e-35    
emb|CCI48831.1|  unnamed protein product                                144   2e-35    
emb|CCI48830.1|  unnamed protein product                                144   2e-35    
ref|XP_011150153.1|  PREDICTED: dnaJ homolog subfamily A member 1       140   3e-35    
ref|NP_001171852.1|  dnaJ homolog subfamily A member 2-like             140   3e-35    
gb|ELU11047.1|  hypothetical protein CAPTEDRAFT_164620                  140   4e-35    
ref|XP_008296183.1|  PREDICTED: dnaJ homolog subfamily A member 2       140   4e-35    
emb|CDJ47480.1|  DnaJ domain-containing protein, putative               140   4e-35    
gb|EWM24221.1|  HSP40/DnaJ heat shock protein                           140   4e-35    
ref|XP_011059083.1|  PREDICTED: dnaJ homolog subfamily A member 1       140   4e-35    
ref|XP_009058223.1|  hypothetical protein LOTGIDRAFT_122424             140   4e-35    
emb|CBJ30599.1|  Heat shock protein 40                                  140   4e-35    
ref|XP_004539855.1|  PREDICTED: dnaJ homolog subfamily A member 2...    140   6e-35    
ref|XP_001635397.1|  predicted protein                                  139   7e-35    
ref|XP_003440442.1|  PREDICTED: dnaJ homolog subfamily A member 2...    139   8e-35    
ref|XP_003289478.1|  heat shock protein                                 139   8e-35    
ref|XP_004553333.1|  PREDICTED: dnaJ homolog subfamily A member 2...    139   8e-35    
ref|XP_003494215.1|  PREDICTED: dnaJ homolog subfamily A member 1...    139   9e-35    
ref|XP_008205330.1|  PREDICTED: dnaJ homolog subfamily A member 1       139   1e-34    
emb|CDI76051.1|  DnaJ domain-containing protein, putative               139   1e-34    
gb|ABA99886.2|  DnaJ protein, putative, expressed                       139   1e-34    
ref|XP_003395031.1|  PREDICTED: dnaJ homolog subfamily A member 1...    139   1e-34    
ref|XP_002604869.1|  hypothetical protein BRAFLDRAFT_217157             139   1e-34    
gb|EAY83926.1|  hypothetical protein OsI_39149                          139   1e-34    
gb|AAC72887.1|  heat shock protein Ddj1                                 138   2e-34    
ref|XP_011474480.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    138   2e-34    
ref|XP_011173657.1|  PREDICTED: dnaJ homolog subfamily A member 1       138   2e-34    
ref|XP_641304.1|  heat shock protein                                    138   2e-34    
emb|CDJ57769.1|  DnaJ domain-containing protein, putative               138   2e-34    
ref|XP_003694595.1|  PREDICTED: dnaJ homolog subfamily A member 1...    137   3e-34    
ref|XP_011334056.1|  PREDICTED: dnaJ homolog subfamily A member 4       137   4e-34    
ref|XP_005802556.1|  PREDICTED: dnaJ homolog subfamily A member 2...    137   4e-34    
ref|XP_316024.4|  AGAP005981-PA                                         137   4e-34    
emb|CDJ62663.1|  DnaJ domain-containing protein, putative               137   5e-34    
ref|XP_007887604.1|  PREDICTED: dnaJ homolog subfamily A member 2       137   5e-34    
gb|ABF18277.1|  DNAJ chaperone                                          137   5e-34    
ref|NP_001004807.1|  DnaJ subfamily A member 2                          137   6e-34    
ref|XP_009830474.1|  hypothetical protein H257_06805                    137   7e-34    
ref|XP_011302182.1|  PREDICTED: dnaJ homolog subfamily A member 1       136   7e-34    
gb|EEE53623.1|  hypothetical protein OsJ_36898                          137   8e-34    
ref|XP_007543201.1|  PREDICTED: dnaJ homolog subfamily A member 2       136   1e-33    
ref|XP_008403090.1|  PREDICTED: dnaJ homolog subfamily A member 2       136   1e-33    
ref|XP_009976964.1|  PREDICTED: dnaJ homolog subfamily A member 1...    131   1e-33    
ref|NP_997830.1|  DnaJ subfamily A member 2-like                        136   1e-33    
ref|XP_001844792.1|  DNAJ chaperone                                     135   1e-33    
gb|EGW02401.1|  DnaJ-like subfamily A member 1                          130   2e-33    
ref|XP_004351705.1|  heat shock protein                                 136   2e-33    
gb|ETN63538.1|  DNAJ chaperone                                          135   2e-33    
ref|XP_003967154.1|  PREDICTED: dnaJ homolog subfamily A member 2...    135   2e-33    
emb|CDQ55983.1|  unnamed protein product                                135   3e-33    
gb|EKC32228.1|  DnaJ-like protein subfamily A member 1                  133   3e-33    
ref|XP_009904990.1|  PREDICTED: dnaJ homolog subfamily A member 2       133   4e-33    
dbj|BAH12856.1|  unnamed protein product                                131   5e-33    
gb|KFV72167.1|  DnaJ subfamily A member 2                               134   6e-33    
ref|XP_010716282.1|  PREDICTED: dnaJ homolog subfamily A member 2       130   7e-33    
gb|EMC89242.1|  DnaJ like protein subfamily A member 2                  130   7e-33    
emb|CDQ59403.1|  unnamed protein product                                134   7e-33    
ref|XP_008308939.1|  PREDICTED: dnaJ homolog subfamily A member 2       134   8e-33    
gb|ACN11426.1|  DnaJ homolog subfamily A member 2                       134   8e-33    
emb|CAG13048.1|  unnamed protein product                                134   8e-33    
ref|XP_010730226.1|  PREDICTED: dnaJ homolog subfamily A member 2       134   8e-33    
emb|CEP12765.1|  hypothetical protein                                   134   9e-33    
ref|XP_001507642.1|  PREDICTED: dnaJ homolog subfamily A member 2       134   9e-33    
gb|KFM60612.1|  DnaJ-like protein subfamily A member 2                  134   9e-33    
ref|XP_009034902.1|  hypothetical protein AURANDRAFT_59942              134   9e-33    
ref|XP_002768281.1|  conserved hypothetical protein                     134   1e-32    
ref|XP_011416044.1|  PREDICTED: dnaJ homolog subfamily A member 1...    133   1e-32    
ref|XP_007059709.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    132   2e-32    
ref|XP_008053212.1|  PREDICTED: dnaJ homolog subfamily A member 2       133   2e-32    
ref|XP_003969457.1|  PREDICTED: dnaJ homolog subfamily A member 2...    133   2e-32    
ref|XP_005707432.1|  molecular chaperone DnaJ                           133   2e-32    
ref|XP_007439805.1|  PREDICTED: dnaJ homolog subfamily A member 2       133   2e-32    
ref|XP_006641433.1|  PREDICTED: dnaJ homolog subfamily A member 2...    133   2e-32    
ref|XP_003967491.1|  PREDICTED: dnaJ homolog subfamily A member 4...    132   2e-32    
ref|XP_004069682.1|  PREDICTED: dnaJ homolog subfamily A member 4       132   2e-32    
ref|XP_009563255.1|  PREDICTED: dnaJ homolog subfamily A member 1...    132   2e-32    
ref|XP_003757275.1|  PREDICTED: dnaJ homolog subfamily A member 2       133   3e-32    
ref|XP_004263277.1|  PREDICTED: dnaJ homolog subfamily A member 1...    129   3e-32    
ref|XP_003222964.1|  PREDICTED: dnaJ homolog subfamily A member 2       132   3e-32    
ref|XP_001363277.1|  PREDICTED: dnaJ homolog subfamily A member 2       132   3e-32    
gb|AES12470.1|  heat shock protein 40                                   132   3e-32    
ref|XP_004391436.1|  PREDICTED: LOW QUALITY PROTEIN: DnaJ (Hsp40)...    132   3e-32    
ref|XP_007230450.1|  PREDICTED: dnaJ homolog subfamily A member 2       132   3e-32    
gb|EFA74718.1|  heat shock protein                                      132   3e-32    
gb|ACQ58930.1|  DnaJ homolog subfamily A member 4                       132   3e-32    
gb|EPY82751.1|  dnaJ subfamily A member 1-like isoform 1-like pro...    131   4e-32    
gb|KFU89463.1|  DnaJ subfamily A member 2                               132   4e-32    
ref|XP_004889812.1|  PREDICTED: dnaJ homolog subfamily A member 2       132   4e-32    
ref|NP_001271642.1|  uncharacterized protein LOC101925800               131   4e-32    
ref|XP_003362783.1|  PREDICTED: dnaJ homolog subfamily A member 1...    131   4e-32    
ref|XP_008275021.1|  PREDICTED: dnaJ homolog subfamily A member 4...    132   4e-32    
ref|XP_004004198.1|  PREDICTED: dnaJ homolog subfamily A member 1       132   4e-32    
ref|XP_001511550.1|  PREDICTED: dnaJ homolog subfamily A member 4       132   4e-32    
ref|XP_005289904.1|  PREDICTED: dnaJ homolog subfamily A member 2       132   4e-32    
ref|XP_008297938.1|  PREDICTED: dnaJ homolog subfamily A member 2...    132   4e-32    
ref|NP_998658.1|  dnaJ homolog subfamily A member 2                     132   4e-32    
ref|XP_004371689.1|  PREDICTED: dnaJ homolog subfamily A member 2       132   4e-32    
ref|XP_006143292.1|  PREDICTED: dnaJ homolog subfamily A member 1       131   5e-32    
ref|XP_005802065.1|  PREDICTED: dnaJ homolog subfamily A member 2...    132   5e-32    
gb|EAW58527.1|  DnaJ (Hsp40) homolog, subfamily A, member 1, isof...    131   5e-32    
ref|XP_010164429.1|  PREDICTED: dnaJ homolog subfamily A member 1...    130   5e-32    
ref|XP_005233897.1|  PREDICTED: dnaJ homolog subfamily A member 2       130   5e-32    
ref|XP_005444666.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    130   5e-32    
ref|XP_009695370.1|  PREDICTED: dnaJ homolog subfamily A member 2       130   5e-32    
ref|XP_009939420.1|  PREDICTED: dnaJ homolog subfamily A member 2       130   5e-32    
ref|XP_010013041.1|  PREDICTED: dnaJ homolog subfamily A member 2       130   5e-32    
ref|XP_009461777.1|  PREDICTED: dnaJ homolog subfamily A member 2       130   6e-32    
ref|XP_010202745.1|  PREDICTED: dnaJ homolog subfamily A member 2       130   6e-32    
gb|KFO91050.1|  DnaJ subfamily A member 2                               131   6e-32    
ref|XP_002165748.2|  PREDICTED: dnaJ homolog subfamily A member 2...    127   6e-32    
ref|XP_007545750.1|  PREDICTED: dnaJ homolog subfamily A member 2...    131   6e-32    
ref|XP_009808292.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    130   6e-32    



>gb|AFR66645.1| MIP1.1a [Nicotiana benthamiana]
Length=420

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 166/171 (97%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TI+GDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  251  TISGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFPETL+P+QCK LEAVLPP+P T++T
Sbjct  311  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPETLSPEQCKNLEAVLPPKPKTQMT  370

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y+EDEDMHGGAQRVQCAQQ
Sbjct  371  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDEDMHGGAQRVQCAQQ  420



>gb|AGY48883.1| MIP1.1b [Nicotiana benthamiana]
Length=418

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 165/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  249  TITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPETL+ +QCK LEAVLPP+P T++T
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPETLSLEQCKNLEAVLPPKPKTQMT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y+EDEDMHGGAQRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDEDMHGGAQRVQCAQQ  418



>ref|XP_009588725.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009588726.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 165/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  251  TITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPETL+ +QCK LEAVLPP+P T++T
Sbjct  311  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPETLSLEQCKNLEAVLPPKPKTQMT  370

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y+EDEDMHGGAQRVQCAQQ
Sbjct  371  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDEDMHGGAQRVQCAQQ  420



>ref|XP_009760224.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009760225.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=420

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 164/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  251  TITGDIVFILQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPETL+ +QCK LEAVLPP+P T++T
Sbjct  311  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPETLSLEQCKNLEAVLPPKPKTQMT  370

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y EDEDMHGGAQRVQCAQQ
Sbjct  371  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYNEDEDMHGGAQRVQCAQQ  420



>ref|XP_007010484.1| DNAJ [Theobroma cacao]
 gb|EOY19294.1| DNAJ [Theobroma cacao]
Length=417

 Score =   322 bits (825),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L PDQCKALEAVLPPR + ++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLIPDQCKALEAVLPPRTSVQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEDMHGGAQRVQCAQQ  417



>ref|XP_011032891.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011032892.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=420

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+FVEHTL+LTEALCGF FVLTHLD RQLLIKSQPGE
Sbjct  250  TVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALCGFHFVLTHLDGRQLLIKSQPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFP++L+ DQCKALEA LPPR + ++T
Sbjct  310  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDSLSADQCKALEAALPPRASVQLT  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED+DMHGGAQRVQCAQQ
Sbjct  370  DMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDDMHGGAQRVQCAQQ  420



>dbj|BAC53943.1| DnaJ homolog [Nicotiana tabacum]
Length=339

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRK DD+FVEHTL+LTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  170  TITGDIVFILQQKEHPKFKRKEDDLFVEHTLSLTEALCGFQFILTHLDNRQLLIKSQPGE  229

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPETL+ +QCK LEAVLPP+P T++T
Sbjct  230  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPETLSLEQCKNLEAVLPPKPKTQMT  289

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y EDEDMHGGAQRVQCAQQ
Sbjct  290  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYNEDEDMHGGAQRVQCAQQ  339



>gb|AAG24642.1|AF308737_1 J1P [Daucus carota]
 gb|AAG24643.1|AF308738_1 J2P [Daucus carota]
Length=418

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEH+LTL+EALCGFQF LTHLD RQLLIKSQPGE
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHSLTLSEALCGFQFTLTHLDGRQLLIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFK INDEGMPMYQ+PFMRGKLYIHF+VDFPE+LTP+QCKALEAVLPPRP+ ++T
Sbjct  309  VIKPDQFKGINDEGMPMYQRPFMRGKLYIHFSVDFPESLTPEQCKALEAVLPPRPSIQMT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+EDEDMHGGAQRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDEDMHGGAQRVQCAQQ  418



>ref|XP_010319287.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum lycopersicum]
Length=337

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLDNRQL+IKSQPGE
Sbjct  166  TVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLIIKSQPGE  225

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTVDFP TLTP+ CK LEAVLP RP T+ +
Sbjct  226  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNTLTPELCKNLEAVLPARPKTQAS  285

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y E+D+DMHGGAQRVQCAQQ
Sbjct  286  DMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHGGAQRVQCAQQ  337



>ref|XP_006365673.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
Length=412

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE
Sbjct  243  TITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  302

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGK+YIHFTVDFPE+LTP+QCK LEAVLPPRP  +++
Sbjct  303  VVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPESLTPEQCKNLEAVLPPRPKLQVS  362

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIE+EMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  363  DMELDECEETTLHDVNIEDEMRRK-QQAAQEAYDEDDDMPGGAQRVQCAQQ  412



>ref|XP_006365672.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
Length=419

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE
Sbjct  250  TITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGK+YIHFTVDFPE+LTP+QCK LEAVLPPRP  +++
Sbjct  310  VVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPESLTPEQCKNLEAVLPPRPKLQVS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIE+EMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  370  DMELDECEETTLHDVNIEDEMRRK-QQAAQEAYDEDDDMPGGAQRVQCAQQ  419



>gb|KHG16063.1| DnaJ protein [Gossypium arboreum]
Length=299

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLD RQLLIK+ PGE
Sbjct  129  TVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDGRQLLIKTHPGE  188

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQ KAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L P+QCKALEAVLP R + ++T
Sbjct  189  VVKPDQCKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLAPEQCKALEAVLPSRASVQLT  248

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTLYDVNIEEEMRRKQ Q AQE YEED+DMHGGAQRVQCAQQ
Sbjct  249  DMELDECEETTLYDVNIEEEMRRKQAQAAQEAYEEDDDMHGGAQRVQCAQQ  299



>gb|KJB84159.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84160.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84161.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84162.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84166.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+FVEHTL LTEALCGFQF+LTHLD RQLLIK+QPGE
Sbjct  248  TVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDGRQLLIKTQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFMRGKL+IHFTVDFP++LTPDQCKALEAVLPP+ + ++T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMRGKLFIHFTVDFPDSLTPDQCKALEAVLPPKASVQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETT++DVNIEEEMRRKQ Q  QE YEEDEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTMHDVNIEEEMRRKQAQAQQEAYEEDEDMHGGAQRVQCAQQ  418



>gb|AAN87055.1| tuber-induction protein [Solanum tuberosum]
Length=315

 Score =   313 bits (802),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 164/172 (95%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLDNRQL+IK Q GE
Sbjct  145  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLIIKPQAGE  204

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+TL+P+QCK LEAVLPP+P T++T
Sbjct  205  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMT  264

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DEDMHGGAQRVQCAQQ
Sbjct  265  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDEDMHGGAQRVQCAQQ  315



>dbj|BAA35121.1| DnaJ homolog [Salix gilgiana]
Length=420

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKSQPGE
Sbjct  250  TVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSQPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+V+FP++L+PD CKALEAVLPPR + ++T
Sbjct  310  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVEFPDSLSPDMCKALEAVLPPRASVQLT  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y+ED++M GGAQRVQCAQQ
Sbjct  370  DMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDEMPGGAQRVQCAQQ  420



>ref|XP_009397426.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=416

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 164/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+F EH L+LTEALCGF+FVLTHLDNRQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKDHPKFKRKGDDLFYEHALSLTEALCGFRFVLTHLDNRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP+++TP+QCKALE+VLPP+PA+++T
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSMTPEQCKALESVLPPKPASQMT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEED+DMHGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDDDMHGGAQRVQCAQQ  416



>ref|XP_004236804.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum lycopersicum]
Length=418

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLDNRQL+IKSQPGE
Sbjct  247  TVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLIIKSQPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTVDFP TLTP+ CK LEAVLP RP T+ +
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNTLTPELCKNLEAVLPARPKTQAS  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y E+D+DMHGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHGGAQRVQCAQQ  418



>ref|XP_002310999.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE88366.1| DnaJ family protein [Populus trichocarpa]
Length=420

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+FVEHTL+LTEALCGF FVLTHLD RQLLIKSQPGE
Sbjct  250  TVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALCGFHFVLTHLDGRQLLIKSQPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFP++L+ DQCKALEAVLPPR + ++T
Sbjct  310  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDSLSTDQCKALEAVLPPRASVQLT  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED++M GGAQRVQCAQQ
Sbjct  370  DMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDEMPGGAQRVQCAQQ  420



>gb|AGY48885.1| MIP1.3 [Nicotiana benthamiana]
Length=418

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  249  TITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDNRQLLIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+LTP+QCK LEAVLPP+P  +++
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTPEQCKNLEAVLPPKPKMEVS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +MELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  369  EMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMPGGAQRVQCAQQ  418



>ref|XP_009793842.1| PREDICTED: dnaJ protein homolog isoform X2 [Nicotiana sylvestris]
Length=412

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  243  TITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDNRQLLIKSQPGE  302

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+LTP+QCK LEAVLPP+P  +++
Sbjct  303  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTPEQCKNLEAVLPPKPKMEVS  362

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +MELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  363  EMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMPGGAQRVQCAQQ  412



>gb|KJB60379.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60380.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60381.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60382.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60383.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
Length=418

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRK DD+FVEHTLTLTEALCGFQF+LTHLD RQLLIK+ PGE
Sbjct  248  TVTGDIVFVLQQKDHPKFKRKSDDLFVEHTLTLTEALCGFQFILTHLDGRQLLIKTHPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGM MYQ+PFMRGKLYIHFTVDFP++L P+QCKALEAVLPPR + ++T
Sbjct  308  VVKPDQFKAINDEGMAMYQRPFMRGKLYIHFTVDFPDSLAPEQCKALEAVLPPRTSVQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTLYDVNIEEEMRRKQ Q AQE YEED+DMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLYDVNIEEEMRRKQAQAAQEAYEEDDDMHGGAQRVQCAQQ  418



>gb|KDO48714.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=335

 Score =   313 bits (802),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFV+THLD RQLLIKSQPGE
Sbjct  166  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGE  225

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+L+PDQCK LE VLPPR + ++T
Sbjct  226  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLT  285

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  286  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMQGGAQRVQCAQQ  335



>gb|KDO48709.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=381

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFV+THLD RQLLIKSQPGE
Sbjct  212  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGE  271

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+L+PDQCK LE VLPPR + ++T
Sbjct  272  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLT  331

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  332  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMQGGAQRVQCAQQ  381



>ref|XP_010907714.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=415

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  246  TVTGDIVFVLQQKDHPKFKRKGDDLFFEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++LT +QCKALEAVLPP+P +++T
Sbjct  306  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLTLEQCKALEAVLPPKPVSQLT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED+HGGAQRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEDVHGGAQRVQCAQQ  415



>gb|KHG01500.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
 gb|KHG06497.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=318

 Score =   312 bits (799),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+FVEHTL LTEALCGFQF+LTHLD RQLLIK+QPGE
Sbjct  148  TVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDGRQLLIKTQPGE  207

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFMRGKLYI FTVDFP++LTPDQCKALEAVLPP+ + ++T
Sbjct  208  VVKPDQFKAINDEGMPIYQRPFMRGKLYIQFTVDFPDSLTPDQCKALEAVLPPKASVQLT  267

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEE MRRKQ Q  QE Y+EDEDMHGGAQRVQCAQQ
Sbjct  268  DMELDECEETTLHDVNIEEVMRRKQTQAQQEAYDEDEDMHGGAQRVQCAQQ  318



>ref|XP_009793841.1| PREDICTED: dnaJ protein homolog isoform X1 [Nicotiana sylvestris]
Length=418

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  249  TITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDNRQLLIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+LTP+QCK LEAVLPP+P  +++
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTPEQCKNLEAVLPPKPKMEVS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +MELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  369  EMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMPGGAQRVQCAQQ  418



>ref|XP_006345881.1| PREDICTED: dnaJ protein homolog [Solanum tuberosum]
 gb|ABB16989.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 165/172 (96%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLDNRQL+IK QPGE
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLIIKPQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+TL+P+QCK LEAVLPP+P T++T
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DEDMHGGAQRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDEDMHGGAQRVQCAQQ  419



>sp|P42824.1|DNJH2_ALLPO RecName: Full=DnaJ protein homolog 2; Flags: Precursor [Allium 
ampeloprasum]
 emb|CAA54720.1| LDJ2 [Allium ampeloprasum]
Length=418

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+F EH+L+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDLFYEHSLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFK INDEGMPMYQ+PFMRGKLYIHF+VDFP++LTPDQCKALE+VLP R A+++T
Sbjct  308  VIKPDQFKGINDEGMPMYQRPFMRGKLYIHFSVDFPDSLTPDQCKALESVLPSRNASRLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DVNIEEEMRRKQ QQAQE Y+ED++ HGGAQRVQCAQQ
Sbjct  368  DMEIDECEETTMHDVNIEEEMRRKQHQQAQEAYDEDDEGHGGAQRVQCAQQ  418



>gb|KDO48708.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=383

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFV+THLD RQLLIKSQPGE
Sbjct  214  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGE  273

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+L+PDQCK LE VLPPR + ++T
Sbjct  274  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLT  333

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  334  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMQGGAQRVQCAQQ  383



>ref|XP_010263053.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=417

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDDIF EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKGDDIFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTV+FP++LT +QCKALEAVLPPR + ++T
Sbjct  308  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVEFPDSLTMEQCKALEAVLPPRTSQQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED HGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEDAHGGAQRVQCAQQ  417



>gb|KDO48707.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=382

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFV+THLD RQLLIKSQPGE
Sbjct  213  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGE  272

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+L+PDQCK LE VLPPR + ++T
Sbjct  273  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLT  332

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  333  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMQGGAQRVQCAQQ  382



>ref|XP_009600920.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009600921.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=417

 Score =   314 bits (805),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLDNRQLLIKSQPGE
Sbjct  248  TITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDNRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+LTP+QCK LEAVLPP+P  +++
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTPEQCKNLEAVLPPKPKMEVS  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +MELDECEETTL+DVNIEEEMRRK QQ AQE Y++D+DM GGAQRVQCAQQ
Sbjct  368  EMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDDDDDMPGGAQRVQCAQQ  417



>gb|KDO48711.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48712.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48713.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=402

 Score =   314 bits (804),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFV+THLD RQLLIKSQPGE
Sbjct  233  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGE  292

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+L+PDQCK LE VLPPR + ++T
Sbjct  293  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLT  352

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  353  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMQGGAQRVQCAQQ  402



>ref|XP_011024143.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011024144.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=422

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L EALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  251  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALCGFQFILTHLDGRQLLIKSQPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L+ DQCKALE +LPPR + ++T
Sbjct  311  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLSLDQCKALETMLPPRTSAELT  370

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED+DMH GG QRVQCAQQ
Sbjct  371  DMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDDMHSGGGQRVQCAQQ  422



>ref|XP_006485485.1| PREDICTED: dnaJ protein homolog [Citrus sinensis]
Length=416

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFV+THLD RQLLIKSQPGE
Sbjct  247  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+L+PDQCK LE VLPPR + ++T
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMQGGAQRVQCAQQ  416



>ref|XP_004249937.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE
Sbjct  250  TITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGK+YIHFTVDFPE+LT +QCK LEAVLPP+P  +++
Sbjct  310  VVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPESLTAEQCKNLEAVLPPKPKLQVS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIE+EMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  370  DMELDECEETTLHDVNIEDEMRRK-QQAAQEAYDEDDDMPGGAQRVQCAQQ  419



>ref|XP_006445792.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
 gb|ESR59032.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
Length=416

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFV+THLD RQLLIKSQPGE
Sbjct  247  TVTGDIVFVLQQKEHLKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+L+PDQCK LE VLPPR + ++T
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMQGGAQRVQCAQQ  416



>gb|KDO48710.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=401

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFV+THLD RQLLIKSQPGE
Sbjct  232  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGE  291

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+L+PDQCK LE VLPPR + ++T
Sbjct  292  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLT  351

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+DM GGAQRVQCAQQ
Sbjct  352  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDDMQGGAQRVQCAQQ  401



>ref|XP_009623415.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009623416.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 163/174 (94%), Gaps = 3/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLD+RQLLIKSQPGE
Sbjct  247  TITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDSRQLLIKSQPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFK INDEGMPMYQ+PFMRGKLYIHFTVDFPETL P+ CK LEAVLPPRP T+ +
Sbjct  307  VVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPETLAPELCKNLEAVLPPRPKTQAS  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEE---DEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRK+QQQAQE YEE   D+DMHGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDDDDDMHGGAQRVQCAQQ  420



>ref|XP_002316479.1| DnaJ family protein [Populus trichocarpa]
 gb|ABK95315.1| unknown [Populus trichocarpa]
 gb|EEF02650.1| DnaJ family protein [Populus trichocarpa]
Length=422

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L EALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  251  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALCGFQFILTHLDGRQLLIKSQPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L+ DQCKALE VLPPR + ++T
Sbjct  311  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLSLDQCKALETVLPPRTSAELT  370

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED++MH GG QRVQCAQQ
Sbjct  371  DMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDEMHGGGGQRVQCAQQ  422



>ref|XP_004306421.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=410

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+F EHTL+L EALCGFQFVLTHLD+RQLLIKS PGE
Sbjct  240  TVTGDIVFVLQQKEHPKFKRKGDDLFYEHTLSLMEALCGFQFVLTHLDSRQLLIKSHPGE  299

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+ FM+GKLYIHFTV+FP++L P+QCK LEAVLPPR +T++T
Sbjct  300  VVKPDQFKAINDEGMPMYQRAFMKGKLYIHFTVEFPDSLNPEQCKTLEAVLPPRSSTQLT  359

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQ QQ+QE Y+EDEDMHGGAQRVQCAQQ
Sbjct  360  DMELDECEETTLHDVNIEEEMRRKQGQQSQEAYDEDEDMHGGAQRVQCAQQ  410



>gb|KCW50581.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=296

 Score =   308 bits (790),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH K+KRKGDD+F EHTL+LTE+LCGFQF L+HLD RQLLIKSQPGE
Sbjct  127  TVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLCGFQFALSHLDGRQLLIKSQPGE  186

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFKAINDEGMP+Y +PFM+GKLYIHFTV+FP+TL+P+QCKALE +LPPR + ++T
Sbjct  187  VIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDTLSPEQCKALETILPPRSSAQLT  246

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDEDMHGGAQRVQCAQQ
Sbjct  247  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEDMHGGAQRVQCAQQ  296



>emb|CAA63965.1| DnaJ protein [Solanum tuberosum]
Length=419

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 164/172 (95%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLDNRQL+IK Q GE
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLIIKPQAGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+TL+P+QCK LEAVLPP+P T++T
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DEDMHGGAQRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDEDMHGGAQRVQCAQQ  419



>ref|XP_010263054.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=416

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  247  TITGDIVFVLQQKEHPKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSSPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP++LT +QCKALEAVLPPR + ++T
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDSLTMEQCKALEAVLPPRTSQQLT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED+HGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEDVHGGAQRVQCAQQ  416



>ref|XP_008787761.1| PREDICTED: dnaJ protein homolog [Phoenix dactylifera]
Length=415

 Score =   312 bits (799),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+F E TL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  246  TVTGDIVFVLQQKDHPKFKRKGDDLFYESTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            +VKPDQFKAINDEGMP+YQ+PFMRGKLYIHFTVDFP++L P+QCKALEAVLPPRP +++T
Sbjct  306  IVKPDQFKAINDEGMPIYQRPFMRGKLYIHFTVDFPDSLAPEQCKALEAVLPPRPVSQMT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDE+ HGGAQRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEEAHGGAQRVQCAQQ  415



>ref|XP_010694477.1| PREDICTED: dnaJ protein homolog [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   312 bits (799),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQKEH+K+KRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKSQPGE
Sbjct  249  TVTGDIVFILQQKEHSKYKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L  DQCK+LEAVLPPR A ++T
Sbjct  309  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAVDQCKSLEAVLPPRSAAQLT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK+ +  QE Y+EDEDMHGGAQRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNIEEEMRRKEARAQQEAYDEDEDMHGGAQRVQCAQQ  419



>ref|XP_009418972.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQ K+H+KFKRKGDD+F EHTL+L+EALCGFQ+VLTHLDNRQLLIKS PGE
Sbjct  247  TVTGDIVFVLQLKDHSKFKRKGDDLFFEHTLSLSEALCGFQYVLTHLDNRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+LT DQCKALE VLPPR AT++T
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTLDQCKALETVLPPRLATQMT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEED+D+HGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDDDVHGGAQRVQCAQQ  416



>ref|XP_009418971.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQ K+H+KFKRKGDD+F EHTL+L+EALCGFQ+VLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVLQLKDHSKFKRKGDDLFFEHTLSLSEALCGFQYVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+LT DQCKALE VLPPR AT++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLTLDQCKALETVLPPRLATQMT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEED+D+HGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDDDVHGGAQRVQCAQQ  417



>gb|KDP22008.1| hypothetical protein JCGZ_03128 [Jatropha curcas]
Length=326

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+ V+HTL+LTEALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  157  TITGDIVFVLQQKEHPKFKRKGDDLIVDHTLSLTEALCGFQFILTHLDGRQLLIKSQPGE  216

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L PDQCKALEAVLP R + +++
Sbjct  217  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLPPDQCKALEAVLPSRSSVQLS  276

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN EEEMRRK QQ A E Y+EDEDMHGG+QRVQCAQQ
Sbjct  277  DMELDECEETTLHDVNFEEEMRRK-QQHAAEAYDEDEDMHGGSQRVQCAQQ  326



>ref|XP_006367021.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum tuberosum]
Length=338

 Score =   309 bits (791),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLDNRQL+IKSQPGE
Sbjct  166  TVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLIIKSQPGE  225

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTVDFP  LTP+ CK LEAVLP RP T+ +
Sbjct  226  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNILTPELCKNLEAVLPARPKTQAS  285

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMH-GGAQRVQCAQQ  242
            DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y E+D+DMH GGAQRVQCAQQ
Sbjct  286  DMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHGGGAQRVQCAQQ  338



>ref|XP_006378828.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
 gb|ERP56625.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
Length=459

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L EALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  288  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALCGFQFILTHLDGRQLLIKSQPGE  347

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L+ DQCKALE VLPPR + ++T
Sbjct  348  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLSLDQCKALETVLPPRTSAELT  407

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED++MH GG QRVQCAQQ
Sbjct  408  DMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDEMHGGGGQRVQCAQQ  459



>ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|ABH06547.1| molecular chaperone [Ricinus communis]
 gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+ VEHTL+LTEALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  249  TITGDIVFVLQQKEHPKFKRKGDDLVVEHTLSLTEALCGFQFILTHLDGRQLLIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFP++L PDQCKALE VLP R + +++
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDSLPPDQCKALETVLPSRTSVQLS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN EEEMRRK QQQAQE Y+EDEDMHGGAQRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNFEEEMRRK-QQQAQEAYDEDEDMHGGAQRVQCAQQ  418



>ref|XP_011084248.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
 ref|XP_011084249.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=418

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKE+ KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLDNRQLLIKS+PGE
Sbjct  249  TVTGDIVFVLQQKEYPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDNRQLLIKSEPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFKAINDEGMPMYQ+ FM+GKLYI FTVDFPE+L+PDQ KALE VLPPRP T++T
Sbjct  309  VIKPDQFKAINDEGMPMYQRSFMKGKLYIQFTVDFPESLSPDQSKALEGVLPPRPTTRLT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRK QQ AQE YEED+DMHGG QRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNMEEEMRRK-QQHAQEAYEEDDDMHGGPQRVQCAQQ  418



>ref|XP_010907982.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKDHPKFKRKGDDLFFEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGM +YQ+PFMRGKLYIHF VDFP++LTPDQCKA+EAVLPP+P +++T
Sbjct  308  VVKPDQFKAINDEGMTLYQRPFMRGKLYIHFAVDFPDSLTPDQCKAIEAVLPPKPVSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIEEEMRRK Q QAQE YEEDE+ HGGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEEAHGGAQRVQCAQQ  417



>ref|XP_004239737.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 164/172 (95%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLD RQL+IKSQPGE
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDTRQLIIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+TL+ +QCK LEAVLPP+P T++T
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDTLSLEQCKNLEAVLPPKPKTQMT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DEDMHGGAQRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDEDMHGGAQRVQCAQQ  419



>ref|XP_010090486.1| DnaJ-like protein [Morus notabilis]
 gb|EXB39585.1| DnaJ-like protein [Morus notabilis]
Length=417

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDDIF EHTL+LTEALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDIFYEHTLSLTEALCGFQFILTHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L+P+QCKALE VLPPR   ++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLSPEQCKALETVLPPRSGQQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIEEEMRRK Q QAQE Y+ED+DMHGGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEEEMRRK-QAQAQEAYDEDDDMHGGAQRVQCAQQ  417



>emb|CAN82708.1| hypothetical protein VITISV_000291 [Vitis vinifera]
Length=407

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 160/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  239  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDGRQLLIKSHPGE  298

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQKPFM+GKLYIHF VDFP++L  DQCKALEAVLPPR +T++T
Sbjct  299  VVKPDQFKAINDEGMPIYQKPFMKGKLYIHFAVDFPDSLNTDQCKALEAVLPPRTSTQLT  358

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIEEEMRRK  Q AQE YEEDED+HGGAQRVQCAQQ
Sbjct  359  DMEIDECEETTLHDVNIEEEMRRK--QAAQEAYEEDEDIHGGAQRVQCAQQ  407



>ref|XP_009398344.1| PREDICTED: dnaJ protein homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 163/172 (95%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDIVFVLQQK+H K+KRKGDDIF EHTL+LTEALCGFQFVLTHLDNRQLLIK  PGE
Sbjct  248  TATGDIVFVLQQKDHPKYKRKGDDIFYEHTLSLTEALCGFQFVLTHLDNRQLLIKLNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++LTPDQCKALEAVLPP+PA+++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLTPDQCKALEAVLPPKPASQMT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEE-DEDMHGGAQRVQCAQQ  242
            DMELDECEETT++DVN+EEEMRRK Q QAQE YEE D+D+HGGAQRVQCAQQ
Sbjct  368  DMELDECEETTVHDVNMEEEMRRK-QAQAQEAYEEDDDDVHGGAQRVQCAQQ  418



>ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 ref|XP_010658892.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 emb|CBI24994.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 160/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDGRQLLIKSHPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQKPFM+GKLYIHF VDFP++L  DQCKALEAVLPPR +T++T
Sbjct  308  VVKPDQFKAINDEGMPIYQKPFMKGKLYIHFAVDFPDSLNTDQCKALEAVLPPRTSTQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIEEEMRRK  Q AQE YEEDED+HGGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEEEMRRK--QAAQEAYEEDEDIHGGAQRVQCAQQ  416



>gb|ABX57881.1| DnaJ [Viola baoshanensis]
Length=417

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIV VLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF L HLDNRQLLIKSQPGE
Sbjct  248  TVTGDIVSVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFALAHLDNRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFMRGKLYIHFTV+FP++LTPDQ +A+EAVLP RP+ ++T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMRGKLYIHFTVEFPDSLTPDQSRAIEAVLPARPSPQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK QQQAQE Y+EDEDMHGGAQRVQCAQQ
Sbjct  368  DMEVDECEETTLHDVNIEDEMRRK-QQQAQEAYDEDEDMHGGAQRVQCAQQ  417



>ref|XP_006367020.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
Length=419

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLDNRQL+IKSQPGE
Sbjct  247  TVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLIIKSQPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTVDFP  LTP+ CK LEAVLP RP T+ +
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNILTPELCKNLEAVLPARPKTQAS  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMH-GGAQRVQCAQQ  242
            DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y E+D+DMH GGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDDDMHGGGAQRVQCAQQ  419



>ref|XP_004982304.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   309 bits (792),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDIVFVLQQK+H+KFKRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TTTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLPP+P +K+T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPPKPTSKLT  367

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DV NIEEEMRRKQ   AQE YEED+DM GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDDMPGGAQRVQCAQQ  419



>gb|KHG17902.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=417

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKG+D+F+EHTL+LTEALCGFQFV+THLD RQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALCGFQFVITHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD  KAINDEGMP+YQ+PFM+GKLYI FTV+FP++L+PDQ KALEA+LPP+P ++++
Sbjct  307  VVKPDSCKAINDEGMPLYQRPFMKGKLYIQFTVEFPDSLSPDQVKALEAILPPKPTSQLS  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTLYDVNIEEEMRRKQQQ AQE YEEDEDMHGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLYDVNIEEEMRRKQQQAAQEAYEEDEDMHGGAQRVQCAQQ  417



>gb|KJB35426.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=417

 Score =   309 bits (792),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKG+D+F+EHTL+LTEALCGFQFV+THLD RQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALCGFQFVITHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD  KAINDEGMP+YQ+PFM+GKLYI FTV+FP++L+PDQ KALEA+LPP+P ++++
Sbjct  307  VVKPDSCKAINDEGMPLYQRPFMKGKLYIQFTVEFPDSLSPDQVKALEAILPPKPTSQLS  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTLYDVNIEEEMRRKQQQ AQE YEEDEDMHGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLYDVNIEEEMRRKQQQAAQEAYEEDEDMHGGAQRVQCAQQ  417



>ref|XP_007211787.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
 gb|EMJ12986.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
Length=417

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+F EHTL+L EALCGF FVLTHLD RQLLIKSQPGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVEALCGFHFVLTHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCK LEAVLPPR + ++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPEQCKGLEAVLPPRSSAQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE Y+ED+DMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYDEDDDMHGGAQRVQCAQQ  417



>gb|ABB16980.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 162/172 (94%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEH L+LTE LCGFQF+LTHLDNRQL+IK QPGE
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHXLSLTEXLCGFQFILTHLDNRQLIIKPQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+TL+P+QCK LEAVLPP+P T++T
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DV IEEEMRRK QQQAQE Y E+DEDMHGGAQRVQCAQQ
Sbjct  369  DMELDECEETTLHDVXIEEEMRRK-QQQAQEAYDEDDEDMHGGAQRVQCAQQ  419



>gb|AFW68139.1| putative dnaJ chaperone family protein [Zea mays]
Length=338

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  167  TVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  226

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++L P+QCKALE+VLPP+P++K+T
Sbjct  227  VVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALESVLPPKPSSKLT  286

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DV NIEEEMRRKQ   AQE YEED++M GGAQRVQCAQQ
Sbjct  287  DMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPGGAQRVQCAQQ  338



>ref|XP_008231805.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=417

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+F EHTL+L E+LCGF FVLTHLD RQLLIKSQPGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLCGFHFVLTHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCK LEAVLPPR + ++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPEQCKGLEAVLPPRSSAQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE Y+ED+DMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYDEDDDMHGGAQRVQCAQQ  417



>gb|ABI83623.1| DnaJ-like protein [Setaria italica]
Length=419

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGD VFVLQQK+H+KFKRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TTTGDTVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLPP+P +K+T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPPKPTSKLT  367

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DV NIEEEMRRKQ   AQE YEED+DM GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDDMPGGAQRVQCAQQ  419



>ref|XP_009766164.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
 ref|XP_009766166.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
Length=419

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+F EHTLTLTEALCGFQFVLTHLD+RQLLIKSQPGE
Sbjct  247  TITGDIVFILQQKEHPKFKRKGDDLFAEHTLTLTEALCGFQFVLTHLDSRQLLIKSQPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFK INDEGMPMYQ+PFMRGKLYIHFTVDFP+TL P+ CK LEAVLPPRP T+ +
Sbjct  307  VVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPDTLAPELCKNLEAVLPPRPKTQAS  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY--EEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRK+QQQAQE Y  ++D+DMHGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDDDDMHGGAQRVQCAQQ  419



>ref|XP_008375557.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+F EHTL+L E+LCGFQF+LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLMESLCGFQFILTHLDGRQLLIKSHPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLPPR + ++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPEQCKALEAVLPPRTSAQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q  AQE Y+EDEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAHAQEAYDEDEDMHGGAQRVQCAQQ  417



>gb|KCW50580.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=373

 Score =   305 bits (781),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH K+KRKGDD+F EHTL+LTE+LCGFQF L+HLD RQLLIKSQPGE
Sbjct  204  TVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLCGFQFALSHLDGRQLLIKSQPGE  263

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFKAINDEGMP+Y +PFM+GKLYIHFTV+FP+TL+P+QCKALE +LPPR + ++T
Sbjct  264  VIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDTLSPEQCKALETILPPRSSAQLT  323

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDEDMHGGAQRVQCAQQ
Sbjct  324  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEDMHGGAQRVQCAQQ  373



>ref|XP_010031320.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 ref|XP_010031321.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50579.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=417

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH K+KRKGDD+F EHTL+LTE+LCGFQF L+HLD RQLLIKSQPGE
Sbjct  248  TVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLCGFQFALSHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFKAINDEGMP+Y +PFM+GKLYIHFTV+FP+TL+P+QCKALE +LPPR + ++T
Sbjct  308  VIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDTLSPEQCKALETILPPRSSAQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEDMHGGAQRVQCAQQ  417



>ref|XP_008345828.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+F EHTL+L E+LCGFQFVLTHLD RQLLIKSQPGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLCGFQFVLTHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLPP+ + ++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPEQCKALEAVLPPKTSAQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q  A E Y++DEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAHAHEAYDDDEDMHGGAQRVQCAQQ  417



>ref|NP_001146715.1| uncharacterized protein LOC100280317 [Zea mays]
 gb|ACL54611.1| unknown [Zea mays]
Length=419

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++L P+QCKALE+VLPP+P++K+T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALESVLPPKPSSKLT  367

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DV NIEEEMRRKQ   AQE YEED++M GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPGGAQRVQCAQQ  419



>gb|AFW68140.1| putative dnaJ chaperone family protein isoform 1 [Zea mays]
 gb|AFW68141.1| putative dnaJ chaperone family protein isoform 2 [Zea mays]
Length=419

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++L P+QCKALE+VLPP+P++K+T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALESVLPPKPSSKLT  367

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DV NIEEEMRRKQ   AQE YEED++M GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPGGAQRVQCAQQ  419



>ref|NP_001130317.1| chaperone DNA J2 [Zea mays]
 gb|AAC08009.1| DnaJ-related protein ZMDJ1 [Zea mays]
 gb|ACF78499.1| unknown [Zea mays]
 gb|ACG32917.1| dnaJ protein [Zea mays]
 gb|ACL53813.1| unknown [Zea mays]
 gb|ACN34490.1| unknown [Zea mays]
 gb|ACR38444.1| unknown [Zea mays]
 tpg|DAA50285.1| TPA: chaperone DNA J2 [Zea mays]
Length=419

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSDPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++L P+QCKALE VLPPRP++K+T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALETVLPPRPSSKLT  367

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DV NIEEEMRRKQ   AQE YEED++M GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPGGAQRVQCAQQ  419



>gb|AGY48884.1| MIP1.2 [Nicotiana benthamiana]
Length=419

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLD+RQLLIKSQPGE
Sbjct  247  TITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDSRQLLIKSQPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFK INDEGMPMYQ+PFMRGKLYIHFTVDFP+T  P+ CK LEAVLPPRP T+ +
Sbjct  307  VVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPDTFAPEMCKNLEAVLPPRPKTQAS  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY--EEDEDMHGGAQRVQCAQQ  242
            +MELDECEETTL+DVN+EEEMRRK+QQQAQE Y  ++++DMHGGAQRV+CAQQ
Sbjct  367  NMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDEDDMHGGAQRVECAQQ  419



>ref|XP_009408521.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD++ EHTL+LTEALC FQFVLTHLDNRQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKDHPKFKRKGDDLYYEHTLSLTEALCSFQFVLTHLDNRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP+ LT DQCKALEA LPP+PA+++T
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDLLTLDQCKALEAALPPKPASQMT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTLYDVNIEEEMRRK Q QAQE YEE++D+ G AQR+QCAQQ
Sbjct  367  DMELDECEETTLYDVNIEEEMRRK-QAQAQEAYEEEDDVSGRAQRLQCAQQ  416



>ref|XP_010651845.1| PREDICTED: dnaJ protein homolog isoform X2 [Vitis vinifera]
Length=417

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFMRGKLYI F V+FP+TL+P+QCKALEAVLP R  T++T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDTLSPEQCKALEAVLPARATTQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDE+M GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEEMPGGAQRVQCAQQ  417



>ref|XP_002270362.1| PREDICTED: dnaJ protein homolog isoform X1 [Vitis vinifera]
 emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera]
Length=417

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFMRGKLYI F V+FP+TL+P+QCKALEAVLP R  T++T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDTLSPEQCKALEAVLPARATTQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDE+M GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEEMPGGAQRVQCAQQ  417



>ref|XP_004169945.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 sp|Q04960.1|DNJH_CUCSA RecName: Full=DnaJ protein homolog; AltName: Full=DNAJ-1; Flags: 
Precursor [Cucumis sativus]
 emb|CAA47925.1| cs DnaJ-1 [Cucumis sativus]
 gb|KGN52169.1| hypothetical protein Csa_5G613470 [Cucumis sativus]
Length=413

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 159/171 (93%), Gaps = 3/171 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L E+LCGFQF+LTHLD RQLLIKS PGE
Sbjct  246  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLVESLCGFQFILTHLDGRQLLIKSLPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++L P+QCKALE VLPPR + +++
Sbjct  306  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPEQCKALEGVLPPRTSVQLS  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK   QAQE Y+EDEDMHGGAQRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNIEEEMRRK---QAQEAYDEDEDMHGGAQRVQCAQQ  413



>ref|XP_002466747.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
 gb|EER93745.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
Length=419

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLPPR ++K+T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPPRSSSKLT  367

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DV NIEEEMRRKQ   AQE YEED++M GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDDEMPGGAQRVQCAQQ  419



>ref|XP_009408520.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD++ EHTL+LTEALC FQFVLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKDHPKFKRKGDDLYYEHTLSLTEALCSFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP+ LT DQCKALEA LPP+PA+++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDLLTLDQCKALEAALPPKPASQMT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTLYDVNIEEEMRRK Q QAQE YEE++D+ G AQR+QCAQQ
Sbjct  368  DMELDECEETTLYDVNIEEEMRRK-QAQAQEAYEEEDDVSGRAQRLQCAQQ  417



>ref|XP_004166311.1| PREDICTED: dnaJ protein homolog, partial [Cucumis sativus]
Length=311

 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 160/171 (94%), Gaps = 3/171 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQF LTHLD RQLLIK+ PGE
Sbjct  144  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFALTHLDGRQLLIKTNPGE  203

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMP+YQ+PFM+GKLYIHF+VDFP++L+P+Q KALEAVLP +P++++T
Sbjct  204  VVKPDSFKAINDEGMPVYQRPFMKGKLYIHFSVDFPDSLSPEQIKALEAVLPSKPSSQLT  263

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET+++DVNIEEEMRRKQQ +A   YEEDEDMHGGAQRVQCAQQ
Sbjct  264  DMELDECEETSMHDVNIEEEMRRKQQAEA---YEEDEDMHGGAQRVQCAQQ  311



>ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria italica]
Length=418

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTE+LCGFQFVLTHLDNRQLLIKS PGE
Sbjct  249  TVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLCGFQFVLTHLDNRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++L P+QCKALEAVLPP+P ++ T
Sbjct  309  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPEQCKALEAVLPPKPTSQYT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEE+RR+QQQ  QE Y+EDEDM GGAQRVQCAQQ
Sbjct  369  DMELDECEETMPYDVNIEEELRRRQQQH-QEAYDEDEDMPGGAQRVQCAQQ  418



>ref|XP_009341572.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=417

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+F EHTL+L E+LCGFQFVLTHLD RQLLIKSQPGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLCGFQFVLTHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+ FM+GKLYIHFTV+FP++L P+QCKALEAVLPP+ + ++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRSFMKGKLYIHFTVEFPDSLNPEQCKALEAVLPPKTSAQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q  A E Y++DEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRK-QAHAHEAYDDDEDMHGGAQRVQCAQQ  417



>ref|NP_001238341.1| seed maturation protein PM37 [Glycine max]
 gb|AAD51625.1|AF169022_1 seed maturation protein PM37 [Glycine max]
 gb|KHN21201.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALCGFQFVLTHLD+RQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKAEDLFVEHTLSLTEALCGFQFVLTHLDSRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L PDQ KALEAVLPP+P++++T
Sbjct  308  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPDQVKALEAVLPPKPSSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE RRK QQQAQE Y+ED+DM GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEETRRK-QQQAQEAYDEDDDMPGGAQRVQCAQQ  417



>ref|NP_001168650.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACN29044.1| unknown [Zea mays]
 tpg|DAA51803.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=418

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTE+LCGFQFV+THLDNRQLLIKS PGE
Sbjct  249  TVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLCGFQFVVTHLDNRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++L+P+QCKALEAVLPP+P ++ T
Sbjct  309  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSPEQCKALEAVLPPKPVSQYT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNIE EMRR+QQQ  QE Y+EDEDM GGAQRVQCAQQ
Sbjct  369  DMELDECEETMPYDVNIEAEMRRRQQQH-QEAYDEDEDMPGGAQRVQCAQQ  418



>ref|XP_008446732.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 158/171 (92%), Gaps = 3/171 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH +FKRKGDD+FVEHTL+L E+LCGFQF+LTHLD RQLLIKS PGE
Sbjct  246  TVTGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLVESLCGFQFILTHLDGRQLLIKSLPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++L P+QCKALE VLPPR + +++
Sbjct  306  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPEQCKALEGVLPPRTSVQLS  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK   Q QE Y+EDEDMHGGAQRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNIEEEMRRK---QVQEAYDEDEDMHGGAQRVQCAQQ  413



>ref|NP_001149958.1| dnaJ protein [Zea mays]
 gb|ACG37341.1| dnaJ protein [Zea mays]
Length=336

 Score =   299 bits (765),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTE+LCGFQFVLTHLDNRQLLIKS PGE
Sbjct  167  TATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLCGFQFVLTHLDNRQLLIKSNPGE  226

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++L+P+QCKALEAVLPP+P ++ T
Sbjct  227  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSPEQCKALEAVLPPKPVSQYT  286

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D+ GG QRVQCAQQ
Sbjct  287  DMELDECEETMSYDVNIEEEMRRRQQQH-QEAYDEDDDVPGGGQRVQCAQQ  336



>gb|EMT20603.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+F EHT++LTEALCGFQ VLTHLDNRQLLIKS PGE
Sbjct  250  TVTGDIVFVVQQKEHPKFKRKGDDLFYEHTISLTEALCGFQLVLTHLDNRQLLIKSNPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAI+DEGMPMYQ+PFM+GKLYIHFTV+FP++L PDQCKALEAVLPP+PA+K+T
Sbjct  310  VVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPDQCKALEAVLPPKPASKLT  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            DMELDECEETT++DVN+EEEMRRK    AQE Y+ED++M  GGAQRVQCAQQ
Sbjct  370  DMELDECEETTMHDVNMEEEMRRKAHAAAQEAYDEDDEMPGGGAQRVQCAQQ  421



>gb|AAX95135.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97900.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
Length=416

 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 163/172 (95%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H+KFKRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  246  TVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLPP+PA+++T
Sbjct  306  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPPKPASQLT  365

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +ME+DECEETT++DV NIEEEMRRK  Q AQE Y+ED++M GGAQRVQCAQQ
Sbjct  366  EMEIDECEETTMHDVNNIEEEMRRK-AQAAQEAYDEDDEMPGGAQRVQCAQQ  416



>ref|NP_001050779.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|AAO72551.1| DNAJ-like protein [Oryza sativa Japonica Group]
 gb|AAU89194.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97899.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF97901.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12693.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|EAY94672.1| hypothetical protein OsI_16451 [Oryza sativa Indica Group]
 gb|EAZ27951.1| hypothetical protein OsJ_11911 [Oryza sativa Japonica Group]
 gb|ACA50510.1| DnaJ protein [Oryza sativa Japonica Group]
 dbj|BAG97073.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 163/172 (95%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H+KFKRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLPP+PA+++T
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPPKPASQLT  366

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +ME+DECEETT++DV NIEEEMRRK  Q AQE Y+ED++M GGAQRVQCAQQ
Sbjct  367  EMEIDECEETTMHDVNNIEEEMRRK-AQAAQEAYDEDDEMPGGAQRVQCAQQ  417



>ref|XP_009406563.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=414

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 160/171 (94%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQK+H KFKRKGDDIF EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  246  TVTGDIVFILQQKDHPKFKRKGDDIFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAI+DEGMPMYQ+PFMRGKLYIHFTVDFP++LTPDQCKALEAVLPPR A ++T
Sbjct  306  VVKPDQFKAIDDEGMPMYQRPFMRGKLYIHFTVDFPDSLTPDQCKALEAVLPPRQALQMT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +MELDECEET L +VNIEEEMRRK Q Q+QE Y+ED+D+HGGA RVQCAQQ
Sbjct  366  EMELDECEETILNNVNIEEEMRRK-QAQSQEAYDEDDDVHGGA-RVQCAQQ  414



>ref|XP_010089798.1| DnaJ-like protein [Morus notabilis]
 gb|EXB38414.1| DnaJ-like protein [Morus notabilis]
Length=440

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+FVEH L+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  270  TITGDIVFVLQQKEHPKFKRKGDDLFVEHNLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  329

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP+ L+P+  KALE VLPP+P + ++
Sbjct  330  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDYLSPEHVKALEVVLPPKPLSPLS  389

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETT ++VNIEEEMRRKQQQ   E YEEDEDM GGAQRVQCAQQ
Sbjct  390  DMELDECEETTPHNVNIEEEMRRKQQQAQAEAYEEDEDMQGGAQRVQCAQQ  440



>gb|AGY48886.1| MIP1.4a [Nicotiana benthamiana]
Length=403

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H +FKRKGDD+FV+HTL+LTEALCGFQF++THLD RQLLIKS PGE
Sbjct  234  TVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALCGFQFIITHLDGRQLLIKSNPGE  293

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF V+FPE+L+P+Q KALEAVLPPRP ++ T
Sbjct  294  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPESLSPEQAKALEAVLPPRPQSQYT  353

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED+++HGG QRVQCAQQ
Sbjct  354  DMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDELHGGGQRVQCAQQ  403



>gb|KCW50936.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=335

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  166  TVTGDIVFILQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  225

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFPE+L+P+Q +AL++VLP +PA+++T
Sbjct  226  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPESLSPEQVEALQSVLPQKPASQLT  285

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +MELDECEETTL+DVNIEEEMRRKQQ QA E Y+ED+DM  GAQRVQCAQQ
Sbjct  286  EMELDECEETTLHDVNIEEEMRRKQQAQA-EAYDEDDDMPSGAQRVQCAQQ  335



>ref|NP_001267695.1| dnaJ protein homolog [Cucumis sativus]
 gb|ADF30255.1| heat shock protein [Cucumis sativus]
Length=413

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 157/171 (92%), Gaps = 3/171 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L E+LCGFQF+LTHLD RQLLIKS PGE
Sbjct  246  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLVESLCGFQFILTHLDGRQLLIKSLPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHF V+FP++L P+QCKALE VLPPR + +++
Sbjct  306  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFCVEFPDSLNPEQCKALEGVLPPRTSVQLS  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK   QAQE  +EDEDMHGGAQRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNIEEEMRRK---QAQEANDEDEDMHGGAQRVQCAQQ  413



>gb|EMT10718.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTEALCGFQ+VL HLD RQLLIKS PGE
Sbjct  250  TVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALCGFQYVLAHLDGRQLLIKSNPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++L+ DQCKALE VLPP+PA++ T
Sbjct  310  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLSLDQCKALETVLPPKPASQYT  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            DMELDECEET  YD++IEEEMRR++QQQAQE Y+EDEDM  GG QRVQCAQQ
Sbjct  370  DMELDECEETMAYDIDIEEEMRRREQQQAQEGYDEDEDMPGGGGQRVQCAQQ  421



>gb|ABA46776.1| DnaJ-like protein [Solanum tuberosum]
Length=443

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 159/166 (96%), Gaps = 2/166 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLDNRQL+IK QPGE
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDNRQLIIKPQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+TL+P+QCK LEAVLPP+P T++T
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQMT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQR  260
            DMELDECEETTL+DV+IEEEMRRK QQQAQE Y E+DEDMHGGAQR
Sbjct  369  DMELDECEETTLHDVHIEEEMRRK-QQQAQEAYDEDDEDMHGGAQR  413



>ref|XP_004139085.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 gb|KGN66611.1| DnaJ [Cucumis sativus]
Length=413

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 160/171 (94%), Gaps = 3/171 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQF LTHLD RQLLIK+ PGE
Sbjct  246  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFALTHLDGRQLLIKTNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMP+YQ+PFM+GKLYIHF+VDFP++L+P+Q KALEAVLP +P++++T
Sbjct  306  VVKPDSFKAINDEGMPVYQRPFMKGKLYIHFSVDFPDSLSPEQIKALEAVLPSKPSSQLT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET+++DVNIEEEMRRKQQ +A   YEEDEDMHGGAQRVQCAQQ
Sbjct  366  DMELDECEETSMHDVNIEEEMRRKQQAEA---YEEDEDMHGGAQRVQCAQQ  413



>gb|KDO48966.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=335

 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+F EHTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  166  TVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  225

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAIN+EGMP+YQ+PFM+GKLYIHFTV+FP++LTPDQ KALEA+LP RP + +T
Sbjct  226  VVKPDSYKAINEEGMPLYQRPFMKGKLYIHFTVEFPDSLTPDQVKALEAILPSRPLSGMT  285

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q  AQE YEEDEDM GGAQRVQCAQQ
Sbjct  286  DMELDECEETTLHDVNIEEEMRRK-QAHAQEAYEEDEDMPGGAQRVQCAQQ  335



>ref|XP_008443634.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 160/171 (94%), Gaps = 3/171 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD RQLLIK+ PGE
Sbjct  246  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKTNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMP+YQ+PFM+GKLYIHF+VDFP++L+P+Q KALE VLP +P++++T
Sbjct  306  VVKPDSFKAINDEGMPVYQRPFMKGKLYIHFSVDFPDSLSPEQIKALETVLPSKPSSQLT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET+++DVNIEEEMRRKQQ +A   YEEDEDMHGGAQRVQCAQQ
Sbjct  366  DMELDECEETSMHDVNIEEEMRRKQQAEA---YEEDEDMHGGAQRVQCAQQ  413



>ref|XP_010031575.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50935.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=416

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  247  TVTGDIVFILQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFPE+L+P+Q +AL++VLP +PA+++T
Sbjct  307  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPESLSPEQVEALQSVLPQKPASQLT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +MELDECEETTL+DVNIEEEMRRKQQ QA E Y+ED+DM  GAQRVQCAQQ
Sbjct  367  EMELDECEETTLHDVNIEEEMRRKQQAQA-EAYDEDDDMPSGAQRVQCAQQ  416



>ref|XP_006650350.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=417

 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 162/172 (94%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H+KFKRKGDD+F EHTL+LTEALCGFQFVLTHLDNRQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLP +PA+++T
Sbjct  307  VVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPAKPASQLT  366

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +ME+DECEETT++DV NIEEEMRRK  Q AQE Y+ED++M GGAQRVQCAQQ
Sbjct  367  EMEIDECEETTMHDVSNIEEEMRRK-AQAAQEAYDEDDEMPGGAQRVQCAQQ  417



>ref|XP_006826444.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
 gb|ERM93681.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
Length=419

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  751  ITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGEV  572
            ITGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLDNRQLLIKS PGEV
Sbjct  249  ITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDNRQLLIKSNPGEV  308

Query  571  VKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKITD  392
            VKPDQFKAINDEGMPMY +PFM+GKLYIHFTV+FP++L+PDQ KALEAVL PR ++++TD
Sbjct  309  VKPDQFKAINDEGMPMYGRPFMKGKLYIHFTVEFPDSLSPDQSKALEAVLLPRSSSQLTD  368

Query  391  MELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            MELDECEETTL+DVNIEEEMRRKQ   AQEVY+ED+D    GAQRVQCAQQ
Sbjct  369  MELDECEETTLHDVNIEEEMRRKQSHPAQEVYDEDDDGPASGAQRVQCAQQ  419



>ref|XP_003561819.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+F EHTL+LTEALCGFQ VLTHLDNRQLLIKS PGE
Sbjct  248  TVTGDIVFVVQQKEHPKFKRKGDDLFYEHTLSLTEALCGFQLVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            +VKPD FKAI+DEGMPMYQ+PFM+GKLYIHFTV+FP++L P+QCKALEAVLPP+P +K+T
Sbjct  308  IVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPPKPVSKLT  367

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            DMELDECEETTL+DV N+EEEMRRK Q  AQE Y+ED+DM  GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNNMEEEMRRKAQAAAQEAYDEDDDMPGGGAQRVQCAQQ  420



>emb|CDO99946.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 157/171 (92%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK DD+F EHTL+LTEALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKHDDLFYEHTLSLTEALCGFQFILTHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFKAINDEGM +YQ+PFMRGKLYIHF V+FP+ L P+QCK+LEAVLPP+   +IT
Sbjct  308  VLKPDQFKAINDEGMVVYQRPFMRGKLYIHFNVEFPDYLDPEQCKSLEAVLPPKTTKQIT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIE+EMRRK  QQAQE YEEDEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEDEMRRK--QQAQEAYEEDEDMHGGAQRVQCAQQ  416



>sp|Q03363.1|DNJH1_ALLPO RecName: Full=DnaJ protein homolog 1; Short=DNAJ-1; Flags: Precursor, 
partial [Allium ampeloprasum]
 emb|CAA49211.1| DNA J protein [Allium ampeloprasum]
 prf||1914140A DnaJ protein
Length=397

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KF+RKGDD+F +HTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  227  TVTGDIVFVLQQKEHPKFQRKGDDLFYKHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  286

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYI F VDFP++LTPDQCK +E+VLP   ++++T
Sbjct  287  VVKPDQFKAINDEGMPMYQRPFMRGKLYIQFLVDFPDSLTPDQCKVIESVLPRSASSQLT  346

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DVNIEEEMRRKQ Q AQE Y+ED++ HGG QRVQCAQQ
Sbjct  347  DMEIDECEETTMHDVNIEEEMRRKQHQHAQEAYDEDDEGHGGGQRVQCAQQ  397



>gb|AAF64454.1|AF239932_1 DnaJ protein [Euphorbia esula]
Length=418

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQ+EH KFKR+GDD+ VEHTL+LTEALCGFQF+LTHLD RQLLIKSQPGE
Sbjct  249  TVTGDIVFILQQREHPKFKRRGDDLVVEHTLSLTEALCGFQFILTHLDGRQLLIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF V+FP++L PDQ KALEAVLP R + +++
Sbjct  309  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFNVEFPDSLPPDQSKALEAVLPSRTSVQLS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVN EEEMRRKQQQ A E Y+EDEDM GGAQRVQCAQQ
Sbjct  369  DMEVDECEETTLHDVNFEEEMRRKQQQSA-EAYDEDEDMPGGAQRVQCAQQ  418



>ref|XP_004506241.1| PREDICTED: dnaJ protein homolog ANJ1-like [Cicer arietinum]
Length=418

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTV+FPETL+ DQ K LEAVLP +P++++T
Sbjct  308  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPETLSLDQVKGLEAVLPAKPSSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE RRKQ QQ QE Y+ED+DM GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEETRRKQHQQQQEAYDEDDDMPGGAQRVQCAQQ  418



>ref|XP_006424068.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 ref|XP_006487844.1| PREDICTED: dnaJ protein homolog ANJ1-like [Citrus sinensis]
 gb|ESR37308.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 gb|KDO48965.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=416

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+F EHTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAIN+EGMP+YQ+PFM+GKLYIHFTV+FP++LTPDQ KALEA+LP RP + +T
Sbjct  307  VVKPDSYKAINEEGMPLYQRPFMKGKLYIHFTVEFPDSLTPDQVKALEAILPSRPLSGMT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK Q  AQE YEEDEDM GGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIEEEMRRK-QAHAQEAYEEDEDMPGGAQRVQCAQQ  416



>gb|ABI18985.1| molecular chaperone DjA2 [Allium ampeloprasum]
Length=418

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KF+RKGDD+F +HTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFQRKGDDLFYKHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYI F VDFP++LTPDQCK +E+VLP   ++++T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIQFLVDFPDSLTPDQCKVIESVLPRSASSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETT++DVNIEEEMRRKQ Q AQE Y+ED++ HGG QRVQCAQQ
Sbjct  368  DMEIDECEETTMHDVNIEEEMRRKQHQHAQEAYDEDDEGHGGGQRVQCAQQ  418



>ref|XP_003596917.1| DnaJ [Medicago truncatula]
Length=256

 Score =   292 bits (747),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQF LTHLD+RQLLIKS PGE
Sbjct  87   TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFALTHLDSRQLLIKSNPGE  146

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FPE+LT DQ KALE +LP RP +++T
Sbjct  147  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPESLTLDQVKALETILPARPVSQLT  206

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++M GGAQRVQCAQQ
Sbjct  207  DMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDEMPGGAQRVQCAQQ  256



>ref|NP_001242510.1| uncharacterized protein LOC100808604 [Glycine max]
 gb|ACU21221.1| unknown [Glycine max]
Length=410

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRK +D+FVEH L+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  241  TITGDIVFVLQQKEHPKFKRKAEDLFVEHILSLTEALCGFQFVLTHLDGRQLLIKSNPGE  300

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+ FM+GKLYIHFTV+FP++L PDQ KALEAVLPP+P++++T
Sbjct  301  VVKPDSYKAINDEGMPMYQRSFMKGKLYIHFTVEFPDSLNPDQVKALEAVLPPKPSSQLT  360

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE RRK QQQAQE Y+ED+DM GGAQRVQCAQQ
Sbjct  361  DMELDECEETTLHDVNMEEETRRK-QQQAQEAYDEDDDMPGGAQRVQCAQQ  410



>ref|XP_006590333.1| PREDICTED: uncharacterized protein LOC100808604 isoform X1 [Glycine 
max]
 gb|KHN13055.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   297 bits (760),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRK +D+FVEH L+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKAEDLFVEHILSLTEALCGFQFVLTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+ FM+GKLYIHFTV+FP++L PDQ KALEAVLPP+P++++T
Sbjct  308  VVKPDSYKAINDEGMPMYQRSFMKGKLYIHFTVEFPDSLNPDQVKALEAVLPPKPSSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE RRK QQQAQE Y+ED+DM GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEETRRK-QQQAQEAYDEDDDMPGGAQRVQCAQQ  417



>gb|KJB09149.1| hypothetical protein B456_001G126200 [Gossypium raimondii]
Length=416

 Score =   297 bits (760),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQK+H KFKRKG+D+FVEHTL LTEALCGFQFV+THLD RQLLIKS PGE
Sbjct  247  TITGDIVFVLQQKDHPKFKRKGEDLFVEHTLALTEALCGFQFVVTHLDGRQLLIKSIPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMP+YQ+PF++GK+YIHFTV+FP++L PDQ  ALEA+LPP+P + +T
Sbjct  307  VVKPDSFKAINDEGMPLYQRPFIKGKMYIHFTVEFPDSLNPDQIMALEAILPPKPTSHLT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE Y+EDED HGGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDEDTHGGAQRVQCAQQ  416



>ref|XP_008385581.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   296 bits (759),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  249  TVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPA-TKI  398
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF V+FPE+L+P+Q KALEA LP +P+ +++
Sbjct  309  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLSPEQVKALEAALPGKPSXSQL  368

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            TDME+DECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+DM GGAQRVQCAQQ
Sbjct  369  TDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPGGAQRVQCAQQ  420



>ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum]
 gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum]
Length=419

 Score =   296 bits (759),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+FVEHTL+L E+LCGFQFVLTHLDNRQLLIKSQPGE
Sbjct  250  TITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLDESLCGFQFVLTHLDNRQLLIKSQPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFM+GK+YIHFTVDFPE+L  +QCK LEAVLPP+   +I+
Sbjct  310  VVKPDQFKAINDEGMPMYQRPFMKGKMYIHFTVDFPESLHAEQCKNLEAVLPPKTKLQIS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDE EETTL+DVNIEEEMRRK QQ AQE  +ED+DM GGAQRVQCAQQ
Sbjct  370  DMELDEWEETTLHDVNIEEEMRRK-QQAAQEAQDEDDDMPGGAQRVQCAQQ  419



>ref|XP_008359180.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=424

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  253  TVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  312

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPA-TKI  398
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF V+FPE+L+P+Q KALEA LP +P+ +++
Sbjct  313  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLSPEQVKALEAALPGKPSXSQL  372

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            TDME+DECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+DM GGAQRVQCAQQ
Sbjct  373  TDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPGGAQRVQCAQQ  424



>ref|XP_009789005.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=418

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 159/172 (92%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H +FKRKGDD+FV+HTL+LTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALCGFQFILTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF V+FP++L+P+Q KALEA+LPPRP ++ T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPDSLSPEQVKALEAILPPRPQSQYT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++MH GG QRVQCAQQ
Sbjct  368  DMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDEMHGGGGQRVQCAQQ  418



>ref|XP_007015641.1| DNAJ isoform 2 [Theobroma cacao]
 gb|EOY33260.1| DNAJ isoform 2 [Theobroma cacao]
Length=414

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 159/171 (93%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS  GE
Sbjct  246  TITGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNSGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            +VKPD FKAINDEGMP+YQ+PFM+GKLYIHFTVDFP++L+PDQ +ALEA+LPP+P +++T
Sbjct  306  IVKPDSFKAINDEGMPLYQRPFMKGKLYIHFTVDFPDSLSPDQVQALEAILPPKPTSQLT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRK QQ AQE  +E E+MHGGAQRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNIEEEMRRK-QQAAQETLDE-EEMHGGAQRVQCAQQ  414



>emb|CDP15561.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 159/172 (92%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDIVFV+QQKEH K KRK DDIFVEHTL+LTEALCGFQF+LTHLD RQLLIKS+PGE
Sbjct  247  TATGDIVFVVQQKEHPKLKRKHDDIFVEHTLSLTEALCGFQFILTHLDGRQLLIKSKPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFKAI+DEGMPMYQ+PFMRGK+YIHFTV+FP++L+PDQ KALE +LPP+P +++T
Sbjct  307  VIKPDQFKAIDDEGMPMYQRPFMRGKMYIHFTVEFPDSLSPDQVKALEGILPPKPQSQLT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQ  Q QE YEED+DMH GGAQRVQCAQQ
Sbjct  367  DMELDECEETTLHDVNIEEEMRRKQAAQ-QEAYEEDDDMHGGGAQRVQCAQQ  417



>ref|XP_007132506.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
 gb|ESW04500.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
Length=418

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KF+RK +D+FVEHTL+LTEALCGFQFVLTHLD+RQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALCGFQFVLTHLDSRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLY+HFTV+FP+ L P+Q KALEAVLPP+  +++T
Sbjct  308  VVKPDSYKAINDEGMPMYQRPFMKGKLYLHFTVEFPDFLNPEQVKALEAVLPPKQPSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+E+E RR+QQQ AQE YEED+DM GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDDMPGGAQRVQCAQQ  418



>gb|AFK38714.1| unknown [Lotus japonicus]
Length=247

 Score =   289 bits (739),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDIVFVLQ KEH KFKRK +D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  77   TTTGDIVFVLQLKEHPKFKRKAEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  136

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L P+Q K LEA LP +P++++T
Sbjct  137  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLNPNQVKDLEAALPAKPSSQLT  196

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE RRK+QQ  QE Y+ED+DM GGAQRVQCAQQ
Sbjct  197  DMELDECEETTLHDVNMEEENRRKEQQAQQEAYDEDDDMPGGAQRVQCAQQ  247



>gb|AAD12055.1| DnaJ protein [Hevea brasiliensis]
Length=415

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+ V+HTL+LTEALC  QF+LTHLD   LLIKSQPGE
Sbjct  247  TITGDIVFVLQQKEHPKFKRKGDDLIVDHTLSLTEALCASQFILTHLDG-DLLIKSQPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFP++L PDQCKALEAVLP R + +++
Sbjct  306  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDSLPPDQCKALEAVLPSRTSVQLS  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN +EEMRRK QQQAQE Y+ED+DMHGG QRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNFDEEMRRK-QQQAQEAYDEDDDMHGGGQRVQCAQQ  415



>gb|KDP42967.1| hypothetical protein JCGZ_23909 [Jatropha curcas]
Length=418

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+ VEH L+LTE+LCGFQFVLTHLD RQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKGDDLIVEHNLSLTESLCGFQFVLTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+G+LYIHF V+FP++LT DQ KALEA+LPPRP++ +T
Sbjct  308  VVKPDSFKAINDEGMPMYQRPFMKGRLYIHFNVEFPDSLTLDQVKALEAILPPRPSSMLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRK Q+  QE Y+ED+DM  G QRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEEMRRKDQRSQQEAYDEDDDMPSGGQRVQCAQQ  418



>gb|AHA84223.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KF+RK +D+FVEHTL+LTEALCGFQFVLTHLD+RQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALCGFQFVLTHLDSRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLY+HFTV+FP+ L P+Q KALEAVLPP+  +++T
Sbjct  308  VVKPDSYKAINDEGMPMYQRPFMKGKLYLHFTVEFPDFLNPEQVKALEAVLPPKQPSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+E+E RR+QQQ AQE YEED+DM GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDDMPGGAQRVQCAQQ  418



>gb|KJB35429.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=444

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 162/198 (82%), Gaps = 27/198 (14%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKG+D+F+EHTL+LTEALCGFQFV+THLD RQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALCGFQFVITHLDGRQLLIKSNPGE  306

Query  574  VVKPDQF---------------------------KAINDEGMPMYQKPFMRGKLYIHFTV  476
            VVKP +F                           KAINDEGMP+YQ+PFM+GKLYI FTV
Sbjct  307  VVKPGKFLEVSILKGIFYQLLGFKFVKLVIPDSCKAINDEGMPLYQRPFMKGKLYIQFTV  366

Query  475  DFPETLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY  296
            +FP++L+PDQ KALEA+LPP+P ++++DMELDECEETTLYDVNIEEEMRRKQQQ AQE Y
Sbjct  367  EFPDSLSPDQVKALEAILPPKPTSQLSDMELDECEETTLYDVNIEEEMRRKQQQAAQEAY  426

Query  295  EEDEDMHGGAQRVQCAQQ  242
            EEDEDMHGGAQRVQCAQQ
Sbjct  427  EEDEDMHGGAQRVQCAQQ  444



>gb|KHG16062.1| Chaperone protein dnaJ 3 [Gossypium arboreum]
Length=321

 Score =   291 bits (744),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLD RQLLIK+ PGE
Sbjct  129  TVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDGRQLLIKTHPGE  188

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQ KAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L P+QCKALEAVLP R + ++T
Sbjct  189  VVKPDQCKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLAPEQCKALEAVLPSRASVQLT  248

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHG  272
            DMELDECEETTLYDVNIEEEMRRKQ Q AQE YEED+DMH 
Sbjct  249  DMELDECEETTLYDVNIEEEMRRKQAQAAQEAYEEDDDMHA  289



>ref|XP_009368443.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   294 bits (752),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALCGFQ+VLTHLD RQLLIKS PGE
Sbjct  249  TVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQYVLTHLDGRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPR-PATKI  398
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF V+FPE+L+P+Q KALEA LP +  A+++
Sbjct  309  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLSPEQVKALEAALPGKASASQL  368

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            TDME+DECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+DM GGAQRVQCAQQ
Sbjct  369  TDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPGGAQRVQCAQQ  420



>ref|XP_011090296.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=417

 Score =   293 bits (751),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQF+L+HLD RQLLIKSQPGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFILSHLDGRQLLIKSQPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHF VDFP++LT DQ  AL  +LPP+  +++T
Sbjct  308  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFNVDFPDSLTADQVDALAKILPPKAQSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQ Q  QE Y+EDE+MHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEEMRRKQTQH-QEAYDEDEEMHGGAQRVQCAQQ  417



>ref|XP_008230416.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=418

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 158/172 (92%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF++ QKEH KFKRKG+D+FVEH+L+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFIIHQKEHPKFKRKGEDLFVEHSLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRP-ATKI  398
            VVKPD FKAINDEGMP+YQ+PFM+GKLYIHF VDFPE+L PDQ KALEA+LP +P A+++
Sbjct  308  VVKPDSFKAINDEGMPLYQRPFMKGKLYIHFNVDFPESLNPDQVKALEAILPSKPGASQL  367

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            TDME+DECEETTL+DVN+EEEMRRKQQ QA E Y+ED+DM GGAQRVQCAQQ
Sbjct  368  TDMEVDECEETTLHDVNMEEEMRRKQQAQA-EAYDEDDDMPGGAQRVQCAQQ  418



>gb|AFK48086.1| unknown [Medicago truncatula]
Length=227

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  57   TVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  116

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP+TL+ DQ K LEAVLP +P++++T
Sbjct  117  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLDQVKGLEAVLPAKPSSQLT  176

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVN+EEE RRKQQQQ QE Y+ED+DM GGAQRVQCAQQ
Sbjct  177  DMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDDMPGGAQRVQCAQQ  227



>gb|AFK37703.1| unknown [Medicago truncatula]
Length=417

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQF LTHLD+RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFALTHLDSRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FPE+LT DQ KALE +LP RP +++T
Sbjct  308  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPESLTLDQVKALETILPARPVSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++M GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDEMPGGAQRVQCAQQ  417



>ref|XP_003596916.1| DnaJ [Medicago truncatula]
 gb|AES67167.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=417

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQF LTHLD+RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFALTHLDSRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FPE+LT DQ KALE +LP RP +++T
Sbjct  308  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPESLTLDQVKALETILPARPVSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++M GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDEMPGGAQRVQCAQQ  417



>gb|EYU37228.1| hypothetical protein MIMGU_mgv1a006942mg [Erythranthe guttata]
Length=425

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLDNRQLLIKS+ GE
Sbjct  253  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDNRQLLIKSESGE  312

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFKAINDEGMPMYQK FM+GKLYI F+VDFPE+L P+Q KA+  VLP +   ++T
Sbjct  313  VIKPDQFKAINDEGMPMYQKSFMKGKLYIQFSVDFPESLNPEQSKAIGTVLPSKSTNQLT  372

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMH-GGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRKQ Q AQE Y EED+DMH GGAQRVQCAQQ
Sbjct  373  DMELDECEETTLHDVNMEEEMRRKQHQHAQEAYDEEDDDMHGGGAQRVQCAQQ  425



>gb|ACJ84348.1| unknown [Medicago truncatula]
 gb|AFK39964.1| unknown [Medicago truncatula]
Length=256

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQF  THLD+RQLLIKS PGE
Sbjct  87   TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFAPTHLDSRQLLIKSNPGE  146

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV FPE+LT DQ KALE +LP RP +++T
Sbjct  147  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVVFPESLTLDQVKALETILPARPVSQLT  206

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++M GGAQRVQCAQQ
Sbjct  207  DMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDEMPGGAQRVQCAQQ  256



>gb|AGY48887.1| MIP1.4b [Nicotiana benthamiana]
Length=418

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 158/172 (92%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQK+H +FKRKGDD+FV+HTL+LTEALCGFQF++THLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALCGFQFIITHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF V+FP++L+P+Q K LEA+LPPRP ++ T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPDSLSPEQVKTLEAILPPRPQSQYT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++MH GG QRV+CAQQ
Sbjct  368  DMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDEMHGGGGQRVECAQQ  418



>ref|XP_007205259.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
 gb|EMJ06458.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
Length=418

 Score =   291 bits (746),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 158/172 (92%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF++ QKEH KFKRKG+D+FVEH+L+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFIIHQKEHPKFKRKGEDLFVEHSLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRP-ATKI  398
            VVKPD FKAINDEGMP+YQ+PFM+GKLYIHF VDFPE+L P+Q KALEA+LP +P A+++
Sbjct  308  VVKPDSFKAINDEGMPLYQRPFMKGKLYIHFNVDFPESLNPEQVKALEAILPSKPGASQL  367

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            TDME+DECEETTL+DVN+EEEMRRKQQ QA E Y+ED+DM GGAQRVQCAQQ
Sbjct  368  TDMEVDECEETTLHDVNMEEEMRRKQQAQA-EAYDEDDDMPGGAQRVQCAQQ  418



>gb|KHN36510.1| DnaJ protein like [Glycine soja]
Length=298

 Score =   287 bits (735),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK DD+FVEHTL+LTEALCGFQFVLTHLD+RQLLIKS PGE
Sbjct  129  TVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQFVLTHLDSRQLLIKSNPGE  188

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP+ FKAINDEGMP YQ+ F++GKLYIHF+V+FP+TL+ DQ KALEA LP +P +++T
Sbjct  189  VVKPESFKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLDQVKALEATLPLKPTSQLT  248

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE RR+QQ Q QE Y+EDEDMHGGAQRVQCAQQ
Sbjct  249  DMELDECEETTLHDVNMEEETRRRQQAQ-QEAYDEDEDMHGGAQRVQCAQQ  298



>ref|XP_002313505.1| seed maturation protein PM37 [Populus trichocarpa]
 gb|EEE87460.1| seed maturation protein PM37 [Populus trichocarpa]
Length=415

 Score =   291 bits (745),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 156/171 (91%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLPLTEALCGFQFVLTHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
             VKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++LTPDQ KA+E +L PRP++++T
Sbjct  307  AVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLTPDQVKAIETIL-PRPSSQLT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQQ + +E Y+EDE+M  G QRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNIEEEMRRKQQAR-EEAYDEDEEMPHGGQRVQCAQQ  415



>gb|AFW67420.1| putative dnaJ chaperone family protein [Zea mays]
Length=415

 Score =   291 bits (745),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F EHTL LTE+LCGFQFVLTHLDNRQLLIKS PGE
Sbjct  246  TATGDIIFVLQQKEHPKFKRKGDDLFYEHTLILTESLCGFQFVLTHLDNRQLLIKSNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++L+P+QCK LEAVLP +P ++ T
Sbjct  306  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSPEQCKTLEAVLPLKPVSQYT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D+ GG QRVQCAQQ
Sbjct  366  DMELDECEETMPYDVNIEEEMRRRQQQH-QEAYDEDDDVPGGGQRVQCAQQ  415



>gb|AFW67421.1| putative dnaJ chaperone family protein [Zea mays]
Length=417

 Score =   291 bits (745),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F EHTL LTE+LCGFQFVLTHLDNRQLLIKS PGE
Sbjct  248  TATGDIIFVLQQKEHPKFKRKGDDLFYEHTLILTESLCGFQFVLTHLDNRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++L+P+QCK LEAVLP +P ++ T
Sbjct  308  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSPEQCKTLEAVLPLKPVSQYT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D+ GG QRVQCAQQ
Sbjct  368  DMELDECEETMPYDVNIEEEMRRRQQQH-QEAYDEDDDVPGGGQRVQCAQQ  417



>gb|AFK46626.1| unknown [Medicago truncatula]
Length=256

 Score =   285 bits (730),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQF  THLD+RQLLIKS PGE
Sbjct  87   TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFAPTHLDSRQLLIKSNPGE  146

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV FPE+LT DQ KALE +LP RP +++T
Sbjct  147  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVVFPESLTLDQVKALETILPARPVSQLT  206

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++M GGAQRVQC QQ
Sbjct  207  DMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDEMPGGAQRVQCGQQ  256



>gb|EYU36023.1| hypothetical protein MIMGU_mgv1a007093mg [Erythranthe guttata]
Length=420

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKGDD+F+EHTL L EALCGFQFVL+HLD RQLLIKSQPGE
Sbjct  249  TITGDIVFVLQQKEHPKFKRKGDDLFIEHTLPLAEALCGFQFVLSHLDGRQLLIKSQPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHF V+FP++L+ +Q  ALE +LPP+P +++T
Sbjct  309  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFNVEFPDSLSAEQVAALEKILPPKPQSELT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRKQ  + QE Y +EDEDMHGGAQRVQCAQQ
Sbjct  369  DMEVDECEETTLHDVNIEDEMRRKQAHRQQEAYDDEDEDMHGGAQRVQCAQQ  420



>gb|ADK35105.1| DnaJ-like protein 1 [Astragalus sinicus]
Length=236

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 157/172 (91%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF+LQQKEH KF+RKG+D+FVEHTL+LTE+LCGFQFVLTHLD RQLLIKS PGE
Sbjct  66   TVTGDIVFILQQKEHPKFRRKGEDLFVEHTLSLTESLCGFQFVLTHLDGRQLLIKSNPGE  125

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L  DQ K+LE +LPPRP +++T
Sbjct  126  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLGVDQVKSLETILPPRPVSQLT  185

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED+DM  GGAQRV+CAQQ
Sbjct  186  DMELDECEETTLHDVNIEEESRRRQQAQ-QEAYDEDDDMPGGGAQRVRCAQQ  236



>ref|XP_009336413.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  249  TVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRP-ATKI  398
            VVKPD FKAINDEGMP+YQ+ FM+GKLYIHF V+FPE+L P+Q KALEA LP +P A+++
Sbjct  309  VVKPDSFKAINDEGMPIYQRSFMKGKLYIHFNVEFPESLNPEQVKALEAALPGKPSASQL  368

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
             DME+DECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+DM GGAQRVQCAQQ
Sbjct  369  MDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPGGAQRVQCAQQ  420



>ref|XP_008361658.1| PREDICTED: dnaJ protein homolog [Malus domestica]
 ref|XP_008355256.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  249  TVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLPLTEALCGFQFVLTHLDGRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRP-ATKI  398
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHF V+FPE+L P+Q KALEA LP +P A+++
Sbjct  309  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPESLNPEQVKALEAALPGKPSASQL  368

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            TDME+ ECEETTL+DVN+EEEMRRKQ Q  QE Y+ED+DM GGAQRVQCAQQ
Sbjct  369  TDMEVXECEETTLHDVNMEEEMRRKQLQAQQEAYDEDDDMPGGAQRVQCAQQ  420



>ref|XP_002515865.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF46534.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQK+H KFKRK DD+ V+H L+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKDHPKFKRKEDDLVVDHNLSLTEALCGFQFVLTHLDGRQLLIKSTPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP  FKAINDEGMPMYQ+PFM+GKLYIHF VDFP++LT DQ KALEA+LP R +T++T
Sbjct  308  VVKPGSFKAINDEGMPMYQRPFMKGKLYIHFNVDFPDSLTADQVKALEAILPLRSSTQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+DM  GAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDDMPSGAQRVQCAQQ  418



>ref|XP_009592511.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=418

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 156/172 (91%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQK+H +FKRKGDD+FV+HTL+LTEALCGFQF++THLD RQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALCGFQFIMTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMPMYQ+PFMRGKLYI F V+FP++L  +Q KALEA+LPPRP ++ T
Sbjct  308  VVKPDQFKAINDEGMPMYQRPFMRGKLYIRFVVEFPDSLNTEQVKALEAILPPRPQSQYT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++MH GG QRVQCAQQ
Sbjct  368  DMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDEMHGGGGQRVQCAQQ  418



>ref|XP_004291531.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=423

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVF++QQKEH KFKRK DD+FVEH+L+LT+ALCGFQFVL HLD RQLLIKS PGE
Sbjct  252  TVTGDIVFIIQQKEHPKFKRKMDDLFVEHSLSLTDALCGFQFVLNHLDGRQLLIKSNPGE  311

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPAT-KI  398
            VVKPD FKA+NDEGMPMYQ+PFM+GKLYIHF+VDFPETL+P+Q KALEA LP R ++ ++
Sbjct  312  VVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVDFPETLSPEQVKALEAALPSRASSQQL  371

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            TDMELDECEETTL+DVN+EEEMRRKQ Q   E Y+ED+DM GGAQRVQCAQQ
Sbjct  372  TDMELDECEETTLHDVNMEEEMRRKQHQAHSEAYDEDDDMPGGAQRVQCAQQ  423



>ref|NP_001240264.1| uncharacterized protein LOC100818805 [Glycine max]
 gb|ACU23708.1| unknown [Glycine max]
Length=417

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK DD+FVEHTL+LTEALCGFQFVLTHLD+RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQFVLTHLDSRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP+ FKAINDEGMP YQ+ F++GKLYIHF+V+FP+TL+ DQ KALEAVLP +P ++++
Sbjct  308  VVKPESFKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLDQVKALEAVLPSKPTSQLS  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE RR+QQ Q QE Y+EDEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEETRRRQQAQ-QEAYDEDEDMHGGAQRVQCAQQ  417



>gb|AHA84264.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KF+RK +D+FVEHTL+LTEALCGFQFVLTHLD+RQL IK  PGE
Sbjct  248  TITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALCGFQFVLTHLDSRQLFIKFNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLY HFTV+FP+ L P+Q KALEAVLPP+  +++T
Sbjct  308  VVKPDSYKAINDEGMPMYQRPFMKGKLYFHFTVEFPDFLNPEQVKALEAVLPPKQPSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+E+E RR+QQQ AQE YEED+DM GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDDMPGGAQRVQCAQQ  418



>gb|KHN17991.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK DD+FVEHTL+LTEALCGFQFVL HLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQFVLAHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMP YQ+ F++GKLYIHF+V+FP+TL+ DQ KALEA LP +P +++T
Sbjct  308  VVKPDSYKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLDQVKALEATLPLKPTSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE+RR+QQ Q QE YEEDEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEEIRRRQQAQ-QEAYEEDEDMHGGAQRVQCAQQ  417



>ref|XP_008670357.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=267

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F +HTLTLTE+LCGFQFVL HLDNRQLLIKS PGE
Sbjct  98   TATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLCGFQFVLAHLDNRQLLIKSNPGE  157

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP +L+P+QCKALE VLPP+P ++ T
Sbjct  158  VVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPNSLSPEQCKALEVVLPPKPVSQYT  217

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D+  G QRVQCAQQ
Sbjct  218  DMELDECEETMPYDVNIEEEMRRRQQQH-QEAYDEDDDVPSGGQRVQCAQQ  267



>ref|XP_003605981.1| DnaJ [Medicago truncatula]
Length=413

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  243  TVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  302

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP+TL+ DQ K LEAVLP +P++++T
Sbjct  303  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLDQVKGLEAVLPAKPSSQLT  362

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVN+EEE RRKQQQQ QE Y+ED+DM GGAQRVQCAQQ
Sbjct  363  DMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDDMPGGAQRVQCAQQ  413



>tpg|DAA40640.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=301

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F +HTLTLTE+LCGFQFVL HLDNRQLLIKS PGE
Sbjct  132  TATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLCGFQFVLAHLDNRQLLIKSNPGE  191

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP +L+P+QCKALE VLPP+P ++ T
Sbjct  192  VVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPNSLSPEQCKALEVVLPPKPVSQYT  251

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D+  G QRVQCAQQ
Sbjct  252  DMELDECEETMPYDVNIEEEMRRRQQQH-QEAYDEDDDVPSGGQRVQCAQQ  301



>ref|XP_003605980.1| DnaJ [Medicago truncatula]
 gb|AES88177.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=416

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  246  TVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP+TL+ DQ K LEAVLP +P++++T
Sbjct  306  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLDQVKGLEAVLPAKPSSQLT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVN+EEE RRKQQQQ QE Y+ED+DM GGAQRVQCAQQ
Sbjct  366  DMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDDMPGGAQRVQCAQQ  416



>ref|XP_003540271.1| PREDICTED: dnaJ protein homolog [Glycine max]
Length=417

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK DD+FVEHTL+LTEALCGFQFVL HLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQFVLAHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMP YQ+ F++GKLYIHF+V+FP+TL+ DQ KALE  LP +P +++T
Sbjct  308  VVKPDSYKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLDQVKALETTLPLKPTSQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEE+RR+QQ Q QE YEEDEDMHGGAQRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEEIRRRQQAQ-QEAYEEDEDMHGGAQRVQCAQQ  417



>ref|XP_008661261.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=312

 Score =   283 bits (723),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F +HTLTLTE+LCGFQFVL HLDNRQLLIKS PGE
Sbjct  143  TATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLCGFQFVLAHLDNRQLLIKSNPGE  202

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP++L+P+QCKALE VLPP+P ++ T
Sbjct  203  VVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPDSLSPEQCKALEVVLPPKPVSQYT  262

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNI+EEMRR+QQQ  QE Y+ED+D+  G QRVQCAQQ
Sbjct  263  DMELDECEETMPYDVNIKEEMRRRQQQH-QEAYDEDDDVPSGGQRVQCAQQ  312



>gb|AFW89867.1| putative dnaJ chaperone family protein [Zea mays]
Length=344

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F +HTLTLTE+LCGFQFVL HLDNRQLLIKS PGE
Sbjct  175  TATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLCGFQFVLAHLDNRQLLIKSNPGE  234

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP++L+P+QCKALE VLPP+P ++ T
Sbjct  235  VVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPDSLSPEQCKALEVVLPPKPVSQYT  294

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEET  YDVNI+EEMRR+QQQ  QE Y+ED+D+  G QRVQCAQQ
Sbjct  295  DMELDECEETMPYDVNIKEEMRRRQQQH-QEAYDEDDDVPSGGQRVQCAQQ  344



>gb|EYU36024.1| hypothetical protein MIMGU_mgv1a007013mg [Erythranthe guttata]
Length=422

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH K+KRKGDD+F+EHTL L EALCGFQF L+HLD RQLLIKSQPGE
Sbjct  251  TVTGDIVFVVQQKEHPKYKRKGDDLFIEHTLPLGEALCGFQFALSHLDGRQLLIKSQPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMP+YQ+PFM+GKLYIHF V+FP++L+ +Q +ALE +LPP+P +K+T
Sbjct  311  VVKPDSYKAINDEGMPIYQRPFMKGKLYIHFNVEFPDSLSTEQVEALEKILPPKPQSKLT  370

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRKQ  + QE Y ++DEDMHGGAQRVQCAQQ
Sbjct  371  DMEVDECEETTLHDVNIEDEMRRKQAHRQQEAYDDDDEDMHGGAQRVQCAQQ  422



>ref|XP_006650701.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=418

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTEALCGFQFVLTHLDNRQLLIKS+PGE
Sbjct  247  TVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALCGFQFVLTHLDNRQLLIKSKPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKA+NDEGMPMYQ+PFM+GKLYIHF+V+FP++L PDQCKALE VLPPRP ++ T
Sbjct  307  VVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPDQCKALETVLPPRPVSQYT  366

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEEMRR+QQQQ QE Y+EDEDMH GGAQRVQCAQQ
Sbjct  367  DMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDEDMHGGGAQRVQCAQQ  418



>ref|XP_006340319.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X2 [Solanum 
tuberosum]
Length=337

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 156/172 (91%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGD+VFVLQQKEH KFKRKG+D+FV+HTLTLTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  167  TVTGDVVFVLQQKEHPKFKRKGEDLFVDHTLTLTEALCGFQFILTHLDGRQLLIKSNPGE  226

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++L+  Q + LEA+LPPRP ++ +
Sbjct  227  VVKPDQFKAINDEGMPVYQRPFMKGKLYIHFTVEFPDSLSLPQVQLLEAILPPRPTSQYS  286

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHG-GAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRKQ  Q QE Y+EDE+M G G QRVQCAQQ
Sbjct  287  DMELDECEETTLHDVNMEEEMRRKQAAQ-QEAYDEDEEMSGSGGQRVQCAQQ  337



>ref|XP_008666814.1| PREDICTED: dnaJ protein homolog 1-like [Zea mays]
Length=515

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVL+QK+H+KFKRKG+D+  EHTL+LTEALCG QFVLTHLDNRQLLIKS PGE
Sbjct  344  TVTGDIVFVLRQKDHSKFKRKGEDLLYEHTLSLTEALCGCQFVLTHLDNRQLLIKSDPGE  403

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++L P+QCKALE VLPPR ++K+T
Sbjct  404  VVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALETVLPPRLSSKLT  463

Query  394  DMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME DECEETT++DV NIEEEM RKQ   A E YEED++M GGAQRVQCAQQ
Sbjct  464  DMETDECEETTMHDVNNIEEEMHRKQAHAAHEAYEEDDEMPGGAQRVQCAQQ  515



>ref|XP_010685460.1| PREDICTED: dnaJ protein homolog ANJ1 [Beta vulgaris subsp. vulgaris]
Length=417

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+F EHTL+LTE+LCGF+FVLTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTESLCGFRFVLTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V+KPDQFKAI+DEGMP+YQ+PFM+GK+YIHFTV+FP++L PDQ KALEA+LPP+P   +T
Sbjct  308  VIKPDQFKAIDDEGMPIYQRPFMKGKMYIHFTVEFPDSLNPDQVKALEAILPPKPTMTLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETT++DVN+EEEMRRKQ Q  QE Y+ED++  GG QRVQCAQQ
Sbjct  368  DMELDECEETTMHDVNMEEEMRRKQTQAQQEAYDEDDEPQGG-QRVQCAQQ  417



>gb|EYU37227.1| hypothetical protein MIMGU_mgv1a006922mg [Erythranthe guttata]
Length=426

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 156/174 (90%), Gaps = 3/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALCGFQFVLTHLDNRQLLIKS+PGE
Sbjct  253  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSEPGE  312

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPA-TKI  398
            V+KPDQFKAINDEGMPMY+K FM+GKLYI FTVDFPE+L P Q KAL  VLP + + T++
Sbjct  313  VIKPDQFKAINDEGMPMYEKSFMKGKLYIQFTVDFPESLNPQQIKALATVLPSKKSTTQL  372

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMH-GGAQRVQCAQQ  242
            TDMELDECEETTL+DVN+EEEMRRK QQ+A E Y ++DEDMH GGAQ V CAQQ
Sbjct  373  TDMELDECEETTLHDVNMEEEMRRKPQQRAHEAYDDDDEDMHGGGAQSVPCAQQ  426



>gb|EAY92107.1| hypothetical protein OsI_13813 [Oryza sativa Indica Group]
Length=417

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRKGDD+F EHTL LTEALCGFQFVLTHLDNRQLLIKS+PGE
Sbjct  246  TVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLNLTEALCGFQFVLTHLDNRQLLIKSKPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKA+NDEGMPMYQ+PFM+GKLYIHF+V+FP++L PDQCKALE VLPPRP ++ T
Sbjct  306  VVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPDQCKALETVLPPRPVSQYT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEEMRR+QQQQ QE Y+EDEDMH GGAQRVQCAQQ
Sbjct  366  DMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDEDMHGGGAQRVQCAQQ  417



>ref|NP_001051497.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|AAT75262.1| putative DnaJ like protein [Oryza sativa Japonica Group]
 gb|ABF99246.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13411.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|EAZ28837.1| hypothetical protein OsJ_12871 [Oryza sativa Japonica Group]
 dbj|BAG87697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRKGDD+F EHTL LTEALCGFQFVLTHLDNRQLLIKS+PGE
Sbjct  246  TVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLNLTEALCGFQFVLTHLDNRQLLIKSKPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKA+NDEGMPMYQ+PFM+GKLYIHF+V+FP++L PDQCKALE VLPPRP ++ T
Sbjct  306  VVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDSLNPDQCKALETVLPPRPVSQYT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEET  YDVNIEEEMRR+QQQQ QE Y+EDEDMH GGAQRVQCAQQ
Sbjct  366  DMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDEDMHGGGAQRVQCAQQ  417



>ref|XP_004291528.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=423

 Score =   284 bits (726),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 152/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF++QQKEH KFKRKGDD+FVEH+L LT+ALCGFQFVL HLD RQLLIKS PGE
Sbjct  252  TITGDIVFIIQQKEHPKFKRKGDDLFVEHSLLLTDALCGFQFVLNHLDGRQLLIKSNPGE  311

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPAT-KI  398
            VVKPD FKA+NDEGMPMY +PFM+GKLYIHF+V+FPETL+ +Q KALEA LP R ++ ++
Sbjct  312  VVKPDSFKAVNDEGMPMYGRPFMKGKLYIHFSVEFPETLSLEQVKALEAALPTRASSQQL  371

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            TDMELDECEETTL+DVN+EEEMRRKQ     E Y+EDEDM GGAQRVQCAQQ
Sbjct  372  TDMELDECEETTLHDVNMEEEMRRKQHHAHSEAYDEDEDMPGGAQRVQCAQQ  423



>ref|XP_006340318.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X1 [Solanum 
tuberosum]
Length=419

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 156/172 (91%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGD+VFVLQQKEH KFKRKG+D+FV+HTLTLTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  249  TVTGDVVFVLQQKEHPKFKRKGEDLFVDHTLTLTEALCGFQFILTHLDGRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++L+  Q + LEA+LPPRP ++ +
Sbjct  309  VVKPDQFKAINDEGMPVYQRPFMKGKLYIHFTVEFPDSLSLPQVQLLEAILPPRPTSQYS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHG-GAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRKQ  Q QE Y+EDE+M G G QRVQCAQQ
Sbjct  369  DMELDECEETTLHDVNMEEEMRRKQAAQ-QEAYDEDEEMSGSGGQRVQCAQQ  419



>ref|XP_007150008.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
 gb|ESW22002.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
Length=418

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 156/172 (91%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  248  TITGDIVFVLQQKEHPKFKRKIEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPAT-KI  398
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP++L+PDQ  A+EAVLP + +  K+
Sbjct  308  VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLSPDQVTAIEAVLPAKTSPQKL  367

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            T+MELDECEETTL+ VN+EEE+RR+ QQ  QE YEED+DMHGGAQRVQCAQQ
Sbjct  368  TEMELDECEETTLHGVNMEEELRRR-QQIPQEAYEEDDDMHGGAQRVQCAQQ  418



>ref|XP_007015640.1| DNAJ isoform 1 [Theobroma cacao]
 gb|EOY33259.1| DNAJ isoform 1 [Theobroma cacao]
Length=431

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS  GE
Sbjct  246  TITGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNSGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            +VKPD FKAINDEGMP+YQ+PFM+GKLYIHFTVDFP++L+PDQ +ALEA+LPP+P +++T
Sbjct  306  IVKPDSFKAINDEGMPLYQRPFMKGKLYIHFTVDFPDSLSPDQVQALEAILPPKPTSQLT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRV  257
            DMELDECEETTL+DVNIEEEMRRK QQ AQE  +E E+MHGGAQR+
Sbjct  366  DMELDECEETTLHDVNIEEEMRRK-QQAAQETLDE-EEMHGGAQRL  409



>ref|XP_002874044.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50303.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  249  TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDKRQLLIKSSPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FPE+L+PDQ KA+EAVLP      I+
Sbjct  309  VVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLPKPTKAAIS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EM+RK Q Q +E Y++DED H GGAQRVQCAQQ
Sbjct  369  DMEIDECEETTLHDVNIEDEMKRKAQAQ-REAYDDDEDEHPGGAQRVQCAQQ  419



>ref|NP_001275059.1| DnaJ-like protein [Solanum tuberosum]
 gb|ABB55383.1| DnaJ-like protein-like [Solanum tuberosum]
Length=445

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 154/169 (91%), Gaps = 4/169 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC-GFQFV-LTHLDNRQLLIKSQP  581
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL L    C GFQF+ LTHLD RQL+IK QP
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLKLKPRPCVGFQFIFLTHLDYRQLIIKPQP  308

Query  580  GEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK  401
            GEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+TL+P+QCK LEAVLPP+P T+
Sbjct  309  GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDTLSPEQCKNLEAVLPPKPKTQ  368

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDEDMHGGAQRV  257
            +TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DEDMHGGAQRV
Sbjct  369  MTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDEDMHGGAQRV  416



>ref|XP_008660777.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=324

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F EHTLTL E+LC FQFVLTH+DNRQ+LIK   GE
Sbjct  155  TATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLIESLCSFQFVLTHMDNRQMLIKLNHGE  214

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP+ FKAINDEGMPMYQ+PF++GKLYIHF+V+F ++L+P+QCKALE VLPP+P ++ T
Sbjct  215  VVKPNSFKAINDEGMPMYQRPFIKGKLYIHFSVEFSDSLSPEQCKALEVVLPPKPVSQYT  274

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECE+T  YDVNIEEEMRR+QQQ  QE Y+ED+++ GG QRVQCAQQ
Sbjct  275  DMELDECEDTMPYDVNIEEEMRRRQQQH-QEAYDEDDNVPGGGQRVQCAQQ  324



>ref|XP_003558043.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRK DD+F EHTLTLTEALCGFQ+VLTHLD RQLLIKS PGE
Sbjct  249  TLTGDIIFVLQQKEHPKFKRKSDDLFYEHTLTLTEALCGFQYVLTHLDGRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++L PDQCKALEAVLPP+PA++ T
Sbjct  309  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLNPDQCKALEAVLPPKPASQYT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            DMELDECEET  YD++IEEEMRR+QQQQ QE Y+EDEDM  GG QRVQCAQQ
Sbjct  369  DMELDECEETMAYDIDIEEEMRRRQQQQQQEAYDEDEDMPGGGGQRVQCAQQ  420



>gb|ABK21047.1| unknown [Picea sitchensis]
Length=189

 Score =   269 bits (687),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 154/173 (89%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ K+H+KFKRKGDD++VEHTL LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  19   TITGDIVFVLQLKDHSKFKRKGDDLYVEHTLNLTEALCGFQFPLTHLDGRQLLIKSSPGE  78

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            ++KP Q+KAINDEGMP YQ+PFM+G+LYIHF V+FPE+  L+P+QCKALE++LPPRPA  
Sbjct  79   IIKPSQYKAINDEGMPQYQRPFMKGRLYIHFNVEFPESGALSPEQCKALESILPPRPAGY  138

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDMELDECEETTL+DVNIE+E+RRKQQQQ QE YEED++  G   RVQCAQQ
Sbjct  139  MTDMELDECEETTLHDVNIEDELRRKQQQQQQEAYEEDDEPQG--HRVQCAQQ  189



>ref|XP_011008852.1| PREDICTED: dnaJ protein homolog isoform X1 [Populus euphratica]
Length=415

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 152/171 (89%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEH L LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  247  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHVLPLTEALCGFQFVLTHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
             VKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++LTPDQ KA+E +L PRP+ ++T
Sbjct  307  AVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLTPDQVKAIETIL-PRPSRQLT  365

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQQ + +   E++E  HGG QRVQCAQQ
Sbjct  366  DMELDECEETTLHDVNIEEEMRRKQQAREEAYEEDEEMPHGG-QRVQCAQQ  415



>ref|XP_011008853.1| PREDICTED: dnaJ protein homolog isoform X2 [Populus euphratica]
Length=409

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 152/171 (89%), Gaps = 2/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEH L LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  241  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHVLPLTEALCGFQFVLTHLDGRQLLIKSNPGE  300

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
             VKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++LTPDQ KA+E +L PRP+ ++T
Sbjct  301  AVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLTPDQVKAIETIL-PRPSRQLT  359

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+DVNIEEEMRRKQQ + +   E++E  HGG QRVQCAQQ
Sbjct  360  DMELDECEETTLHDVNIEEEMRRKQQAREEAYEEDEEMPHGG-QRVQCAQQ  409



>ref|XP_010544327.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
 ref|XP_010544328.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
Length=419

 Score =   276 bits (707),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 155/175 (89%), Gaps = 4/175 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGD+VFV+QQKEH KFKRKG+++F EHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  245  TVTGDVVFVIQQKEHPKFKRKGENLFYEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  304

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVL-PPRPATKI  398
            VVKPD FKAI+DEGMP++Q+PFM+GKLYIHF V+FP++L+ DQ KALEA+L PPR +++ 
Sbjct  305  VVKPDSFKAIDDEGMPVHQRPFMKGKLYIHFMVEFPDSLSSDQVKALEAILPPPRTSSQF  364

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQ-QAQEVYEEDED--MHGGAQRVQCAQQ  242
            TDMELDECEETTL+DVNIEEEMRRK QQ Q  E YEED D   HGGAQRVQCAQQ
Sbjct  365  TDMELDECEETTLHDVNIEEEMRRKHQQPQRGEAYEEDGDDSGHGGAQRVQCAQQ  419



>sp|P43644.1|DNJH_ATRNU RecName: Full=DnaJ protein homolog ANJ1; Flags: Precursor [Atriplex 
nummularia]
Length=417

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+F EHTL+LTEALCGF+FVLTHLD RQLLIKS  GE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALCGFRFVLTHLDGRQLLIKSNLGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAI DEGMP+YQ+PFM+GK+YIHFTV+FP++L PDQ K+LEA+LPP+P+  +T
Sbjct  308  VVKPDQFKAIEDEGMPIYQRPFMKGKMYIHFTVEFPDSLNPDQVKSLEAILPPKPSMSLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
             MELDECEETTL++VNIEEEM+RKQ Q  QE Y+ED++  GG QRVQCAQQ
Sbjct  368  YMELDECEETTLHNVNIEEEMKRKQTQAQQEAYDEDDEPAGG-QRVQCAQQ  417



>ref|NP_568412.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
 sp|P42825.2|DNAJ2_ARATH RecName: Full=Chaperone protein dnaJ 2; Short=AtDjA2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC34499.1| DNAJ PROTEIN HOMOLOG ATJ [Arabidopsis thaliana]
 dbj|BAC42997.1| putative DnaJ protein homolog ATJ [Arabidopsis thaliana]
 gb|ABH04586.1| At5g22060 [Arabidopsis thaliana]
 gb|AED92977.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
Length=419

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 156/172 (91%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKG+D+FVEHT++LTEALCGFQFVLTHLD RQLLIKS+PGE
Sbjct  249  TVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQFVLTHLDKRQLLIKSKPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FPE+L+PDQ KA+EAVLP      I+
Sbjct  309  VVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLPKPTKAAIS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DME+D+CEETTL+DVNIE+EM+RK Q Q +E Y++DE+ H GGAQRVQCAQQ
Sbjct  369  DMEIDDCEETTLHDVNIEDEMKRKAQAQ-REAYDDDEEDHPGGAQRVQCAQQ  419



>ref|XP_004251216.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=418

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGD+VFVLQQK+H KFKRKGDD+FV+HTLTLTEALCGFQF+L HLD R+LL+KS PGE
Sbjct  248  TVTGDVVFVLQQKDHPKFKRKGDDLFVDHTLTLTEALCGFQFILAHLDGRRLLVKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFM+GKLYIHF V+FP++L+  Q + LEA+LP RP ++ +
Sbjct  308  VVKPDQFKAINDEGMPVYQRPFMKGKLYIHFIVEFPDSLSLPQVQLLEAMLPSRPTSQYS  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEETTL+DVN+EEEMRRKQ  Q QE Y+EDE+M  GG QRVQCAQQ
Sbjct  368  DMELDECEETTLHDVNMEEEMRRKQAAQ-QEAYDEDEEMSGGGGQRVQCAQQ  418



>ref|XP_006400711.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
 gb|ESQ42164.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
Length=420

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  250  TVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDTRQLLIKSNPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD ++AI+DEGMP++Q+PFM+GKLYIHFTV+FPE+L+PDQ KA+EAVLP      ++
Sbjct  310  VVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLPKPSKAALS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q Q +   +++ED  GGAQRVQCAQQ
Sbjct  370  DMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDEEDGPGGAQRVQCAQQ  420



>emb|CAC12824.1| putative DNAJ protein [Nicotiana tabacum]
Length=418

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
             ITGDIVFVLQQK+    KRKGDD+FV+HTL+LTEALCGFQF++THLD RQLLIKS  GE
Sbjct  248  AITGDIVFVLQQKDTRGSKRKGDDLFVDHTLSLTEALCGFQFIMTHLDGRQLLIKSNLGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEG PMYQ+PFMRGKLYI F V+FP++L  +Q KALEA+LPPRP ++ T
Sbjct  308  VVKPDQFKAINDEGTPMYQRPFMRGKLYIRFVVEFPDSLNTEQVKALEAILPPRPQSQYT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++MH GG QRVQCAQQ
Sbjct  368  DMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDEMHGGGGQRVQCAQQ  418



>gb|EMS60670.1| DnaJ protein-like protein [Triticum urartu]
Length=446

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTEALCGFQ+VL HLD RQLLIKS PGE
Sbjct  275  TVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALCGFQYVLAHLDGRQLLIKSNPGE  334

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++L+ DQCKALE VLPP+PA++ T
Sbjct  335  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLSLDQCKALETVLPPKPASQYT  394

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            DMELDECEET  YD++IEEEMRR+QQQQAQE Y+EDEDM  GG QRVQCAQQ
Sbjct  395  DMELDECEETMAYDIDIEEEMRRRQQQQAQEAYDEDEDMPGGGGQRVQCAQQ  446



>ref|XP_001782829.1| predicted protein [Physcomitrella patens]
 gb|EDQ52343.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 152/173 (88%), Gaps = 5/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQ K+H KFKRKGDD+FVEH+L LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  246  TVTGDIVFVLQLKDHPKFKRKGDDLFVEHSLNLTEALCGFQFPLTHLDGRQLLIKSNPGE  305

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            +VKP QFKAINDEGMP YQ+PFM+G+LY+HF+V+FPE+  LTP+Q KALE +LPPRP ++
Sbjct  306  IVKPGQFKAINDEGMPHYQRPFMKGRLYLHFSVEFPESGALTPEQLKALEVILPPRPTSQ  365

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDMELDECEETTL DVNIE+EMRRKQQQQ QE Y+EDE+  G   R+QCAQQ
Sbjct  366  MTDMELDECEETTLIDVNIEDEMRRKQQQQ-QEAYDEDEESSG--PRIQCAQQ  415



>gb|AAB86799.1| putative [Arabidopsis thaliana]
 prf||2118338A AtJ2 protein
Length=419

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKG+D+FVEHT++LTEALCGFQFVLTHLD RQLLIKS+PGE
Sbjct  249  TVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQFVLTHLDKRQLLIKSKPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ PFM+GKLYIHFTV+FPE+L+PDQ KA+EAVLP      I+
Sbjct  309  VVKPDSYKAISDEGMPIYQSPFMKGKLYIHFTVEFPESLSPDQTKAIEAVLPKPTKAAIS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DME+D+CEETTL+DVNIE+EM+RK Q Q +E Y+ DE+ H GGA RVQCAQQ
Sbjct  369  DMEIDDCEETTLHDVNIEDEMKRKAQAQ-REAYDVDEEDHPGGAHRVQCAQQ  419



>ref|XP_010919645.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
 ref|XP_010919646.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 148/173 (86%), Gaps = 5/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+F+LQQKEH KFKRK DD+FVEHTL LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIIFMLQQKEHPKFKRKYDDLFVEHTLCLTEALCGFQFALTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KP QFKAINDEGMP + +PFM+G+LYI F V+FP++  L+PDQC  LE +LPPRP+  
Sbjct  308  VIKPGQFKAINDEGMPHHGRPFMKGRLYIQFNVEFPDSGALSPDQCHVLETLLPPRPSNH  367

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++DMELDECEETTLYDVN+EEEMRRKQQQQ QE Y+EDED    A RVQCAQQ
Sbjct  368  LSDMELDECEETTLYDVNMEEEMRRKQQQQPQEAYDEDED---AAPRVQCAQQ  417



>gb|ACN39991.1| unknown [Picea sitchensis]
Length=421

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 154/173 (89%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ K+H+KFKRKGDD++VEHTL LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  251  TITGDIVFVLQLKDHSKFKRKGDDLYVEHTLNLTEALCGFQFPLTHLDGRQLLIKSSPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            ++KP Q+KAINDEGMP YQ+PFM+G+LYIHF V+FPE+  L+P+QCKALE++LPPRPA  
Sbjct  311  IIKPSQYKAINDEGMPQYQRPFMKGRLYIHFNVEFPESGALSPEQCKALESILPPRPAGY  370

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDMELDECEETTL+DVNIE+E+RRKQQQQ QE YEED++  G   RVQCAQQ
Sbjct  371  MTDMELDECEETTLHDVNIEDELRRKQQQQQQEAYEEDDEPQG--HRVQCAQQ  421



>ref|XP_010521621.1| PREDICTED: dnaJ protein homolog ANJ1-like [Tarenaya hassleriana]
Length=423

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 149/173 (86%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQQKEH KFKRKGDD+F EHTL LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  251  TITGDIVFILQQKEHPKFKRKGDDLFYEHTLCLTEALCGFQFVLTHLDGRQLLIKSNPGE  310

Query  574  VVKPDQFKAINDEGM--PMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK  401
            VVKP +    +  G   PMYQ+PFM+GKLYIHFTV+FPETL PDQ KALE VLPP+P+T+
Sbjct  311  VVKPGKHFPRSGFGCHPPMYQRPFMKGKLYIHFTVEFPETLKPDQVKALEKVLPPKPSTQ  370

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +++MELDECEETTL+DVNIEEEMRRKQQ Q QE Y+ED+D   GAQRVQCAQQ
Sbjct  371  MSEMELDECEETTLHDVNIEEEMRRKQQSQQQEAYDEDDDEPHGAQRVQCAQQ  423



>gb|ABG78615.1| J-domain protein [Triticum aestivum]
Length=420

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTEALCGFQ+VL HLD RQLLIKS PGE
Sbjct  249  TVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALCGFQYVLAHLDGRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            V KPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++L  DQCKALE VLPP+PA++ T
Sbjct  309  VAKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDSLNLDQCKALETVLPPKPASQYT  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            DMELDECEET  YD++IEEEMRR+QQQQAQE Y+EDEDM  GG QRVQCAQQ
Sbjct  369  DMELDECEETMAYDIDIEEEMRRRQQQQAQEAYDEDEDMPGGGGQRVQCAQQ  420



>gb|AFW86285.1| putative dnaJ chaperone family protein [Zea mays]
Length=641

 Score =   277 bits (708),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F EHTLTL E+LC FQFVLTH+DNRQ+LIK   GE
Sbjct  472  TATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLIESLCSFQFVLTHMDNRQMLIKLNHGE  531

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP+ FKAINDEGMPMYQ+PF++GKLYIHF+V+F ++L+P+QCKALE VLPP+P ++ T
Sbjct  532  VVKPNSFKAINDEGMPMYQRPFIKGKLYIHFSVEFSDSLSPEQCKALEVVLPPKPVSQYT  591

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECE+T  YDVNIEEEMRR+QQQ  QE Y+ED+++ GG QRVQCAQQ
Sbjct  592  DMELDECEDTMPYDVNIEEEMRRRQQQH-QEAYDEDDNVPGGGQRVQCAQQ  641



>gb|KFK26344.1| hypothetical protein AALP_AA8G235700 [Arabis alpina]
Length=421

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 156/174 (90%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  249  TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDKRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLP-PRPATKI  398
            VVKPD +KAI++EGMP+YQ+PFM+GKLYIHFTV+FP++L+PDQ KA+EAVLP P  A + 
Sbjct  309  VVKPDSYKAISEEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKAIEAVLPKPAKAAQT  368

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH--GGAQRVQCAQQ  242
            +DM++DECEETTL+DVNIE+EM+RK Q Q +E Y++D++    GGAQRVQCAQQ
Sbjct  369  SDMDIDECEETTLHDVNIEDEMKRKAQAQ-REAYDDDDEGEGPGGAQRVQCAQQ  421



>ref|XP_001774283.1| predicted protein [Physcomitrella patens]
 gb|EDQ60919.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 151/173 (87%), Gaps = 5/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQ KEH KFKRKGDD+FVEHTL+LTEALCGFQF LTHLD RQLLIK+ PGE
Sbjct  248  TVTGDIVFVLQLKEHPKFKRKGDDLFVEHTLSLTEALCGFQFPLTHLDGRQLLIKTNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE--TLTPDQCKALEAVLPPRPATK  401
            +VKP QFKAINDEGMP YQ+PFM+GKLY+HFTV+FPE  +L+ +QC+ LE++LPPR ++ 
Sbjct  308  IVKPGQFKAINDEGMPQYQRPFMKGKLYLHFTVEFPESGSLSSEQCRMLESILPPRASSH  367

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDM+LDECEETTL DVNIEEEMRRK QQQ QE Y+EDE+  G   R+QCAQQ
Sbjct  368  LTDMDLDECEETTLIDVNIEEEMRRKHQQQ-QEAYDEDEESSG--PRIQCAQQ  417



>ref|XP_002275918.1| PREDICTED: dnaJ protein homolog 2 [Vitis vinifera]
Length=419

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 152/173 (88%), Gaps = 3/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ K+HAKFKRK DD++VEHTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  248  TITGDIVFVLQLKDHAKFKRKYDDLYVEHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            ++KPDQ+KAINDEGMP +Q+PFM+GKLYIHF V+FPE+  L+PDQCKALE++LP + + +
Sbjct  308  IIKPDQYKAINDEGMPHHQRPFMKGKLYIHFDVEFPESGILSPDQCKALESILPQKRSKQ  367

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            I+ ME+DE EETTLYDVNIEEEMRRKQQQQ  E Y+ED+D   GA RVQCAQQ
Sbjct  368  ISAMEVDEAEETTLYDVNIEEEMRRKQQQQQHEAYDEDDDDF-GAPRVQCAQQ  419



>ref|XP_009120689.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
Length=422

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 155/174 (89%), Gaps = 5/174 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  251  TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDKRQLLIKSSPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD ++AI DEGMPM+Q+PFM+GKLYIHFTVDFP++L+PDQ KA+EAVL P+P   ++
Sbjct  311  VVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDSLSPDQTKAIEAVL-PKPKADLS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL++VNIE+EMRRK Q Q +E Y   ++DE+  GGAQRVQCAQQ
Sbjct  370  DMEIDECEETTLHEVNIEDEMRRKAQAQ-REAYDDDDDDEEGPGGAQRVQCAQQ  422



>emb|CDX92385.1| BnaA10g14240D [Brassica napus]
Length=422

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 155/174 (89%), Gaps = 5/174 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  251  TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDKRQLLIKSSPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD ++AI DEGMPM+Q+PFM+GKLYIHFTVDFP++L+PDQ KA+EAVL P+P   ++
Sbjct  311  VVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDSLSPDQTKAIEAVL-PKPKADLS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL++VNIE+EMRRK Q Q +E Y   ++DE+  GGAQRVQCAQQ
Sbjct  370  DMEIDECEETTLHEVNIEDEMRRKAQAQ-REAYDDDDDDEEGPGGAQRVQCAQQ  422



>ref|XP_002969107.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
 ref|XP_002973957.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ24912.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ30223.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
Length=414

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 157/173 (91%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDI+FVLQQKEH KFKRKGDD+F+EH+L+L +ALCGFQF +THLD RQLL+KS+PGE
Sbjct  244  TITGDIIFVLQQKEHPKFKRKGDDLFLEHSLSLLDALCGFQFTITHLDGRQLLVKSRPGE  303

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE--TLTPDQCKALEAVLPPRPATK  401
            ++KP QFKAINDEGMP +Q+PFM+G LYIHF+VDFPE  +LTP+QCKALEAVLPPRP+++
Sbjct  304  IIKPGQFKAINDEGMPHHQRPFMKGTLYIHFSVDFPESGSLTPEQCKALEAVLPPRPSSQ  363

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +T+MELDECEETTL+DVN+EEEMR+KQQQQ QE Y+ED++  G   RVQCAQQ
Sbjct  364  LTEMELDECEETTLHDVNLEEEMRKKQQQQQQEAYDEDDEPAG--PRVQCAQQ  414



>ref|XP_009120690.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
Length=422

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 155/174 (89%), Gaps = 5/174 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  251  TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDKRQLLIKSSPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD ++AI DEGMPM+Q+PFM+GKLYIHFTVDFP++L+PDQ KA+EAVL P+P   ++
Sbjct  311  VVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDSLSPDQTKAIEAVL-PKPKADLS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL++VNIE+EMRRK Q Q +E Y   ++DE+  GGAQRVQCAQQ
Sbjct  370  DMEIDECEETTLHEVNIEDEMRRKAQAQ-REAYDDDDDDEEGPGGAQRVQCAQQ  422



>emb|CDX92386.1| BnaA10g14250D [Brassica napus]
Length=422

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 154/174 (89%), Gaps = 5/174 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  251  TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDKRQLLIKSSPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD ++AI DEGMPM+Q+PFM+GKLYIHFTVDFP++L+PDQ KA+EAVL P+P   ++
Sbjct  311  VVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDSLSPDQTKAIEAVL-PKPKADLS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNI +EMRRK Q Q +E Y   ++DE+  GGAQRVQCAQQ
Sbjct  370  DMEIDECEETTLHDVNIGDEMRRKAQAQ-REAYDDDDDDEEGPGGAQRVQCAQQ  422



>gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thaliana]
Length=420

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 154/174 (89%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD R LLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++L+PDQ KALEAVLP     +++
Sbjct  308  VVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPKPSTAQLS  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH---GGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D++     GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDEDDDHPGGAQRVQCAQQ  420



>ref|NP_189997.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 sp|Q94AW8.2|DNAJ3_ARATH RecName: Full=Chaperone protein dnaJ 3; Short=AtDjA3; Short=AtJ3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86892.1| AtJ3 [Arabidopsis thaliana]
 emb|CAB88419.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAK59592.1| putative dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAM44926.1| putative DnaJ-like protein atj3 [Arabidopsis thaliana]
 gb|AAM65624.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 dbj|BAE98606.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AEE77863.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=420

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 154/174 (89%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD R LLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++L+PDQ KALEAVLP     +++
Sbjct  308  VVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPKPSTAQLS  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH---GGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D++     GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDEDDDHPGGAQRVQCAQQ  420



>ref|XP_011088982.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=413

 Score =   268 bits (684),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 149/172 (87%), Gaps = 7/172 (4%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+        TEALCGFQF+L+HLD RQLLIKSQPGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDL----XXXXTEALCGFQFILSHLDGRQLLIKSQPGE  303

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKP+ +KAINDEGMPMYQ+PFM+GKLYIHF V+FP++L+ DQ  ALE +LPP+P +++T
Sbjct  304  VVKPNSYKAINDEGMPMYQRPFMKGKLYIHFNVEFPDSLSLDQVGALEKILPPKPQSQLT  363

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEE-DEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q   QE YEE DEDMHGGAQRVQCAQQ
Sbjct  364  DMEIDECEETTLHDVNIEDEMRRKAQH--QEAYEEDDEDMHGGAQRVQCAQQ  413



>ref|XP_010420996.1| PREDICTED: chaperone protein dnaJ 2 isoform X1 [Camelina sativa]
 ref|XP_010420997.1| PREDICTED: chaperone protein dnaJ 2 isoform X2 [Camelina sativa]
Length=421

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH  FKRKGDD+FVEHTL+LTEALCGFQFVLTHLD+R+LLIKS PGE
Sbjct  251  TVTGDIVFVIQQKEHPMFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDSRKLLIKSNPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGM MYQ+PFM+GKLYIHFTV+FPE+L+PDQ K +E VLP      ++
Sbjct  311  VVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPESLSPDQTKTIEEVLPKPTKATMS  370

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DM++D+CEETTL+DVNIE+EMRRK Q Q +E Y++D++ H GGAQRVQCAQQ
Sbjct  371  DMDIDDCEETTLHDVNIEDEMRRKAQTQ-REAYDDDDEEHPGGAQRVQCAQQ  421



>ref|XP_002877319.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53578.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD R LLIKS PGE
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRNLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++L+PDQ KALEAVLP    T+++
Sbjct  309  VVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPKPSTTQLS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH---GGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EM+RK Q Q +E Y++D++     GGAQRVQCAQQ
Sbjct  369  DMEIDECEETTLHDVNIEDEMKRKAQAQ-REAYDDDDEDDDHPGGAQRVQCAQQ  421



>ref|XP_010454471.1| PREDICTED: chaperone protein dnaJ 2 [Camelina sativa]
Length=420

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVL HLD+R+LLIKS PGE
Sbjct  250  TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLNHLDSRKLLIKSNPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGM MYQ+PFM+GKLYIHFTV+FPE+L+PDQ K +E VLP      ++
Sbjct  310  VVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPESLSPDQTKTIEEVLPKPTKATMS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DM++D+CEETTL+DVNIE+EMRRK Q Q +E Y++D++ H GG QRVQCAQQ
Sbjct  370  DMDIDDCEETTLHDVNIEDEMRRKAQAQ-REAYDDDDEEHPGGGQRVQCAQQ  420



>ref|XP_006292339.1| hypothetical protein CARUB_v10018551mg [Capsella rubella]
 gb|EOA25237.1| hypothetical protein CARUB_v10018551mg [Capsella rubella]
Length=420

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 154/174 (89%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD R LLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRNLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++L+PDQ KALEAVLP     +++
Sbjct  308  VVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPKPSTAQLS  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH---GGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D+D     GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDDDDDHPGGAQRVQCAQQ  420



>ref|XP_010089281.1| DnaJ-like protein [Morus notabilis]
 gb|EXB37606.1| DnaJ-like protein [Morus notabilis]
Length=419

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 148/173 (86%), Gaps = 3/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQ KEH +FKRK DD++VEHTL+LTEALCGFQF L HLD RQLLIKS PGE
Sbjct  248  TITGDIVFILQLKEHPRFKRKYDDLYVEHTLSLTEALCGFQFALNHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            ++KPDQ+KAINDEGMP +Q+PFM+G+LYIHF V FP+   L+PDQC+ LE +LPPRP+  
Sbjct  308  IIKPDQYKAINDEGMPHHQRPFMKGRLYIHFNVVFPDAGVLSPDQCRTLEKILPPRPSKC  367

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDME+D+CEETTL+DVNIEEEMRRKQQQQ QE Y+ED+D      RVQCAQQ
Sbjct  368  LTDMEVDDCEETTLHDVNIEEEMRRKQQQQYQEAYDEDDD-ESSMPRVQCAQQ  419



>ref|XP_006404506.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
 gb|ESQ45959.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
Length=421

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD R LL+KS PGE
Sbjct  249  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRNLLVKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++L+P+Q KALEAVLP    T+++
Sbjct  309  VVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPNQTKALEAVLPKPSTTQLS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q Q +E Y   ++D++  GGAQRVQCAQQ
Sbjct  369  DMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDDDDEHPGGAQRVQCAQQ  421



>dbj|BAJ91943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+FVLQQKEH KFKRK DD+F EHTLTLTEALCGFQ+VL HLD RQLLIKS PGE
Sbjct  250  TVTGDIIFVLQQKEHPKFKRKADDLFYEHTLTLTEALCGFQYVLAHLDGRQLLIKSNPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTV FP++L+ DQCKALE VLPP+PA++ T
Sbjct  310  VVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVVFPDSLSLDQCKALETVLPPKPASQYT  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDM-HGGAQRVQCAQQ  242
            DMELDECEET  YD++IEEEMRR+QQQQAQE Y+EDEDM  GG QRVQCAQQ
Sbjct  370  DMELDECEETMAYDIDIEEEMRRQQQQQAQEAYDEDEDMPGGGGQRVQCAQQ  421



>ref|XP_010427107.1| PREDICTED: chaperone protein dnaJ 3 isoform X1 [Camelina sativa]
 ref|XP_010427108.1| PREDICTED: chaperone protein dnaJ 3 isoform X2 [Camelina sativa]
Length=420

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 153/174 (88%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD R LLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTVDFP++L+P+Q KALEAVLP     ++ 
Sbjct  308  VVKPDSYKAISDEGMPVYQRPFMKGKLYIHFTVDFPDSLSPEQTKALEAVLPKPSTAQLN  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH---GGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D+D     GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDDDDDHPGGAQRVQCAQQ  420



>ref|XP_010514755.1| PREDICTED: chaperone protein dnaJ 3-like [Camelina sativa]
Length=420

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 153/174 (88%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALCGFQFVLTHLD R LLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTVDFP++L+P+Q KALEAVLP     ++ 
Sbjct  308  VVKPDSYKAISDEGMPVYQRPFMKGKLYIHFTVDFPDSLSPEQTKALEAVLPKPSTAQLN  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH---GGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D+D     GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDDDDDHPGGAQRVQCAQQ  420



>ref|XP_010535721.1| PREDICTED: chaperone protein dnaJ 3 [Tarenaya hassleriana]
Length=423

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 158/177 (89%), Gaps = 7/177 (4%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH +FKRKGDD+FVEHTL+LTEALCGFQF  THLD RQLLI+S PGE
Sbjct  248  TVTGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLTEALCGFQFAQTHLDGRQLLIRSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPAT---  404
            VVKPD +KAINDEGMP+YQ+PFM+GKLYIHF+V+FPE+L+PDQ KA+EAVLP RP++   
Sbjct  308  VVKPDSYKAINDEGMPIYQRPFMKGKLYIHFSVEFPESLSPDQAKAIEAVLPGRPSSSKK  367

Query  403  KITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHG--GAQRVQCAQQ  242
            ++T+ME+DECEETTL+DV N+EEEMRRKQQ Q +E Y++D+D  G  GAQRVQCAQQ
Sbjct  368  QLTEMEIDECEETTLHDVSNMEEEMRRKQQAQ-REAYDDDDDDDGPHGAQRVQCAQQ  423



>gb|AAB49030.1| DnaJ homolog [Arabidopsis thaliana]
Length=420

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 154/174 (89%), Gaps = 4/174 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH +FKRKG+D+FVEHTL+LTEALCGFQFVLTHLD R LLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPQFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++L+PDQ KALEAVLP     +++
Sbjct  308  VVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPKPSTAQLS  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH---GGAQRVQCAQQ  242
            DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D++     GGAQRVQCAQQ
Sbjct  368  DMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDEDDDHPGGAQRVQCAQQ  420



>ref|XP_009126521.1| PREDICTED: chaperone protein dnaJ 3 [Brassica rapa]
Length=423

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 157/175 (90%), Gaps = 6/175 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH+ FKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  251  TVTGDIVFVIQQKEHSTFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDTRQLLIKSSPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK-I  398
            VVKPD ++AI+DEGMP++Q+PFM+GKLYIHFTV+FP++L+PDQ KA+EAVL PRPA   +
Sbjct  311  VVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPDSLSPDQTKAIEAVL-PRPANATL  369

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            +DME+DECEETTL+DVNIE+EMRRK Q Q +E Y   ++DE+  GGAQRVQCAQQ
Sbjct  370  SDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDDDEEGPGGAQRVQCAQQ  423



>emb|CDY09117.1| BnaA02g05430D [Brassica napus]
Length=423

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 157/175 (90%), Gaps = 6/175 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH+ FKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  251  TVTGDIVFVIQQKEHSTFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDTRQLLIKSNPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK-I  398
            VVKPD ++AI+DEGMP++Q+PFM+GKLYIHFTV+FP++L+PDQ KA+EAVL PRPA   +
Sbjct  311  VVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPDSLSPDQTKAIEAVL-PRPANATL  369

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            +DME+DECEETTL+DVNIE+EMRRK Q Q +E Y   ++DE+  GGAQRVQCAQQ
Sbjct  370  SDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDDDEEGPGGAQRVQCAQQ  423



>ref|XP_006287824.1| hypothetical protein CARUB_v10001042mg [Capsella rubella]
 gb|EOA20722.1| hypothetical protein CARUB_v10001042mg [Capsella rubella]
Length=421

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 152/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD+R+LLIKS PGE
Sbjct  250  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDSRKLLIKSNPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGM +YQ+PFM+GKLYIHFTV FPE+L+PDQ KA+EAVLP      ++
Sbjct  310  VVKPDSYKAINDEGMVIYQRPFMKGKLYIHFTVVFPESLSPDQTKAIEAVLPKPTKAAMS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DM++D+CEETTL+DVNIE+EMRRK Q Q +   ++D++ H GGAQRVQCAQQ
Sbjct  370  DMDIDDCEETTLHDVNIEDEMRRKAQAQREAYDDDDDEDHPGGAQRVQCAQQ  421



>ref|XP_010520679.1| PREDICTED: chaperone protein dnaJ 3-like [Tarenaya hassleriana]
Length=484

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQKEH +FKRKGDD+FVEHTL+L EALCGFQFVLTHLD+RQLLI+S PGE
Sbjct  313  TITGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLAEALCGFQFVLTHLDDRQLLIRSSPGE  372

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPA-TKI  398
            VVKPD +KAINDEGMP+YQ+PFM+GKLYIHF+V+FPE+L+PDQ KALEAVLP +P+  ++
Sbjct  373  VVKPDSYKAINDEGMPVYQRPFMKGKLYIHFSVEFPESLSPDQAKALEAVLPQKPSGNQL  432

Query  397  TDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            T+ME+DECEETTL+ VN+EEEMRRKQQ Q +   ++D+D   G QRVQCAQQ
Sbjct  433  TEMEIDECEETTLHQVNMEEEMRRKQQSQREAYDDDDDDGDDGPQRVQCAQQ  484



>emb|CDY16617.1| BnaC09g36560D [Brassica napus]
Length=208

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 5/174 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  37   TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDKRQLLIKSSPGE  96

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD ++AI DEGMP++Q+PFM+GKLYIHFTVDFP++L+PDQ KA+EAVL P+P   ++
Sbjct  97   VVKPDSYRAITDEGMPVHQRPFMKGKLYIHFTVDFPDSLSPDQTKAIEAVL-PKPKADLS  155

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            DME DECEETTL++VNIE+EMRRK Q Q +E Y   ++DE+  GG QRVQCAQQ
Sbjct  156  DMETDECEETTLHEVNIEDEMRRKAQAQ-REAYDDDDDDEEGPGGPQRVQCAQQ  208



>ref|XP_010493266.1| PREDICTED: chaperone protein dnaJ 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010493267.1| PREDICTED: chaperone protein dnaJ 2-like isoform X2 [Camelina 
sativa]
Length=420

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+Q KEH KFKRKGDD+FVEHTL+LTEALCGF FVLTHLD+R+LLIKS PGE
Sbjct  250  TVTGDIVFVIQLKEHPKFKRKGDDLFVEHTLSLTEALCGFHFVLTHLDSRKLLIKSNPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGM MYQ+PFM+GKLYIHFTV+FPE+L+PDQ K +E VLP      ++
Sbjct  310  VVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPESLSPDQTKTIEEVLPKPTKATMS  369

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH-GGAQRVQCAQQ  242
            DM++D+CEETTL+DVNIE+EM+RK Q Q +E Y++D++ H GGAQRVQCAQQ
Sbjct  370  DMDIDDCEETTLHDVNIEDEMKRKAQAQ-REAYDDDDEEHPGGAQRVQCAQQ  420



>ref|XP_010933633.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Elaeis guineensis]
Length=416

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 149/173 (86%), Gaps = 5/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRK DD++VEHTL+L+EALCGFQF LTHLD RQLLIKS PGE
Sbjct  247  TVTGDIVFVVQQKEHPKFKRKYDDLYVEHTLSLSEALCGFQFALTHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            VVKP QFKAINDEGMP + +PFMRG+LYI F V+FP++  L+PDQC+ LE  LPPRP+ +
Sbjct  307  VVKPGQFKAINDEGMPHHGRPFMRGRLYIQFNVEFPDSGVLSPDQCRMLETFLPPRPSNR  366

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++DMELDECEETTLYDVNIEEEMRRKQQQQ QE Y+ED+D      RVQCAQQ
Sbjct  367  LSDMELDECEETTLYDVNIEEEMRRKQQQQQQEAYDEDDD---AIPRVQCAQQ  416



>ref|XP_010933632.1| PREDICTED: dnaJ protein homolog isoform X1 [Elaeis guineensis]
Length=421

 Score =   263 bits (672),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 149/173 (86%), Gaps = 5/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRK DD++VEHTL+L+EALCGFQF LTHLD RQLLIKS PGE
Sbjct  252  TVTGDIVFVVQQKEHPKFKRKYDDLYVEHTLSLSEALCGFQFALTHLDGRQLLIKSNPGE  311

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            VVKP QFKAINDEGMP + +PFMRG+LYI F V+FP++  L+PDQC+ LE  LPPRP+ +
Sbjct  312  VVKPGQFKAINDEGMPHHGRPFMRGRLYIQFNVEFPDSGVLSPDQCRMLETFLPPRPSNR  371

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++DMELDECEETTLYDVNIEEEMRRKQQQQ QE Y+ED+D      RVQCAQQ
Sbjct  372  LSDMELDECEETTLYDVNIEEEMRRKQQQQQQEAYDEDDD---AIPRVQCAQQ  421



>ref|XP_001755408.1| predicted protein [Physcomitrella patens]
 gb|EDQ79888.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 149/173 (86%), Gaps = 6/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDIVFVLQ KEH KFKRKGDD+FVEHTL+LTEALCGF+F L HLD RQLLIKS  GE
Sbjct  251  TQTGDIVFVLQLKEHPKFKRKGDDLFVEHTLSLTEALCGFRFPLVHLDGRQLLIKSDAGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            ++KP QFKAINDEGMP YQ+PFM+G+L++HF V+FPE+  LTPDQCKALE +LPPRP ++
Sbjct  311  IIKPGQFKAINDEGMPHYQRPFMKGRLFLHFNVEFPESGGLTPDQCKALETILPPRP-SQ  369

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDMELDECEETTL DVN E+EMRRKQQQQ QE Y+EDE+  G   R+QCAQQ
Sbjct  370  MTDMELDECEETTLIDVNFEDEMRRKQQQQ-QEAYDEDEESSG--PRIQCAQQ  419



>ref|XP_008803820.1| PREDICTED: dnaJ protein homolog 2-like [Phoenix dactylifera]
Length=417

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 148/173 (86%), Gaps = 5/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDI+F+LQQKEH KFKRK DD+FVEHTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIIFILQQKEHPKFKRKYDDLFVEHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            VVKP QFKAINDEGMP + +PFM+G+LYI F V+FP++  L+PDQC ALE +LPPRP+  
Sbjct  308  VVKPGQFKAINDEGMPHHGRPFMKGRLYIQFNVEFPDSGALSPDQCHALETLLPPRPSNH  367

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            + DMELDECEETTLYDVN+EEE RRKQQQQ Q+ Y+EDED    A RVQCAQQ
Sbjct  368  LLDMELDECEETTLYDVNMEEETRRKQQQQQQDAYDEDED---AAPRVQCAQQ  417



>ref|XP_006445374.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006445375.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|ESR58614.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|ESR58615.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
Length=337

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 146/173 (84%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQ KEH KFKRK DD++V+HTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  167  TITGDIVFILQLKEHPKFKRKFDDLYVDHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  226

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            ++KP Q+KAINDEGMP +Q+PFM+G+LYI F V+FPE   L+PDQC+ LE+VLPPRP   
Sbjct  227  IIKPGQYKAINDEGMPHHQRPFMKGRLYIQFNVEFPECGILSPDQCRTLESVLPPRPGKN  286

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++DMELD+CEE T++DVNI+EEMRRK+ QQ QE Y+ED++      RVQCAQQ
Sbjct  287  LSDMELDDCEEVTMHDVNIDEEMRRKRYQQQQEAYDEDDEP--AMPRVQCAQQ  337



>emb|CBI28261.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 138/171 (81%), Gaps = 24/171 (14%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  248  TVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPDQFKAINDEGMP+YQ+PFMRGKLYI F V+FP+TL+P+QCKALEAVLP R  T++T
Sbjct  308  VVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDTLSPEQCKALEAVLPARATTQLT  367

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            DMELDECEETTL+                        DM GGAQRVQCAQQ
Sbjct  368  DMELDECEETTLH------------------------DMPGGAQRVQCAQQ  394



>ref|XP_001768102.1| predicted protein [Physcomitrella patens]
 gb|EDQ66975.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   258 bits (659),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 146/173 (84%), Gaps = 5/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ KEH KFKRK DD+FVEHTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  250  TITGDIVFVLQLKEHPKFKRKVDDLFVEHTLSLTEALCGFQFPLTHLDGRQLLIKSAPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE--TLTPDQCKALEAVLPPRPATK  401
            ++KP QFKAINDEGMP + +PFM+G+LY+HFTV+ PE  +L+ +Q KALE VLPPRP  +
Sbjct  310  IIKPGQFKAINDEGMPHHLRPFMKGRLYLHFTVEVPESGSLSLEQIKALETVLPPRPTRQ  369

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDMELDECEETTLYDVNI+EEMRRK Q  AQE YEEDE+  G   R QCAQQ
Sbjct  370  MTDMELDECEETTLYDVNIDEEMRRK-QVHAQEAYEEDEESSG--PRTQCAQQ  419



>ref|XP_006445376.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006464459.1| PREDICTED: dnaJ protein homolog 2-like [Citrus sinensis]
 gb|ESR58616.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|KDO85581.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
 gb|KDO85582.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=418

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 146/173 (84%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQ KEH KFKRK DD++V+HTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  248  TITGDIVFILQLKEHPKFKRKFDDLYVDHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            ++KP Q+KAINDEGMP +Q+PFM+G+LYI F V+FPE   L+PDQC+ LE+VLPPRP   
Sbjct  308  IIKPGQYKAINDEGMPHHQRPFMKGRLYIQFNVEFPECGILSPDQCRTLESVLPPRPGKN  367

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++DMELD+CEE T++DVNI+EEMRRK+ QQ QE Y+ED++      RVQCAQQ
Sbjct  368  LSDMELDDCEEVTMHDVNIDEEMRRKRYQQQQEAYDEDDEP--AMPRVQCAQQ  418



>ref|XP_010248011.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
 ref|XP_010248012.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
Length=417

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 150/173 (87%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ KEH KFKRK DD++VEHTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  247  TITGDIVFVLQLKEHPKFKRKFDDLYVEHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KP Q+KAINDEGMP +Q+PFM+G+LYI F+VDFP+T  L+PDQC+ LE +LPPR ++ 
Sbjct  307  VIKPGQYKAINDEGMPHHQRPFMKGRLYIEFSVDFPDTGVLSPDQCRTLETILPPRTSSH  366

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +++MELDECEETTL+DVNIEEEMRRKQQQQ QE Y+ED++      RVQCAQQ
Sbjct  367  LSEMELDECEETTLHDVNIEEEMRRKQQQQQQEAYDEDDEP--SMPRVQCAQQ  417



>emb|CDY65546.1| BnaCnng47600D [Brassica napus]
Length=421

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 5/174 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  250  TVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLTHLDKRQLLIKSSPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD ++AI DEGMP++Q+PFM+GKLYIHFTVDFP++L+PDQ KA+EAVL P+P   ++
Sbjct  310  VVKPDSYRAITDEGMPVHQRPFMKGKLYIHFTVDFPDSLSPDQTKAIEAVL-PKPKADLS  368

Query  394  DMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EEDEDMHGGAQRVQCAQQ  242
            DME DECEETTL++VNIE+EMRRK Q Q +E Y   ++DE+  GG QRVQCAQQ
Sbjct  369  DMETDECEETTLHEVNIEDEMRRKAQAQ-REAYDDDDDDEEGPGGPQRVQCAQQ  421



>ref|XP_009779099.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009779100.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=423

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDI+F+LQQK+H+KF+RK DD++ EH L+LTEALCGFQFVLTHLD R LLIKS PGE
Sbjct  251  TITGDIIFILQQKDHSKFRRKSDDLYAEHNLSLTEALCGFQFVLTHLDGRLLLIKSSPGE  310

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KPDQ+KAINDEGMP Y +PF++G+LYIHF V+FPE+  LTP++C+ LE+VLPPRP  +
Sbjct  311  VIKPDQYKAINDEGMPHYGRPFIKGRLYIHFNVEFPESGFLTPEKCRILESVLPPRPGKR  370

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
             +DMEL+ CEETTL+DVN+EEEMR+K+Q++ QE Y+ D+D      R+ C QQ
Sbjct  371  ASDMELNNCEETTLHDVNMEEEMRQKEQRRRQEAYDMDDDDEPNVHRMACNQQ  423



>tpg|DAA50892.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=975

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = -1

Query  724  QQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAI  545
            + K+H+KFKRKG+D+  EHTL+LTEALCG QFVLTHLDNRQLLIKS PGEVVKPDQFKAI
Sbjct  746  EAKDHSKFKRKGEDLLYEHTLSLTEALCGCQFVLTHLDNRQLLIKSDPGEVVKPDQFKAI  805

Query  544  NDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKITDMELDECEET  365
            NDEGMP+YQ+PFM+GKLYIHFTV+FP++L P+QCKALE VLPPR ++K+TDME DECEET
Sbjct  806  NDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALETVLPPRLSSKLTDMETDECEET  865

Query  364  TLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            T++DV NIEEEM RKQ   A E YEED++M GGAQRVQCAQQ
Sbjct  866  TMHDVNNIEEEMHRKQAHAAHEAYEEDDEMPGGAQRVQCAQQ  907



>tpg|DAA41085.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=472

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 6/152 (4%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTE+LCGFQFVLTHLDNRQLLIKS PGE
Sbjct  321  TATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLCGFQFVLTHLDNRQLLIKSNPGE  380

Query  574  VV------KPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPR  413
            VV      KPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++L+ +QCKALEAVLPP+
Sbjct  381  VVNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDSLSLEQCKALEAVLPPK  440

Query  412  PATKITDMELDECEETTLYDVNIEEEMRRKQQ  317
            P ++ TDMELDECEET  YDVNIEEEM+R+QQ
Sbjct  441  PVSQYTDMELDECEETMPYDVNIEEEMQRRQQ  472



>ref|XP_009622737.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
 ref|XP_009622738.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
Length=421

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 145/173 (84%), Gaps = 3/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQQK+H+KFKRK DD+++EHTLTLTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  250  TITGDIVFVLQQKDHSKFKRKFDDLYMEHTLTLTEALCGFQFVLTHLDGRQLLIKSNPGE  309

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KPDQ+KAINDEGMP Y +PF++G+LYIHF VDFPE+  L+P+ C+ +  +LP RP   
Sbjct  310  VIKPDQYKAINDEGMPSYGRPFIKGRLYIHFNVDFPESGVLSPETCRGIGTILPARPGKG  369

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
             ++MELD+CEETT+++VNIEEEMRRK++Q+ QE Y+ D+D      RV C QQ
Sbjct  370  SSEMELDKCEETTMHNVNIEEEMRRKEKQRQQEAYDSDDD-EPNVHRVACNQQ  421



>ref|XP_002983333.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
 ref|XP_002987616.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ11191.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ15675.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
Length=419

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFV+Q K+H KFKR+GDD+F EHTLTLTEALCGFQF+LTHLD R LL+KS PGE
Sbjct  247  TITGDIVFVIQVKDHPKFKRRGDDLFYEHTLTLTEALCGFQFILTHLDGRSLLVKSTPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE--TLTPDQCKALEAVLPPRPATK  401
            ++KPDQFK I+DEGMP YQ+PFM+G+L+I F VDFP+  +L+P+QCK LE +LPPRP   
Sbjct  307  IIKPDQFKGIDDEGMPHYQRPFMKGRLFIQFHVDFPDSGSLSPEQCKMLETILPPRPTNH  366

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDMELDECEETTL DVNIEEEMRRKQQ Q Q+    DED      RVQCAQQ
Sbjct  367  LTDMELDECEETTLLDVNIEEEMRRKQQHQQQQQEAYDEDDEPSGPRVQCAQQ  419



>gb|ACJ83716.1| unknown [Medicago truncatula]
Length=156

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  19   TVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQFVLTHLDGRQLLIKSNPGE  78

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKIT  395
            VVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP+TL+ DQ K LEAVLP +P++++T
Sbjct  79   VVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLDQVKGLEAVLPAKPSSQLT  138

Query  394  DMELDECEETTLYDVNIE  341
            DME+DECEETTL+DVN+E
Sbjct  139  DMEIDECEETTLHDVNME  156



>ref|XP_009382439.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=423

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 148/173 (86%), Gaps = 5/173 (3%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQ KEH KFKRK DD++V+ TL+LTEALCGFQFVLTHLD RQLLIKS PGE
Sbjct  254  TVTGDIVFVLQHKEHPKFKRKYDDLYVDRTLSLTEALCGFQFVLTHLDGRQLLIKSSPGE  313

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KP Q+KAI+DEGMP + +PFM+G+LYI F V+FPET   +PDQC++LE +LPPRP+  
Sbjct  314  VIKPGQYKAIDDEGMPHHGRPFMKGRLYIQFNVEFPETGVFSPDQCRSLEKILPPRPSNH  373

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            I++MELDECEETT+YDVNIEEEMRR++ Q+ QE Y+EDED    A RVQCAQQ
Sbjct  374  ISNMELDECEETTMYDVNIEEEMRRQRLQRQQEAYDEDED---AAPRVQCAQQ  423



>emb|CBI16632.3| unnamed protein product [Vitis vinifera]
Length=692

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 147/169 (87%), Gaps = 3/169 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ K+HAKFKRK DD++VEHTL+LTEALCGFQF LTHLD RQLLIKS PGE
Sbjct  248  TITGDIVFVLQLKDHAKFKRKYDDLYVEHTLSLTEALCGFQFALTHLDGRQLLIKSNPGE  307

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            ++KPDQ+KAINDEGMP +Q+PFM+GKLYIHF V+FPE+  L+PDQCKALE++LP + + +
Sbjct  308  IIKPDQYKAINDEGMPHHQRPFMKGKLYIHFDVEFPESGILSPDQCKALESILPQKRSKQ  367

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQ  254
            I+ ME+DE EETTLYDVNIEEEMRRKQQQQ  E Y+ED+D   GA RV 
Sbjct  368  ISAMEVDEAEETTLYDVNIEEEMRRKQQQQQHEAYDEDDDDF-GAPRVH  415



>ref|XP_002963792.1| hypothetical protein SELMODRAFT_230221 [Selaginella moellendorffii]
 gb|EFJ35663.1| hypothetical protein SELMODRAFT_230221 [Selaginella moellendorffii]
Length=413

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 144/173 (83%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
             ITGD++F+LQ+KEH+KFKRKGDD+F EH LTL EALCGFQFVLT LD RQLLIKS PGE
Sbjct  243  AITGDVIFILQEKEHSKFKRKGDDLFTEHKLTLVEALCGFQFVLTQLDGRQLLIKSAPGE  302

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE--TLTPDQCKALEAVLPPRPATK  401
            ++KP QFKA+NDEGMP +Q+PF++G+LYI F+VDFPE   L PD  K LE+VLPPRPA +
Sbjct  303  IIKPGQFKAVNDEGMPQHQRPFVKGRLYIQFSVDFPEPRALNPDMLKTLESVLPPRPALQ  362

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +T +ELDECEE TL+DVNI+EEM+ K QQQ +E Y++D+D   G  RVQCAQQ
Sbjct  363  LTQVELDECEEATLHDVNIDEEMKSKHQQQ-REAYDDDDDPSAG-HRVQCAQQ  413



>ref|XP_010258833.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Nelumbo nucifera]
Length=332

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 149/173 (86%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ KEH+KFKRK DD++VEHTL+LTEALCGFQF LTHLD+RQLLIKS PGE
Sbjct  162  TITGDIVFVLQLKEHSKFKRKFDDLYVEHTLSLTEALCGFQFALTHLDSRQLLIKSNPGE  221

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KP Q+KAINDEGMP +Q+PFM+G+LYI F VDFP++  L+PD+C+ LE +LPPR  + 
Sbjct  222  VIKPGQYKAINDEGMPHHQRPFMKGRLYIQFHVDFPDSAVLSPDECRTLETILPPRANSH  281

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++ M+LD+CEETTL+DVN++EEMRRKQQQQ QE Y+ED++      RVQCAQQ
Sbjct  282  LSGMDLDDCEETTLHDVNVDEEMRRKQQQQQQEAYDEDDEP--SMPRVQCAQQ  332



>ref|XP_008232370.1| PREDICTED: dnaJ protein homolog 2-like [Prunus mume]
Length=415

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ KEHAKFKRK DD++VEHTL LT ALCGFQFVLTHLD RQLL+KS PGE
Sbjct  243  TITGDIVFVLQLKEHAKFKRKLDDLYVEHTLNLTAALCGFQFVLTHLDGRQLLVKSNPGE  302

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KP Q KAINDEGMP YQ+PFM+G L+IHF V+FP++  L+PDQ + L+ VL P+P+ +
Sbjct  303  VIKPGQSKAINDEGMPHYQRPFMKGNLFIHFNVEFPDSGILSPDQSRNLQTVLSPKPSKR  362

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TDMELDECEETT++DVNIE+EMRRK +QQ +E Y+ED+D      RVQCAQQ
Sbjct  363  LTDMELDECEETTMHDVNIEDEMRRKPRQQYREAYDEDDDDDEPMPRVQCAQQ  415



>ref|XP_003521084.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN43746.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 145/173 (84%), Gaps = 3/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ K+H KF+R+ DD++++H L+LTEALCGFQF + HLD RQLLIKS PGE
Sbjct  249  TITGDIVFVLQVKDHPKFRREQDDLYIDHNLSLTEALCGFQFAVKHLDGRQLLIKSNPGE  308

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KP Q+KAINDEGMP + +PFM+G+LYI F VDFP++  L+PDQC+ LE VLP + +  
Sbjct  309  VIKPGQYKAINDEGMPQHNRPFMKGRLYIQFNVDFPDSGFLSPDQCQLLEKVLPQKSSKH  368

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++DMELD+CEETTL+DVN +EEMRRKQQQQ +E Y+ED+D   G QRVQCAQQ
Sbjct  369  VSDMELDDCEETTLHDVNFKEEMRRKQQQQYREAYDEDDDEPSG-QRVQCAQQ  420



>ref|XP_007220469.1| hypothetical protein PRUPE_ppa006364mg [Prunus persica]
 gb|EMJ21668.1| hypothetical protein PRUPE_ppa006364mg [Prunus persica]
Length=415

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVF+LQ KEHAKFKRK DD++VEHTL LTEALCGFQFVLTHLD RQLL+KS PGE
Sbjct  243  TITGDIVFILQLKEHAKFKRKLDDLYVEHTLNLTEALCGFQFVLTHLDGRQLLVKSNPGE  302

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KP Q KAINDEGMP YQ+PFM+G L+IHF V+FP++  L+PDQ + L+ VL P+P+  
Sbjct  303  VIKPGQSKAINDEGMPHYQRPFMKGNLFIHFNVEFPDSGILSPDQSRNLQTVLSPKPSKH  362

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +TD+ELDECEETT++DVNIE+EMRRK +QQ +E Y+ED+D      RVQCAQQ
Sbjct  363  LTDVELDECEETTMHDVNIEDEMRRKPRQQYREAYDEDDDDDEPMPRVQCAQQ  415



>ref|XP_010258832.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Nelumbo nucifera]
Length=413

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 149/173 (86%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            TITGDIVFVLQ KEH+KFKRK DD++VEHTL+LTEALCGFQF LTHLD+RQLLIKS PGE
Sbjct  243  TITGDIVFVLQLKEHSKFKRKFDDLYVEHTLSLTEALCGFQFALTHLDSRQLLIKSNPGE  302

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            V+KP Q+KAINDEGMP +Q+PFM+G+LYI F VDFP++  L+PD+C+ LE +LPPR  + 
Sbjct  303  VIKPGQYKAINDEGMPHHQRPFMKGRLYIQFHVDFPDSAVLSPDECRTLETILPPRANSH  362

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++ M+LD+CEETTL+DVN++EEMRRKQQQQ QE Y+ED++      RVQCAQQ
Sbjct  363  LSGMDLDDCEETTLHDVNVDEEMRRKQQQQQQEAYDEDDEP--SMPRVQCAQQ  413



>ref|XP_002446897.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
 gb|EES11225.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
Length=418

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 145/173 (84%), Gaps = 3/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
            T+TGDIVFVLQ KEH +FKRK DD+F+EHT++LTEALCGFQF+LTHLD RQLLIKS PGE
Sbjct  247  TVTGDIVFVLQVKEHPRFKRKYDDLFIEHTISLTEALCGFQFILTHLDGRQLLIKSNPGE  306

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LTPDQCKALEAVLPPRPATK  401
            +++P Q KAINDEGMP + + FM+G+L++ F V+FPE+  L+PDQC+ALE VLP RP  +
Sbjct  307  IIQPGQHKAINDEGMPQHGRSFMKGRLFVEFNVEFPESGALSPDQCRALEKVLPQRPRAQ  366

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            ++DME+D+CEET ++DVN+EEEMRR++ Q+ QE Y EDE+   G  RVQCAQQ
Sbjct  367  LSDMEVDQCEETIMHDVNMEEEMRRRKHQRRQEAYNEDEE-DAGPSRVQCAQQ  418



>ref|XP_002974881.1| hypothetical protein SELMODRAFT_232411 [Selaginella moellendorffii]
 gb|EFJ24401.1| hypothetical protein SELMODRAFT_232411 [Selaginella moellendorffii]
Length=412

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 143/173 (83%), Gaps = 4/173 (2%)
 Frame = -1

Query  754  TITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGE  575
             ITGD++F+LQ+KEH+KFKRKGDD+F EH LTL EALCGFQFVLT LD RQLLIKS  GE
Sbjct  242  AITGDVIFILQEKEHSKFKRKGDDLFTEHKLTLVEALCGFQFVLTQLDGRQLLIKSAAGE  301

Query  574  VVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE--TLTPDQCKALEAVLPPRPATK  401
            ++KP QFKA+NDEGMP +Q+PF++G+LYI F+VDFPE   L PD  K LE+VLPPRPA +
Sbjct  302  IIKPGQFKAVNDEGMPQHQRPFVKGRLYIQFSVDFPEPRALNPDMLKTLESVLPPRPALQ  361

Query  400  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  242
            +T +ELDECEE TL+DVNI+EEM+ K QQQ +E Y++D+D   G  RVQCAQQ
Sbjct  362  LTQVELDECEEATLHDVNIDEEMKSKHQQQ-REAYDDDDDPSAG-HRVQCAQQ  412



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050