BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002K16

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797723.1|  PREDICTED: serine/threonine protein phosphat...    120   1e-27   Nicotiana sylvestris
ref|XP_009630828.1|  PREDICTED: serine/threonine protein phosphat...    118   4e-27   Nicotiana tomentosiformis
ref|XP_006366869.1|  PREDICTED: serine/threonine protein phosphat...    110   2e-24   Solanum tuberosum [potatoes]
ref|XP_004251590.1|  PREDICTED: serine/threonine protein phosphat...    108   1e-23   Solanum lycopersicum
gb|KDP32329.1|  hypothetical protein JCGZ_13254                         100   2e-20   Jatropha curcas
ref|XP_010656380.1|  PREDICTED: serine/threonine protein phosphat...  99.4    4e-20   
ref|XP_009389489.1|  PREDICTED: serine/threonine protein phosphat...  97.8    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003609196.1|  Serine/threonine protein phosphatase 2A 57 k...  97.4    2e-19   Medicago truncatula
ref|XP_002515563.1|  protein phosphatase 2a, regulatory subunit, ...  97.4    2e-19   
ref|XP_004508562.1|  PREDICTED: serine/threonine protein phosphat...  96.7    3e-19   Cicer arietinum [garbanzo]
gb|AFK37737.1|  unknown                                               96.3    3e-19   Medicago truncatula
ref|XP_006451049.1|  hypothetical protein CICLE_v10007952mg           96.3    4e-19   Citrus clementina [clementine]
ref|XP_006451050.1|  hypothetical protein CICLE_v10007952mg           96.3    4e-19   Citrus clementina [clementine]
ref|XP_007013281.1|  Serine/threonine protein phosphatase 2A 57 k...  92.4    7e-18   Theobroma cacao [chocolate]
gb|KHG08948.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  92.4    7e-18   Gossypium arboreum [tree cotton]
ref|XP_007013280.1|  Serine/threonine protein phosphatase 2A 57 k...  92.4    8e-18   
ref|XP_004287389.1|  PREDICTED: serine/threonine protein phosphat...  92.0    8e-18   Fragaria vesca subsp. vesca
ref|XP_008242686.1|  PREDICTED: serine/threonine protein phosphat...  91.7    2e-17   Prunus mume [ume]
ref|XP_010049936.1|  PREDICTED: serine/threonine protein phosphat...  90.9    3e-17   Eucalyptus grandis [rose gum]
ref|XP_007155131.1|  hypothetical protein PHAVU_003G176100g           90.1    4e-17   Phaseolus vulgaris [French bean]
ref|XP_007138335.1|  hypothetical protein PHAVU_009G200100g           89.4    7e-17   Phaseolus vulgaris [French bean]
ref|XP_008458023.1|  PREDICTED: serine/threonine protein phosphat...  89.0    1e-16   Cucumis melo [Oriental melon]
ref|XP_004163599.1|  PREDICTED: serine/threonine protein phosphat...  89.0    1e-16   
ref|XP_007204385.1|  hypothetical protein PRUPE_ppa004572mg           88.6    1e-16   Prunus persica
emb|CDP21530.1|  unnamed protein product                              88.2    2e-16   Coffea canephora [robusta coffee]
gb|KJB54144.1|  hypothetical protein B456_009G022600                  87.4    3e-16   Gossypium raimondii
ref|XP_003549794.1|  PREDICTED: serine/threonine protein phosphat...  87.4    4e-16   Glycine max [soybeans]
ref|XP_009374054.1|  PREDICTED: serine/threonine protein phosphat...  87.4    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_008337354.1|  PREDICTED: serine/threonine protein phosphat...  87.0    4e-16   
ref|XP_009371422.1|  PREDICTED: serine/threonine protein phosphat...  86.3    8e-16   Pyrus x bretschneideri [bai li]
ref|XP_004139334.1|  PREDICTED: serine/threonine protein phosphat...  86.3    8e-16   Cucumis sativus [cucumbers]
gb|KJB83138.1|  hypothetical protein B456_013G231300                  85.5    2e-15   Gossypium raimondii
ref|XP_008386225.1|  PREDICTED: serine/threonine protein phosphat...  85.1    2e-15   
ref|XP_010249885.1|  PREDICTED: serine/threonine protein phosphat...  84.7    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_008811587.1|  PREDICTED: serine/threonine protein phosphat...  84.3    4e-15   Phoenix dactylifera
ref|XP_003524519.1|  PREDICTED: serine/threonine protein phosphat...  82.8    1e-14   Glycine max [soybeans]
ref|XP_010254226.1|  PREDICTED: serine/threonine protein phosphat...  82.8    1e-14   Nelumbo nucifera [Indian lotus]
gb|KHN10406.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  81.6    2e-14   Glycine soja [wild soybean]
gb|KJB64864.1|  hypothetical protein B456_010G068400                  81.6    3e-14   Gossypium raimondii
ref|XP_006841877.1|  hypothetical protein AMTR_s00042p00019010        80.9    5e-14   Amborella trichopoda
ref|XP_002324961.1|  hypothetical protein POPTR_0018s06320g           80.1    9e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011010867.1|  PREDICTED: serine/threonine protein phosphat...  80.1    1e-13   Populus euphratica
ref|XP_010098941.1|  Serine/threonine protein phosphatase 2A 57 k...  80.1    1e-13   
gb|KHG22084.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  79.7    2e-13   Gossypium arboreum [tree cotton]
emb|CBI20930.3|  unnamed protein product                              73.6    6e-13   Vitis vinifera
dbj|BAJ86218.1|  predicted protein                                    77.0    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68651.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  76.6    1e-12   Triticum urartu
gb|EMT02137.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  76.6    1e-12   
ref|XP_008809266.1|  PREDICTED: serine/threonine protein phosphat...  76.3    2e-12   Phoenix dactylifera
ref|XP_010670759.1|  PREDICTED: serine/threonine protein phosphat...  75.9    3e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010913433.1|  PREDICTED: serine/threonine protein phosphat...  75.5    3e-12   Elaeis guineensis
ref|XP_002284526.1|  PREDICTED: serine/threonine protein phosphat...  75.1    4e-12   Vitis vinifera
ref|XP_004960832.1|  PREDICTED: serine/threonine protein phosphat...  75.1    5e-12   Setaria italica
ref|XP_011087131.1|  PREDICTED: serine/threonine protein phosphat...  74.7    5e-12   Sesamum indicum [beniseed]
tpg|DAA53185.1|  TPA: hypothetical protein ZEAMMB73_340114            70.1    7e-12   
ref|XP_007137075.1|  hypothetical protein PHAVU_009G097600g           74.3    8e-12   Phaseolus vulgaris [French bean]
ref|XP_008649389.1|  PREDICTED: serine/threonine protein phosphat...  73.9    1e-11   Zea mays [maize]
ref|XP_003567932.1|  PREDICTED: serine/threonine protein phosphat...  73.9    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_002440704.1|  hypothetical protein SORBIDRAFT_09g005420        73.6    1e-11   Sorghum bicolor [broomcorn]
ref|XP_010925297.1|  PREDICTED: serine/threonine protein phosphat...  73.6    1e-11   Elaeis guineensis
gb|EMS52063.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  72.8    2e-11   Triticum urartu
emb|CAB76153.1|  putative B' regulatory subunit of PP2A               68.9    3e-11   Oryza sativa [red rice]
ref|XP_003526435.1|  PREDICTED: serine/threonine protein phosphat...  72.4    3e-11   Glycine max [soybeans]
ref|XP_004501280.1|  PREDICTED: serine/threonine protein phosphat...  72.0    4e-11   
ref|XP_008785883.1|  PREDICTED: serine/threonine protein phosphat...  72.0    5e-11   Phoenix dactylifera
ref|XP_008785874.1|  PREDICTED: serine/threonine protein phosphat...  72.0    5e-11   Phoenix dactylifera
emb|CDP18419.1|  unnamed protein product                              72.0    5e-11   Coffea canephora [robusta coffee]
ref|XP_002455079.1|  hypothetical protein SORBIDRAFT_03g003950        71.6    7e-11   Sorghum bicolor [broomcorn]
ref|NP_001141673.1|  uncharacterized protein LOC100273799             70.9    1e-10   Zea mays [maize]
ref|XP_004138753.1|  PREDICTED: serine/threonine protein phosphat...  70.5    1e-10   Cucumis sativus [cucumbers]
ref|XP_010533199.1|  PREDICTED: serine/threonine protein phosphat...  70.5    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_006654758.1|  PREDICTED: serine/threonine protein phosphat...  70.1    2e-10   Oryza brachyantha
ref|XP_010231656.1|  PREDICTED: serine/threonine protein phosphat...  70.1    2e-10   Brachypodium distachyon [annual false brome]
gb|EEE64635.1|  hypothetical protein OsJ_19488                        65.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007013747.1|  Phosphatase 2A regulatory B subunit family p...  69.3    4e-10   
ref|XP_006371724.1|  hypothetical protein POPTR_0018s01130g           65.1    4e-10   
ref|XP_009798807.1|  PREDICTED: serine/threonine protein phosphat...  68.9    4e-10   Nicotiana sylvestris
ref|XP_003522642.1|  PREDICTED: serine/threonine protein phosphat...  68.9    5e-10   Glycine max [soybeans]
gb|EYU21914.1|  hypothetical protein MIMGU_mgv1a005231mg              68.6    6e-10   Erythranthe guttata [common monkey flower]
ref|XP_010925115.1|  PREDICTED: serine/threonine protein phosphat...  68.2    8e-10   Elaeis guineensis
gb|KHG19967.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  67.8    1e-09   Gossypium arboreum [tree cotton]
ref|XP_006643825.1|  PREDICTED: serine/threonine protein phosphat...  67.8    1e-09   Oryza brachyantha
ref|XP_010109039.1|  Serine/threonine protein phosphatase 2A 57 k...  67.8    1e-09   
gb|EAY98962.1|  hypothetical protein OsI_20919                        67.8    1e-09   Oryza sativa Indica Group [Indian rice]
dbj|BAG98544.1|  unnamed protein product                              64.7    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654101.1|  PREDICTED: serine/threonine protein phosphat...  67.4    2e-09   Oryza brachyantha
gb|KDP32288.1|  hypothetical protein JCGZ_13213                       67.4    2e-09   Jatropha curcas
ref|XP_001758786.1|  predicted protein                                67.4    2e-09   
ref|NP_001148974.1|  transposon protein                               67.4    2e-09   
ref|NP_001042191.1|  Os01g0178400                                     64.7    2e-09   
ref|XP_003569694.1|  PREDICTED: serine/threonine protein phosphat...  67.0    2e-09   Brachypodium distachyon [annual false brome]
emb|CAC85920.1|  protein phosphatase 2A B'kappa subunit               67.0    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006382064.1|  hypothetical protein POPTR_0006s26330g           63.5    2e-09   
ref|XP_009385620.1|  PREDICTED: serine/threonine protein phosphat...  66.6    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407446.1|  PREDICTED: serine/threonine protein phosphat...  66.6    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004498632.1|  PREDICTED: serine/threonine protein phosphat...  66.6    3e-09   Cicer arietinum [garbanzo]
ref|XP_007161261.1|  hypothetical protein PHAVU_001G055500g           66.6    3e-09   Phaseolus vulgaris [French bean]
ref|XP_006852143.1|  hypothetical protein AMTR_s00049p00063500        66.6    3e-09   Amborella trichopoda
ref|XP_009151080.1|  PREDICTED: serine/threonine protein phosphat...  66.6    3e-09   Brassica rapa
gb|KJB07811.1|  hypothetical protein B456_001G045700                  66.6    3e-09   Gossypium raimondii
gb|EEE62528.1|  hypothetical protein OsJ_17326                        65.9    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009619322.1|  PREDICTED: serine/threonine protein phosphat...  66.2    4e-09   Nicotiana tomentosiformis
ref|XP_003603467.1|  Serine/threonine protein phosphatase 2A 57 k...  66.2    4e-09   Medicago truncatula
ref|XP_006353657.1|  PREDICTED: serine/threonine protein phosphat...  66.2    4e-09   Solanum tuberosum [potatoes]
ref|XP_002458327.1|  hypothetical protein SORBIDRAFT_03g031350        66.2    4e-09   Sorghum bicolor [broomcorn]
gb|KHF99622.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  66.2    4e-09   Gossypium arboreum [tree cotton]
ref|XP_007221123.1|  hypothetical protein PRUPE_ppa018321mg           62.0    5e-09   
ref|XP_009415355.1|  PREDICTED: serine/threonine protein phosphat...  65.9    5e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN30940.1|  unknown                                               65.9    5e-09   Zea mays [maize]
gb|EEE53979.1|  hypothetical protein OsJ_00602                        65.5    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054799.1|  Os05g0178400                                     65.9    6e-09   
gb|EMS60469.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  65.5    6e-09   Triticum urartu
gb|EMT11476.1|  hypothetical protein F775_43033                       65.9    6e-09   
ref|XP_002440213.1|  hypothetical protein SORBIDRAFT_09g027870        65.5    6e-09   Sorghum bicolor [broomcorn]
dbj|BAD67828.1|  putative serine/threonine protein phosphatase 2A...  65.5    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969560.1|  PREDICTED: serine/threonine protein phosphat...  65.1    7e-09   
gb|EEC70043.1|  hypothetical protein OsI_00633                        65.5    7e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_008647861.1|  PREDICTED: transposon protein isoform X1         65.5    7e-09   
ref|XP_011026522.1|  PREDICTED: serine/threonine protein phosphat...  65.5    7e-09   Populus euphratica
gb|KJB42861.1|  hypothetical protein B456_007G171000                  65.5    7e-09   Gossypium raimondii
ref|XP_010493808.1|  PREDICTED: serine/threonine protein phosphat...  65.5    7e-09   Camelina sativa [gold-of-pleasure]
gb|EPS70113.1|  hypothetical protein M569_04647                       65.5    7e-09   Genlisea aurea
emb|CDX80521.1|  BnaC07g29230D                                        65.5    7e-09   
ref|XP_010421407.1|  PREDICTED: serine/threonine protein phosphat...  65.5    7e-09   Camelina sativa [gold-of-pleasure]
emb|CDX88186.1|  BnaA06g27770D                                        65.5    7e-09   
ref|XP_004969559.1|  PREDICTED: serine/threonine protein phosphat...  65.1    8e-09   Setaria italica
ref|XP_002965046.1|  hypothetical protein SELMODRAFT_167051           65.1    1e-08   Selaginella moellendorffii
ref|XP_006338659.1|  PREDICTED: serine/threonine protein phosphat...  64.7    1e-08   Solanum tuberosum [potatoes]
gb|KHN10390.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  64.7    1e-08   Glycine soja [wild soybean]
ref|XP_004241801.1|  PREDICTED: serine/threonine protein phosphat...  64.7    1e-08   
ref|XP_006450560.1|  hypothetical protein CICLE_v10008015mg           64.7    1e-08   Citrus clementina [clementine]
ref|XP_002516615.1|  protein phosphatase 2a, regulatory subunit, ...  64.7    1e-08   Ricinus communis
ref|XP_006476191.1|  PREDICTED: serine/threonine protein phosphat...  64.7    1e-08   Citrus sinensis [apfelsine]
ref|XP_004961286.1|  PREDICTED: serine/threonine protein phosphat...  64.7    1e-08   Setaria italica
gb|EYU39647.1|  hypothetical protein MIMGU_mgv1a005452mg              64.7    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_006476190.1|  PREDICTED: serine/threonine protein phosphat...  64.7    1e-08   
ref|XP_009377509.1|  PREDICTED: serine/threonine protein phosphat...  64.3    2e-08   
ref|XP_003550157.1|  PREDICTED: serine/threonine protein phosphat...  64.3    2e-08   Glycine max [soybeans]
ref|XP_003544625.1|  PREDICTED: serine/threonine protein phosphat...  64.3    2e-08   Glycine max [soybeans]
ref|XP_008394018.1|  PREDICTED: serine/threonine protein phosphat...  63.9    2e-08   
gb|KHN03104.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  63.9    2e-08   Glycine soja [wild soybean]
ref|XP_006428449.1|  hypothetical protein CICLE_v10013819mg           60.1    2e-08   
dbj|BAK03510.1|  predicted protein                                    63.9    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK27832.1|  hypothetical protein AALP_AA8G435800                  63.5    3e-08   Arabis alpina [alpine rockcress]
ref|XP_006287577.1|  hypothetical protein CARUB_v10000786mg           63.5    3e-08   Capsella rubella
ref|XP_011019731.1|  PREDICTED: serine/threonine protein phosphat...  63.5    3e-08   Populus euphratica
ref|XP_009377393.1|  PREDICTED: serine/threonine protein phosphat...  63.5    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_009372941.1|  PREDICTED: serine/threonine protein phosphat...  63.5    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_002969377.1|  hypothetical protein SELMODRAFT_267276           63.5    3e-08   
ref|XP_002970708.1|  hypothetical protein SELMODRAFT_171686           63.5    3e-08   
ref|XP_004304704.1|  PREDICTED: serine/threonine protein phosphat...  63.5    3e-08   Fragaria vesca subsp. vesca
gb|KHG13833.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  63.2    4e-08   Gossypium arboreum [tree cotton]
ref|XP_002962142.1|  hypothetical protein SELMODRAFT_63731            63.2    4e-08   
gb|EPS71240.1|  hypothetical protein M569_03516                       63.2    4e-08   Genlisea aurea
gb|KJB40702.1|  hypothetical protein B456_007G074200                  63.2    5e-08   Gossypium raimondii
gb|KDO52089.1|  hypothetical protein CISIN_1g0107852mg                59.7    5e-08   Citrus sinensis [apfelsine]
emb|CDX87083.1|  BnaC09g03980D                                        62.4    5e-08   
ref|XP_004169443.1|  PREDICTED: serine/threonine protein phosphat...  62.8    6e-08   
gb|KGN45729.1|  hypothetical protein Csa_6G008600                     62.8    6e-08   Cucumis sativus [cucumbers]
ref|XP_004138464.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  62.8    6e-08   
ref|XP_001774044.1|  predicted protein                                62.8    6e-08   
ref|XP_010543448.1|  PREDICTED: serine/threonine protein phosphat...  62.4    6e-08   Tarenaya hassleriana [spider flower]
gb|KDP30791.1|  hypothetical protein JCGZ_13734                       62.4    7e-08   Jatropha curcas
ref|XP_004497127.1|  PREDICTED: serine/threonine protein phosphat...  62.4    7e-08   Cicer arietinum [garbanzo]
gb|KCW48799.1|  hypothetical protein EUGRSUZ_K02441                   62.4    7e-08   Eucalyptus grandis [rose gum]
ref|XP_008445128.1|  PREDICTED: serine/threonine protein phosphat...  62.4    7e-08   Cucumis melo [Oriental melon]
gb|KHN05593.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  62.4    7e-08   Glycine soja [wild soybean]
ref|XP_006589705.1|  PREDICTED: serine/threonine protein phosphat...  62.4    7e-08   
gb|EPS62004.1|  hypothetical protein M569_12788                       62.4    8e-08   Genlisea aurea
ref|XP_010037138.1|  PREDICTED: serine/threonine protein phosphat...  62.4    8e-08   Eucalyptus grandis [rose gum]
ref|XP_008383627.1|  PREDICTED: serine/threonine protein phosphat...  62.4    8e-08   
ref|XP_002870241.1|  hypothetical protein ARALYDRAFT_329973           62.4    8e-08   
ref|XP_008441374.1|  PREDICTED: serine/threonine protein phosphat...  62.4    9e-08   Cucumis melo [Oriental melon]
gb|KHG10267.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  62.0    9e-08   Gossypium arboreum [tree cotton]
ref|XP_007027455.1|  Phosphatase 2A regulatory B subunit family p...  62.0    9e-08   
ref|XP_008233254.1|  PREDICTED: serine/threonine protein phosphat...  62.0    1e-07   Prunus mume [ume]
ref|NP_197933.1|  protein phosphatase 2A regulatory B subunit         62.0    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY05497.1|  BnaA02g31940D                                        62.0    1e-07   
emb|CDY54903.1|  BnaC02g48620D                                        62.0    1e-07   Brassica napus [oilseed rape]
ref|XP_008343496.1|  PREDICTED: serine/threonine protein phosphat...  60.1    1e-07   
ref|XP_011012347.1|  PREDICTED: serine/threonine protein phosphat...  62.0    1e-07   Populus euphratica
ref|XP_006375537.1|  hypothetical protein POPTR_0014s15520g           60.1    1e-07   
ref|XP_011010241.1|  PREDICTED: serine/threonine protein phosphat...  62.0    1e-07   Populus euphratica
ref|XP_005649013.1|  PP2A-widerborst subunit                          62.0    1e-07   Coccomyxa subellipsoidea C-169
ref|XP_010111637.1|  Serine/threonine protein phosphatase 2A 59 k...  62.0    1e-07   Morus notabilis
ref|XP_009411828.1|  PREDICTED: serine/threonine protein phosphat...  62.0    1e-07   
ref|XP_009411832.1|  PREDICTED: serine/threonine protein phosphat...  62.0    1e-07   
ref|XP_009411830.1|  PREDICTED: serine/threonine protein phosphat...  61.6    1e-07   
ref|XP_004307335.1|  PREDICTED: serine/threonine protein phosphat...  61.6    1e-07   Fragaria vesca subsp. vesca
ref|XP_002323997.1|  serine/threonine protein phosphatase 2A regu...  61.6    1e-07   
ref|XP_011081886.1|  PREDICTED: serine/threonine protein phosphat...  61.6    1e-07   Sesamum indicum [beniseed]
gb|EYU29254.1|  hypothetical protein MIMGU_mgv1a005961mg              61.6    1e-07   Erythranthe guttata [common monkey flower]
gb|KCW80466.1|  hypothetical protein EUGRSUZ_C018112                  58.2    1e-07   Eucalyptus grandis [rose gum]
ref|XP_008812431.1|  PREDICTED: serine/threonine protein phosphat...  61.6    2e-07   Phoenix dactylifera
ref|XP_010935325.1|  PREDICTED: serine/threonine protein phosphat...  61.6    2e-07   Elaeis guineensis
ref|XP_002874266.1|  hypothetical protein ARALYDRAFT_489409           61.2    2e-07   
ref|XP_009786927.1|  PREDICTED: serine/threonine protein phosphat...  61.6    2e-07   Nicotiana sylvestris
ref|XP_010907766.1|  PREDICTED: serine/threonine protein phosphat...  61.2    2e-07   Elaeis guineensis
ref|XP_010910784.1|  PREDICTED: serine/threonine protein phosphat...  58.2    2e-07   
ref|XP_004292963.1|  PREDICTED: serine/threonine protein phosphat...  61.2    2e-07   Fragaria vesca subsp. vesca
ref|XP_007049146.1|  Phosphatase 2A regulatory B subunit family p...  61.2    2e-07   
ref|XP_010907764.1|  PREDICTED: serine/threonine protein phosphat...  61.2    2e-07   Elaeis guineensis
gb|KDO40519.1|  hypothetical protein CISIN_1g011191mg                 61.2    2e-07   Citrus sinensis [apfelsine]
ref|XP_010486565.1|  PREDICTED: serine/threonine protein phosphat...  61.2    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006491669.1|  PREDICTED: serine/threonine protein phosphat...  61.2    2e-07   Citrus sinensis [apfelsine]
ref|XP_002976536.1|  hypothetical protein SELMODRAFT_232803           60.8    2e-07   
ref|XP_009620794.1|  PREDICTED: serine/threonine protein phosphat...  61.2    2e-07   Nicotiana tomentosiformis
ref|XP_007201959.1|  hypothetical protein PRUPE_ppa004682mg           61.2    2e-07   Prunus persica
ref|XP_009137092.1|  PREDICTED: serine/threonine protein phosphat...  61.2    2e-07   Brassica rapa
ref|XP_008241387.1|  PREDICTED: serine/threonine protein phosphat...  60.8    2e-07   Prunus mume [ume]
emb|CDP15283.1|  unnamed protein product                              58.5    2e-07   Coffea canephora [robusta coffee]
gb|KJB46507.1|  hypothetical protein B456_007G372900                  60.8    2e-07   Gossypium raimondii
ref|XP_006368169.1|  hypothetical protein POPTR_0001s00210g           59.3    2e-07   
gb|KJB46506.1|  hypothetical protein B456_007G372900                  60.8    3e-07   Gossypium raimondii
ref|XP_008799955.1|  PREDICTED: serine/threonine protein phosphat...  58.9    3e-07   
ref|NP_187599.1|  serine/threonine protein phosphatase 2A regulat...  60.8    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973366.1|  hypothetical protein SELMODRAFT_99313            60.8    3e-07   
ref|XP_004243528.1|  PREDICTED: serine/threonine protein phosphat...  60.8    3e-07   Solanum lycopersicum
ref|XP_010696300.1|  PREDICTED: serine/threonine protein phosphat...  60.8    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006297503.1|  hypothetical protein CARUB_v10013525mg           60.5    3e-07   Capsella rubella
ref|XP_008813321.1|  PREDICTED: serine/threonine protein phosphat...  60.5    3e-07   Phoenix dactylifera
ref|XP_006394804.1|  hypothetical protein EUTSA_v10004060mg           60.5    3e-07   Eutrema salsugineum [saltwater cress]
gb|KJB16761.1|  hypothetical protein B456_002G246300                  60.5    3e-07   Gossypium raimondii
ref|XP_001768015.1|  predicted protein                                60.5    3e-07   
ref|XP_006357949.1|  PREDICTED: serine/threonine protein phosphat...  60.5    3e-07   Solanum tuberosum [potatoes]
ref|XP_009368942.1|  PREDICTED: serine/threonine protein phosphat...  60.5    3e-07   Pyrus x bretschneideri [bai li]
ref|XP_011086721.1|  PREDICTED: serine/threonine protein phosphat...  60.5    4e-07   Sesamum indicum [beniseed]
ref|XP_010541630.1|  PREDICTED: serine/threonine protein phosphat...  60.5    4e-07   
ref|XP_009409882.1|  PREDICTED: serine/threonine protein phosphat...  60.5    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003588682.1|  Serine/threonine protein phosphatase 2A 57 k...  60.5    4e-07   Medicago truncatula
ref|XP_001766428.1|  predicted protein                                60.1    4e-07   
ref|XP_010243212.1|  PREDICTED: serine/threonine protein phosphat...  60.5    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008379151.1|  PREDICTED: serine/threonine protein phosphat...  60.5    4e-07   
emb|CDY07942.1|  BnaC03g35810D                                        60.1    4e-07   Brassica napus [oilseed rape]
ref|XP_010250854.1|  PREDICTED: serine/threonine protein phosphat...  60.1    4e-07   Nelumbo nucifera [Indian lotus]
emb|CAB10320.1|  phosphatase like protein                             60.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KDP46344.1|  hypothetical protein JCGZ_10184                       60.1    4e-07   Jatropha curcas
ref|XP_010932304.1|  PREDICTED: serine/threonine protein phosphat...  60.1    5e-07   Elaeis guineensis
ref|XP_010464647.1|  PREDICTED: serine/threonine protein phosphat...  60.1    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007031732.1|  Serine/threonine protein phosphatase 2A 59 k...  60.1    5e-07   
ref|XP_006469972.1|  PREDICTED: serine/threonine protein phosphat...  60.1    5e-07   Citrus sinensis [apfelsine]
ref|XP_006357177.1|  PREDICTED: serine/threonine protein phosphat...  60.1    5e-07   Solanum tuberosum [potatoes]
ref|XP_006447169.1|  hypothetical protein CICLE_v10014898mg           60.1    5e-07   
ref|XP_010478286.1|  PREDICTED: serine/threonine protein phosphat...  60.1    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009377048.1|  PREDICTED: serine/threonine protein phosphat...  60.1    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_001767940.1|  predicted protein                                59.7    5e-07   
ref|XP_008387532.1|  PREDICTED: serine/threonine protein phosphat...  59.7    5e-07   
ref|XP_002323499.1|  serine/threonine protein phosphatase 2A regu...  59.7    5e-07   
ref|XP_009412705.1|  PREDICTED: serine/threonine protein phosphat...  59.7    5e-07   
ref|XP_011006622.1|  PREDICTED: serine/threonine protein phosphat...  59.7    5e-07   Populus euphratica
emb|CDY09766.1|  BnaC07g32950D                                        59.7    5e-07   Brassica napus [oilseed rape]
gb|KHG18630.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  59.7    6e-07   Gossypium arboreum [tree cotton]
ref|XP_006407628.1|  hypothetical protein EUTSA_v10020593mg           59.7    6e-07   Eutrema salsugineum [saltwater cress]
ref|XP_009412704.1|  PREDICTED: serine/threonine protein phosphat...  59.7    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB10684.1|  hypothetical protein B456_001G216400                  59.7    6e-07   Gossypium raimondii
ref|XP_008389801.1|  PREDICTED: serine/threonine protein phosphat...  59.7    6e-07   
ref|XP_009625334.1|  PREDICTED: serine/threonine protein phosphat...  59.7    6e-07   Nicotiana tomentosiformis
ref|XP_008799952.1|  PREDICTED: serine/threonine protein phosphat...  59.7    6e-07   Phoenix dactylifera
ref|XP_007223260.1|  hypothetical protein PRUPE_ppa004440mg           59.7    6e-07   Prunus persica
ref|XP_009418105.1|  PREDICTED: serine/threonine protein phosphat...  59.7    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY54611.1|  BnaA05g28660D                                        59.7    6e-07   Brassica napus [oilseed rape]
ref|XP_009146889.1|  PREDICTED: serine/threonine protein phosphat...  59.7    6e-07   Brassica rapa
ref|XP_002503955.1|  Serine/threonine protein phosphatase 2A 57 k...  59.3    6e-07   Micromonas commoda
gb|KDP29180.1|  hypothetical protein JCGZ_16569                       59.3    7e-07   Jatropha curcas
ref|XP_006414514.1|  hypothetical protein EUTSA_v10024939mg           59.3    7e-07   Eutrema salsugineum [saltwater cress]
ref|XP_011457446.1|  PREDICTED: serine/threonine protein phosphat...  59.3    7e-07   Fragaria vesca subsp. vesca
ref|XP_008369010.1|  PREDICTED: serine/threonine protein phosphat...  59.3    7e-07   
ref|XP_004515912.1|  PREDICTED: serine/threonine protein phosphat...  59.3    8e-07   Cicer arietinum [garbanzo]
ref|XP_009370310.1|  PREDICTED: serine/threonine protein phosphat...  59.3    8e-07   
ref|XP_004494078.1|  PREDICTED: serine/threonine protein phosphat...  59.3    8e-07   Cicer arietinum [garbanzo]
gb|KEH44274.1|  protein phosphatase 2A regulatory B subunit famil...  58.9    9e-07   Medicago truncatula
gb|EPS71994.1|  hypothetical protein M569_02763                       58.9    1e-06   Genlisea aurea
gb|EYU22561.1|  hypothetical protein MIMGU_mgv1a007292mg              58.9    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_008797311.1|  PREDICTED: serine/threonine protein phosphat...  58.9    1e-06   Phoenix dactylifera
ref|XP_010048263.1|  PREDICTED: serine/threonine protein phosphat...  58.9    1e-06   Eucalyptus grandis [rose gum]
gb|KJB36483.1|  hypothetical protein B456_006G161400                  58.9    1e-06   Gossypium raimondii
ref|XP_011047218.1|  PREDICTED: serine/threonine protein phosphat...  58.9    1e-06   Populus euphratica
ref|XP_006381385.1|  hypothetical protein POPTR_0006s12420g           58.9    1e-06   
ref|XP_002519463.1|  protein phosphatase 2a, regulatory subunit, ...  58.9    1e-06   Ricinus communis
ref|XP_001782778.1|  predicted protein                                58.9    1e-06   
ref|XP_008340161.1|  PREDICTED: serine/threonine protein phosphat...  58.9    1e-06   
ref|XP_009359296.1|  PREDICTED: serine/threonine protein phosphat...  58.9    1e-06   
ref|XP_010098803.1|  Serine/threonine protein phosphatase 2A 57 k...  58.9    1e-06   
ref|XP_007215087.1|  hypothetical protein PRUPE_ppa004318mg           58.5    1e-06   
ref|XP_008230444.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   
emb|CAN61918.1|  hypothetical protein VITISV_026308                   55.8    1e-06   
ref|XP_009129957.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   
ref|XP_009371715.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   
ref|XP_010531427.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   
emb|CDX73997.1|  BnaA03g30500D                                        58.5    1e-06   
ref|XP_009762457.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   
ref|XP_009762455.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   
ref|XP_011094501.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   
ref|XP_009135039.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   
emb|CBI31412.3|  unnamed protein product                              55.8    1e-06   
gb|EMT31243.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  58.5    2e-06   
ref|XP_006438130.1|  hypothetical protein CICLE_v10031228mg           58.5    2e-06   
ref|XP_006484025.1|  PREDICTED: serine/threonine protein phosphat...  58.5    2e-06   
ref|XP_006838709.1|  hypothetical protein AMTR_s00002p00250530        58.2    2e-06   
ref|XP_003542561.1|  PREDICTED: serine/threonine protein phosphat...  58.2    2e-06   
ref|XP_009402720.1|  PREDICTED: serine/threonine protein phosphat...  58.2    2e-06   
emb|CDP13292.1|  unnamed protein product                              58.2    2e-06   
gb|KJB33915.1|  hypothetical protein B456_006G038500                  58.2    2e-06   
ref|XP_009590023.1|  PREDICTED: serine/threonine protein phosphat...  58.2    2e-06   
gb|KHN48243.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  57.8    2e-06   
emb|CDY41574.1|  BnaC05g43110D                                        58.2    2e-06   
emb|CDY13605.1|  BnaA06g33180D                                        57.8    2e-06   
ref|XP_010537569.1|  PREDICTED: serine/threonine protein phosphat...  57.8    2e-06   
ref|XP_008378369.1|  PREDICTED: serine/threonine protein phosphat...  56.2    2e-06   
ref|XP_009780032.1|  PREDICTED: serine/threonine protein phosphat...  57.8    3e-06   
ref|XP_011018792.1|  PREDICTED: serine/threonine protein phosphat...  57.8    3e-06   
emb|CDX90593.1|  BnaA03g41880D                                        57.8    3e-06   
gb|KEH24045.1|  protein phosphatase 2A regulatory B subunit famil...  55.1    3e-06   
ref|NP_001146864.1|  LOC100280472                                     57.8    3e-06   
ref|XP_003535186.1|  PREDICTED: serine/threonine protein phosphat...  57.8    3e-06   
gb|KHN39022.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  57.4    3e-06   
ref|XP_010244149.1|  PREDICTED: serine/threonine protein phosphat...  57.8    3e-06   
ref|XP_010682883.1|  PREDICTED: serine/threonine protein phosphat...  57.8    3e-06   
ref|XP_009152091.1|  PREDICTED: serine/threonine protein phosphat...  57.8    3e-06   
ref|XP_003555155.1|  PREDICTED: serine/threonine protein phosphat...  57.8    3e-06   
ref|XP_004968416.1|  PREDICTED: serine/threonine protein phosphat...  57.8    3e-06   
ref|XP_006283548.1|  hypothetical protein CARUB_v10004601mg           57.8    3e-06   
gb|AFW81037.1|  hypothetical protein ZEAMMB73_275381                  57.4    3e-06   
ref|XP_008795966.1|  PREDICTED: serine/threonine protein phosphat...  57.4    3e-06   
ref|XP_006651691.1|  PREDICTED: serine/threonine protein phosphat...  57.4    3e-06   
ref|XP_011071183.1|  PREDICTED: serine/threonine protein phosphat...  57.4    3e-06   
gb|KHN44403.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  57.4    3e-06   
ref|XP_003538573.1|  PREDICTED: serine/threonine protein phosphat...  57.4    3e-06   
ref|XP_006299096.1|  hypothetical protein CARUB_v10015234mg           57.4    3e-06   
ref|NP_001146050.1|  uncharacterized protein LOC100279581             57.4    3e-06   
ref|XP_010252513.1|  PREDICTED: serine/threonine protein phosphat...  57.4    3e-06   
emb|CDY04885.1|  BnaAnng00670D                                        57.4    4e-06   
gb|KEH42162.1|  protein phosphatase 2A regulatory B subunit famil...  57.4    4e-06   
gb|KFK38377.1|  hypothetical protein AALP_AA3G106000                  57.4    4e-06   
ref|XP_003561297.1|  PREDICTED: serine/threonine protein phosphat...  57.4    4e-06   
gb|EMS53921.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  57.4    4e-06   
ref|XP_010025360.1|  PREDICTED: serine/threonine protein phosphat...  57.4    4e-06   
ref|XP_010248839.1|  PREDICTED: serine/threonine protein phosphat...  57.4    4e-06   
ref|XP_004982170.1|  PREDICTED: serine/threonine protein phosphat...  57.4    4e-06   
ref|XP_003521415.1|  PREDICTED: serine/threonine protein phosphat...  57.0    4e-06   
ref|XP_006341761.1|  PREDICTED: serine/threonine protein phosphat...  57.0    4e-06   
ref|XP_009772668.1|  PREDICTED: serine/threonine protein phosphat...  57.0    4e-06   
gb|KCW62001.1|  hypothetical protein EUGRSUZ_H04680                   57.0    4e-06   
ref|NP_567464.1|  protein phosphatase 2A B'gamma                      57.0    4e-06   
ref|XP_009414678.1|  PREDICTED: serine/threonine protein phosphat...  57.0    5e-06   
gb|AAM10385.1|  AT4g15410/dl3750w                                     57.0    5e-06   
emb|CBI28848.3|  unnamed protein product                              57.0    5e-06   
ref|XP_010660823.1|  PREDICTED: serine/threonine protein phosphat...  57.0    5e-06   
ref|XP_010657226.1|  PREDICTED: serine/threonine protein phosphat...  57.0    5e-06   
ref|XP_002882642.1|  hypothetical protein ARALYDRAFT_478311           57.0    5e-06   
ref|XP_011470807.1|  PREDICTED: serine/threonine protein phosphat...  57.0    5e-06   
ref|XP_002525315.1|  protein phosphatase 2a, regulatory subunit, ...  57.0    5e-06   
ref|XP_009606776.1|  PREDICTED: serine/threonine protein phosphat...  57.0    5e-06   
gb|KHG04678.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  56.6    6e-06   
ref|XP_004143280.1|  PREDICTED: serine/threonine protein phosphat...  56.6    6e-06   
ref|NP_001154647.1|  protein phosphatase 2A regulatory subunit B'...  56.6    6e-06   
ref|XP_003573322.1|  PREDICTED: serine/threonine protein phosphat...  56.6    6e-06   
ref|XP_010548887.1|  PREDICTED: serine/threonine protein phosphat...  56.6    6e-06   
ref|NP_001154648.1|  protein phosphatase 2A regulatory subunit B'...  56.6    6e-06   
ref|XP_004142950.1|  PREDICTED: serine/threonine protein phosphat...  56.6    7e-06   
ref|XP_002301608.1|  serine/threonine protein phosphatase 2A regu...  56.6    7e-06   
ref|XP_008379655.1|  PREDICTED: serine/threonine protein phosphat...  56.6    7e-06   
ref|XP_008363215.1|  PREDICTED: serine/threonine protein phosphat...  56.6    7e-06   
ref|XP_009365093.1|  PREDICTED: serine/threonine protein phosphat...  56.6    7e-06   
ref|XP_006386782.1|  hypothetical protein POPTR_0002s21550g           56.6    7e-06   
ref|NP_189231.1|  protein phosphatase 2A regulatory subunit B' eta    56.6    7e-06   
gb|KHG25533.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  56.6    7e-06   
ref|XP_009129571.1|  PREDICTED: serine/threonine protein phosphat...  56.6    7e-06   
gb|EPS59388.1|  hypothetical protein M569_15419                       56.6    7e-06   
ref|XP_010456709.1|  PREDICTED: serine/threonine protein phosphat...  56.2    8e-06   
ref|XP_006830091.1|  hypothetical protein AMTR_s00123p00060730        56.2    8e-06   
gb|KJB11609.1|  hypothetical protein B456_001G268200                  56.2    9e-06   
ref|XP_008462494.1|  PREDICTED: serine/threonine protein phosphat...  56.2    9e-06   
emb|CDX83578.1|  BnaC07g23180D                                        56.2    9e-06   
ref|XP_010534418.1|  PREDICTED: serine/threonine protein phosphat...  56.2    9e-06   
emb|CDY40986.1|  BnaA02g27760D                                        56.2    9e-06   
ref|XP_009117687.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  55.8    9e-06   
gb|AHE76186.1|  protein phosphatase 2a                                56.2    9e-06   
ref|XP_010940226.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  56.2    1e-05   
ref|XP_010029046.1|  PREDICTED: serine/threonine protein phosphat...  56.2    1e-05   
emb|CDP16651.1|  unnamed protein product                              56.2    1e-05   
gb|KJB11612.1|  hypothetical protein B456_001G268200                  55.8    1e-05   
ref|XP_002875297.1|  hypothetical protein ARALYDRAFT_904782           55.8    1e-05   
gb|EYU25948.1|  hypothetical protein MIMGU_mgv1a007752mg              55.8    1e-05   
ref|XP_002871036.1|  hypothetical protein ARALYDRAFT_487124           55.8    1e-05   
ref|XP_010440315.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|XP_010434994.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
gb|AAM61625.1|  B regulatory subunit of protein phosphatase 2A, p...  55.8    1e-05   
ref|XP_010449943.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|XP_010440316.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|NP_172803.1|  protein phosphatase 2A B'theta                      55.8    1e-05   
emb|CDY22925.1|  BnaA01g18630D                                        55.8    1e-05   
ref|XP_009125506.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
gb|AAK00963.1|AC079736_3  putative B' regulatory subunit of prote...  52.4    1e-05   
ref|XP_010317069.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|XP_006395602.1|  hypothetical protein EUTSA_v10004020mg           55.8    1e-05   
emb|CDY44370.1|  BnaC02g03070D                                        55.8    1e-05   
ref|XP_009145466.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|XP_002268726.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|XP_010490830.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|XP_006307325.1|  hypothetical protein CARUB_v10008945mg           55.5    1e-05   
ref|XP_010514232.1|  PREDICTED: serine/threonine protein phosphat...  55.5    1e-05   
ref|XP_010425263.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|XP_004231808.1|  PREDICTED: serine/threonine protein phosphat...  55.8    1e-05   
ref|XP_010423705.1|  PREDICTED: serine/threonine protein phosphat...  55.5    1e-05   
ref|XP_010514230.1|  PREDICTED: serine/threonine protein phosphat...  55.5    1e-05   
ref|XP_010452229.1|  PREDICTED: serine/threonine protein phosphat...  55.5    2e-05   
ref|XP_006287591.1|  hypothetical protein CARUB_v10000801mg           55.5    2e-05   
emb|CDY38628.1|  BnaA05g19590D                                        55.5    2e-05   
ref|XP_001693445.1|  PP2A-widerborst subunit                          55.5    2e-05   
ref|XP_007142878.1|  hypothetical protein PHAVU_007G024500g           55.5    2e-05   
dbj|BAK04196.1|  predicted protein                                    55.5    2e-05   
ref|XP_006447619.1|  hypothetical protein CICLE_v10014856mg           55.5    2e-05   
gb|KJB27048.1|  hypothetical protein B456_004G274600                  55.5    2e-05   
emb|CDY48287.1|  BnaC01g31410D                                        55.5    2e-05   
ref|XP_006659077.1|  PREDICTED: serine/threonine protein phosphat...  55.1    2e-05   
ref|XP_004239176.1|  PREDICTED: serine/threonine protein phosphat...  55.1    2e-05   
ref|XP_010458797.1|  PREDICTED: serine/threonine protein phosphat...  55.1    2e-05   
emb|CBI27539.3|  unnamed protein product                              55.1    2e-05   
ref|XP_002266932.1|  PREDICTED: serine/threonine protein phosphat...  55.1    2e-05   
gb|EYU38570.1|  hypothetical protein MIMGU_mgv1a005237mg              54.7    2e-05   
ref|XP_007217254.1|  hypothetical protein PRUPE_ppa003902mg           55.1    2e-05   
ref|XP_007162788.1|  hypothetical protein PHAVU_001G180600g           54.7    3e-05   
ref|NP_001148001.1|  transposon protein                               54.7    3e-05   
ref|XP_003055516.1|  Serine/threonine protein phosphatase 2A 57 k...  54.7    3e-05   
ref|XP_009768299.1|  PREDICTED: serine/threonine protein phosphat...  54.7    3e-05   
emb|CAN66032.1|  hypothetical protein VITISV_019650                   54.7    3e-05   
ref|XP_002956177.1|  hypothetical protein VOLCADRAFT_107119           54.7    3e-05   
ref|XP_010927329.1|  PREDICTED: serine/threonine protein phosphat...  54.7    3e-05   
ref|XP_010502490.1|  PREDICTED: serine/threonine protein phosphat...  54.7    3e-05   
ref|XP_010495328.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
ref|XP_008350950.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
ref|XP_008389803.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
gb|EYU34778.1|  hypothetical protein MIMGU_mgv1a004809mg              54.3    4e-05   
ref|XP_010476343.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
gb|KHG26982.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  54.3    4e-05   
emb|CDY44320.1|  BnaC05g30730D                                        54.3    4e-05   
ref|XP_003601840.1|  Serine/threonine protein phosphatase 2A 59 k...  54.3    4e-05   
gb|EEC82836.1|  hypothetical protein OsI_27645                        54.3    4e-05   
ref|XP_004972977.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
ref|NP_001060884.1|  Os08g0122000                                     54.3    4e-05   
ref|XP_001766093.1|  predicted protein                                54.3    4e-05   
ref|XP_009604718.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
ref|XP_010554220.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
ref|XP_009407773.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
ref|XP_011005899.1|  PREDICTED: serine/threonine protein phosphat...  54.3    4e-05   
ref|XP_006436521.1|  hypothetical protein CICLE_v10033481mg           54.3    4e-05   
ref|XP_002890006.1|  hypothetical protein ARALYDRAFT_471504           53.9    5e-05   
ref|XP_007163719.1|  hypothetical protein PHAVU_001G258400g           53.9    5e-05   
ref|XP_003553562.1|  PREDICTED: serine/threonine protein phosphat...  53.9    5e-05   
gb|KHN02304.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  53.9    5e-05   
ref|XP_006604586.1|  PREDICTED: serine/threonine protein phosphat...  53.9    5e-05   
ref|NP_195967.1|  protein phosphatase 2A B' alpha                     53.9    5e-05   
ref|XP_004310036.1|  PREDICTED: serine/threonine protein phosphat...  53.9    5e-05   
ref|XP_002459695.1|  hypothetical protein SORBIDRAFT_02g008950        53.9    5e-05   
ref|XP_011097329.1|  PREDICTED: serine/threonine protein phosphat...  53.9    5e-05   
ref|XP_011468144.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  53.9    5e-05   
ref|XP_010267227.1|  PREDICTED: serine/threonine protein phosphat...  53.9    6e-05   
ref|XP_006650885.1|  PREDICTED: serine/threonine protein phosphat...  53.9    6e-05   
ref|XP_002514975.1|  protein phosphatase 2a, regulatory subunit, ...  53.9    6e-05   
ref|XP_008643625.1|  PREDICTED: transposon protein isoform X1         53.9    6e-05   
ref|XP_002444972.1|  hypothetical protein SORBIDRAFT_07g002150        53.5    6e-05   
ref|XP_007044972.1|  Serine/threonine protein phosphatase 2A 59 k...  53.5    7e-05   
ref|XP_011098814.1|  PREDICTED: serine/threonine protein phosphat...  53.5    7e-05   
ref|XP_006293086.1|  hypothetical protein CARUB_v10019373mg           53.5    7e-05   
ref|XP_007144376.1|  hypothetical protein PHAVU_007G151100g           53.5    7e-05   
dbj|BAB02360.1|  protein phosphatase 2A B' regulatory subunit         53.5    7e-05   
emb|CBI30157.3|  unnamed protein product                              51.6    8e-05   
ref|NP_188802.1|  protein phosphatase 2A B'zeta                       53.5    8e-05   
ref|XP_010504323.1|  PREDICTED: serine/threonine protein phosphat...  53.1    9e-05   
ref|XP_007044975.1|  Phosphatase 2A regulatory B subunit family p...  53.1    9e-05   
ref|NP_001050908.2|  Os03g0681800                                     52.8    9e-05   
emb|CDX99733.1|  BnaC02g35870D                                        53.5    9e-05   
ref|XP_004502031.1|  PREDICTED: serine/threonine protein phosphat...  53.1    1e-04   
gb|KDP26746.1|  hypothetical protein JCGZ_17904                       53.1    1e-04   
gb|KHG23992.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  53.1    1e-04   
ref|XP_010556177.1|  PREDICTED: serine/threonine protein phosphat...  53.1    1e-04   
ref|XP_008230000.1|  PREDICTED: serine/threonine protein phosphat...  53.1    1e-04   
gb|KHG26884.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  52.8    1e-04   
gb|EEC75941.1|  hypothetical protein OsI_13037                        52.4    1e-04   
ref|XP_010103508.1|  Serine/threonine protein phosphatase 2A 57 k...  52.8    1e-04   
ref|XP_004502334.1|  PREDICTED: serine/threonine protein phosphat...  52.8    1e-04   
ref|XP_011084269.1|  PREDICTED: serine/threonine protein phosphat...  52.8    1e-04   
gb|AFK43061.1|  unknown                                               52.8    1e-04   
gb|AAP68376.1|  putative protein phosphatase 2A regulatory subuni...  52.8    1e-04   
ref|XP_010516038.1|  PREDICTED: serine/threonine protein phosphat...  52.8    1e-04   
ref|XP_006406248.1|  hypothetical protein EUTSA_v10020525mg           52.8    1e-04   
ref|XP_010551033.1|  PREDICTED: serine/threonine protein phosphat...  52.8    1e-04   
gb|EYU32426.1|  hypothetical protein MIMGU_mgv1a005619mg              52.8    1e-04   
emb|CDY07514.1|  BnaC06g15500D                                        52.8    1e-04   
gb|EPS60662.1|  hypothetical protein M569_14139                       52.8    1e-04   
gb|EYU34040.1|  hypothetical protein MIMGU_mgv1a004567mg              52.8    1e-04   
ref|XP_002268629.1|  PREDICTED: serine/threonine protein phosphat...  52.4    2e-04   
emb|CDY30030.1|  BnaC05g09900D                                        52.4    2e-04   
ref|XP_006403514.1|  hypothetical protein EUTSA_v10010320mg           52.4    2e-04   
ref|XP_009148646.1|  PREDICTED: serine/threonine protein phosphat...  52.4    2e-04   
ref|XP_006297394.1|  hypothetical protein CARUB_v10013418mg           52.4    2e-04   
ref|XP_009147392.1|  PREDICTED: serine/threonine protein phosphat...  52.4    2e-04   
emb|CDX98102.1|  BnaA06g08530D                                        52.4    2e-04   
ref|XP_006417120.1|  hypothetical protein EUTSA_v10007450mg           52.4    2e-04   



>ref|XP_009797723.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana sylvestris]
Length=507

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 68/89 (76%), Gaps = 9/89 (10%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWNKA+LNLTQNVRKV +EMDEELV  CQSKLEEE S SNV AERRRLTWE L+
Sbjct  421  ERNSQNHWNKAVLNLTQNVRKVFSEMDEELVLHCQSKLEEENSKSNVAAERRRLTWERLE  480

Query  572  VIA-------ASNISALTKPANASCLVSC  507
            + A        SNIS L KP  A+CLVSC
Sbjct  481  IAANYQPVTMPSNISGLVKP--ATCLVSC  507



>ref|XP_009630828.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana tomentosiformis]
 ref|XP_009630829.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana tomentosiformis]
Length=507

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 67/89 (75%), Gaps = 9/89 (10%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWNKA+LNLTQNVRKV +EMDEELV  CQ KLEEE S SN+ AERRRLTWE L+
Sbjct  421  ERNSQNHWNKAVLNLTQNVRKVFSEMDEELVLDCQGKLEEENSKSNIAAERRRLTWERLE  480

Query  572  VIA-------ASNISALTKPANASCLVSC  507
            + A        SNIS L KP  A+CLVSC
Sbjct  481  IAANYQPVTVPSNISGLVKP--ATCLVSC  507



>ref|XP_006366869.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum tuberosum]
Length=506

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 65/89 (73%), Gaps = 9/89 (10%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWNKA+LNL+QNVRKV +EMDEELV  CQ KLEE+ + SNV AERRRLTWE L+
Sbjct  420  ERNSQNHWNKAVLNLSQNVRKVFSEMDEELVLECQHKLEEDNAKSNVAAERRRLTWERLE  479

Query  572  VIA-------ASNISALTKPANASCLVSC  507
            + A        SNI  + KP   +CLVSC
Sbjct  480  IAANYEPVTVPSNIPGMVKP--PTCLVSC  506



>ref|XP_004251590.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313712.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313713.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313714.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313715.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
Length=506

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 64/89 (72%), Gaps = 9/89 (10%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E NSQ HWNKA+LNL+QNVRKV +EMDEELV  CQ KLEEE + SNV AERRRLTWE L+
Sbjct  420  EWNSQNHWNKAVLNLSQNVRKVFSEMDEELVLECQHKLEEENAKSNVAAERRRLTWERLE  479

Query  572  VIA-------ASNISALTKPANASCLVSC  507
            + A        SNI  L KP   +CLVSC
Sbjct  480  IAAKYEPVTVPSNIPGLVKP--PTCLVSC  506



>gb|KDP32329.1| hypothetical protein JCGZ_13254 [Jatropha curcas]
Length=503

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 7/88 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLTQN+RK+  EMDEEL+ ACQ KLEEE S+ ++ AE+RRLTWE L+
Sbjct  417  ERNTQNHWNQAVLNLTQNIRKMFCEMDEELMLACQRKLEEEDSMLSLKAEKRRLTWERLE  476

Query  572  VIAAS------NISALTKPANASCLVSC  507
              AA       NI A  KPA A+C V+C
Sbjct  477  NAAAGFRPAAENIMAPVKPA-ATCSVAC  503



>ref|XP_010656380.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 ref|XP_010656381.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 emb|CBI28127.3| unnamed protein product [Vitis vinifera]
Length=534

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 62/88 (70%), Gaps = 8/88 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+LNLT NVRK+  EMDEELV ACQ KLEEE S S++ AE+RRLTWE L+
Sbjct  449  ERNTRNHWNQAVLNLTLNVRKMFCEMDEELVLACQGKLEEEDSKSSMAAEKRRLTWERLE  508

Query  572  V------IAASNISALTKPANASCLVSC  507
                   +   NIS L  P  A+C V+C
Sbjct  509  TAASFQPVGGGNISFLVNP--ATCSVTC  534



>ref|XP_009389489.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 64/87 (74%), Gaps = 5/87 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+LNLTQNV+K+++EMDEEL  AC++K EEEK+   ++ E+RR+TWE L+
Sbjct  422  ERNTRSHWNQAVLNLTQNVKKMLSEMDEELFLACKTKFEEEKTRQTIMEEKRRMTWERLE  481

Query  572  VIAA-----SNISALTKPANASCLVSC  507
             IAA      N S L +PA A  +V+ 
Sbjct  482  SIAAFRPVTGNTSVLVRPAIAPPVVAA  508



>ref|XP_003609196.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES91393.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=510

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 64/88 (73%), Gaps = 8/88 (9%)
 Frame = -2

Query  746  NSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD--  573
            NSQ HWN+A+LNLTQN+RK++++MDEELV ACQ K+EEE S S+ VAERRR+TWE L+  
Sbjct  423  NSQNHWNQAVLNLTQNIRKMLSQMDEELVLACQRKIEEEDSKSSDVAERRRITWERLEEA  482

Query  572  ------VIAASNISALTKPANASCLVSC  507
                  V  +S+I    K A A+C V+C
Sbjct  483  ATSVQSVGGSSDILVQVKSATATCSVAC  510



>ref|XP_002515563.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47012.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=543

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLTQN+RK+  EMDEELV ACQ KLEEE S+ +V AE+RRL WE L+
Sbjct  459  ERNTQNHWNQAVLNLTQNIRKMFCEMDEELVVACQRKLEEEDSMLSVKAEKRRLIWERLE  518

Query  572  VI-----AASNISALTKPANASCLVSC  507
                   AA+N+ A  KP   +C VSC
Sbjct  519  SAASLQPAAANLLASVKP--TTCSVSC  543



>ref|XP_004508562.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cicer arietinum]
Length=511

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 8/88 (9%)
 Frame = -2

Query  746  NSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD--  573
            NSQ HWN+A+LNLTQN+RK++++MDE+LV ACQ ++EEE S SN VAERRR+TWE L+  
Sbjct  424  NSQNHWNQAVLNLTQNIRKMLSQMDEDLVLACQRRIEEEDSKSNDVAERRRITWERLEEA  483

Query  572  ------VIAASNISALTKPANASCLVSC  507
                  V  A +I    K A A+C V+C
Sbjct  484  ASNVQSVSGAGDILVPVKSAAATCSVAC  511



>gb|AFK37737.1| unknown [Medicago truncatula]
Length=510

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 8/88 (9%)
 Frame = -2

Query  746  NSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD--  573
            NSQ HWN+A+LNLTQN+RK++++MDEELV ACQ K+EEE S S+ VAER R+TWE L+  
Sbjct  423  NSQNHWNQAVLNLTQNIRKMLSQMDEELVLACQRKIEEEDSKSSDVAERGRITWERLEEA  482

Query  572  ------VIAASNISALTKPANASCLVSC  507
                  V  +S+I    K A A+C V+C
Sbjct  483  ATSVQSVGGSSDILVQVKSATATCFVAC  510



>ref|XP_006451049.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 ref|XP_006475757.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Citrus sinensis]
 gb|ESR64289.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 gb|KDO80418.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
 gb|KDO80419.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=504

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLTQNVRK++ EMDEELV AC+ KLEEE S  +V AERR+LTWE L+
Sbjct  420  ERNTQNHWNQAVLNLTQNVRKILCEMDEELVQACKRKLEEENSTLSVAAERRKLTWERLE  479

Query  572  VIA-----ASNISALTKPANASCLVSC  507
              A     A  I A  KP  A+C V+C
Sbjct  480  SAASFQPSADYIIAPVKP--ATCSVAC  504



>ref|XP_006451050.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 ref|XP_006475756.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Citrus sinensis]
 gb|ESR64290.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 gb|KDO80417.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=537

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLTQNVRK++ EMDEELV AC+ KLEEE S  +V AERR+LTWE L+
Sbjct  453  ERNTQNHWNQAVLNLTQNVRKILCEMDEELVQACKRKLEEENSTLSVAAERRKLTWERLE  512

Query  572  VIA-----ASNISALTKPANASCLVSC  507
              A     A  I A  KP  A+C V+C
Sbjct  513  SAASFQPSADYIIAPVKP--ATCSVAC  537



>ref|XP_007013281.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 2 [Theobroma cacao]
 gb|EOY30900.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 2 [Theobroma cacao]
Length=506

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWN+A+LNLTQN+RK++ EMDEELV  CQ KLEEE S  +  AE+R+LTWE L+
Sbjct  422  ERNSQNHWNQAVLNLTQNIRKMLCEMDEELVLTCQCKLEEENSQLSEAAEKRKLTWERLE  481

Query  572  VI-----AASNISALTKPANASCLVSC  507
                   AA+N+    KP  A+C V+C
Sbjct  482  SAAGFQPAAANMIPPVKP--AACPVAC  506



>gb|KHG08948.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=507

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 8/88 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWN+A+LNLTQN+RK+  EMDEEL+ ACQ KLEEE S     AE+R+L WEHL+
Sbjct  422  ERNSQNHWNQAVLNLTQNIRKMFCEMDEELLLACQRKLEEENSQLIEAAEKRKLAWEHLE  481

Query  572  VIAASNISALT------KPANASCLVSC  507
              AA+   A T      KPA    LV+C
Sbjct  482  TTAAAFKPAATNNVPPVKPATP--LVAC  507



>ref|XP_007013280.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 1 [Theobroma cacao]
 gb|EOY30899.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 1 [Theobroma cacao]
Length=545

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWN+A+LNLTQN+RK++ EMDEELV  CQ KLEEE S  +  AE+R+LTWE L+
Sbjct  461  ERNSQNHWNQAVLNLTQNIRKMLCEMDEELVLTCQCKLEEENSQLSEAAEKRKLTWERLE  520

Query  572  VI-----AASNISALTKPANASCLVSC  507
                   AA+N+    KP  A+C V+C
Sbjct  521  SAAGFQPAAANMIPPVKP--AACPVAC  545



>ref|XP_004287389.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Fragaria vesca subsp. 
vesca]
Length=502

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 59/88 (67%), Gaps = 8/88 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT NVRK+  EMDEELV ACQ KLEEE   SN  AE+RR+TWE L+
Sbjct  417  ERNTQNHWNQAVLNLTMNVRKMFCEMDEELVLACQCKLEEEHIKSNSAAEKRRITWERLE  476

Query  572  V------IAASNISALTKPANASCLVSC  507
                   + A N  A  KP  ++C V C
Sbjct  477  TAAGVQPVVACNFLAPIKP--STCPVVC  502



>ref|XP_008242686.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
 ref|XP_008242687.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
 ref|XP_008242688.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
Length=502

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT NV+K+ ++MDEELV ACQ KLEEE   S+  AE+RRLTWE L+
Sbjct  418  ERNTQNHWNQAVLNLTLNVKKMFSDMDEELVLACQCKLEEEDIRSSAAAEKRRLTWERLE  477

Query  572  VIA-----ASNISALTKPANASCLVSC  507
              A     A N  A  KP  A+C V C
Sbjct  478  TAAGVQPVACNFLAPIKP--ATCPVVC  502



>ref|XP_010049936.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Eucalyptus grandis]
 gb|KCW82762.1| hypothetical protein EUGRSUZ_C04140 [Eucalyptus grandis]
Length=505

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 10/90 (11%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+LNLT+N++K++TEMDEEL+ ACQ KLEE+  LSNVVAE+RR TWE L+
Sbjct  418  EQNIQSHWNQAVLNLTRNLKKILTEMDEELMSACQRKLEEDNLLSNVVAEKRRATWERLE  477

Query  572  VIAA-----SNISAL---TKPANASCLVSC  507
              +A     +NI  L    +P  A+C VSC
Sbjct  478  NASAVQPVCNNILLLNVSVEP--ATCSVSC  505



>ref|XP_007155131.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 ref|XP_007155132.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 gb|ESW27125.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 gb|ESW27126.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
Length=509

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 62/87 (71%), Gaps = 7/87 (8%)
 Frame = -2

Query  746  NSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDVI  567
            N+Q HWN+A+LNLTQN+RK++++MDEELV ACQ + EEE S+++  AERRR+TWE L+  
Sbjct  423  NAQSHWNQAVLNLTQNIRKMLSQMDEELVAACQRRTEEEDSVASAAAERRRVTWERLEAA  482

Query  566  AASNISALTKPAN-------ASCLVSC  507
            A+   S++    +       A+C V+C
Sbjct  483  ASVQSSSMGGGGDVLVPVKSATCSVAC  509



>ref|XP_007138335.1| hypothetical protein PHAVU_009G200100g [Phaseolus vulgaris]
 gb|ESW10329.1| hypothetical protein PHAVU_009G200100g [Phaseolus vulgaris]
Length=506

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (73%), Gaps = 4/84 (5%)
 Frame = -2

Query  746  NSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDVI  567
            N+Q HWN+A+LN T+N+RK++++MDEELV ACQ KLEEE S S+  AERRR+TWE L+  
Sbjct  423  NTQYHWNRAVLNHTENMRKMLSQMDEELVFACQHKLEEEDSRSSAAAERRRVTWERLEAA  482

Query  566  AASNISALTKP----ANASCLVSC  507
            A +N+  +       A+ +C V+C
Sbjct  483  AIANVQPIAVVGDVLASPACSVAC  506



>ref|XP_008458023.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis melo]
 ref|XP_008458029.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis melo]
Length=500

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 7/86 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN A+LNLT NV+K++ EMDEELV ACQ  L+EE+S S   AE+RRLTWE L+
Sbjct  416  ERNTQKHWNNAVLNLTLNVKKLVHEMDEELVLACQVDLKEEQSRSVAAAEKRRLTWERLE  475

Query  572  VIA-----ASNISALTKPANASCLVS  510
              A     + NIS L +P  A+C V+
Sbjct  476  NAARPQPISPNISFLVEP--ATCAVA  499



>ref|XP_004163599.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
Length=500

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 7/86 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN A+LNLT NV+K++ EMDEELV ACQ  L+EE+S S   AE+RRLTWE L+
Sbjct  416  ERNTQKHWNNAVLNLTLNVKKLVHEMDEELVLACQVDLKEEQSKSVAAAEKRRLTWERLE  475

Query  572  VIA-----ASNISALTKPANASCLVS  510
              A     + NIS L +P  A+C V+
Sbjct  476  NAARPQPISPNISFLVEP--ATCAVA  499



>ref|XP_007204385.1| hypothetical protein PRUPE_ppa004572mg [Prunus persica]
 gb|EMJ05584.1| hypothetical protein PRUPE_ppa004572mg [Prunus persica]
Length=502

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT NV+K+ ++MDEELV ACQ KLEEE   S+  AE+RRLTWE L+
Sbjct  418  ERNTQNHWNQAVLNLTLNVKKMFSDMDEELVLACQCKLEEEDIRSSAAAEKRRLTWERLE  477

Query  572  VIAASNISA---LTKPANASCLVSC  507
              A     A   L     A+C V C
Sbjct  478  TAAGVQPVACNFLAPIKTAACPVVC  502



>emb|CDP21530.1| unnamed protein product [Coffea canephora]
Length=519

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E NS+ HWNK +LNLTQN+RKV++EMD+EL  ACQ+K+EEE S S++ AE+R++TWE L+
Sbjct  435  EWNSRNHWNKTVLNLTQNLRKVLSEMDQELALACQNKVEEENSKSSLAAEKRKMTWERLE  494

Query  572  VIAA-----SNISALTKPANASCLVS  510
              A+     S+IS + +  +ASC+VS
Sbjct  495  TAASCQSIVSSISGVRE--SASCVVS  518



>gb|KJB54144.1| hypothetical protein B456_009G022600 [Gossypium raimondii]
 gb|KJB54145.1| hypothetical protein B456_009G022600 [Gossypium raimondii]
Length=507

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWN+A+LNLTQN+RK+  EMDEEL+ ACQ KLEEE S     AE+R+L WE L+
Sbjct  422  ERNSQNHWNQAVLNLTQNIRKMFCEMDEELLLACQHKLEEENSQLIEAAEKRKLAWERLE  481

Query  572  VIAASNISALT---KPANASCL-VSC  507
              AA+   A T    P   + L V+C
Sbjct  482  TTAAAFKPAATNNVPPVKPATLPVAC  507



>ref|XP_003549794.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoformX1 [Glycine max]
 ref|XP_006600772.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Glycine max]
 ref|XP_006600773.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X3 [Glycine max]
Length=514

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  746  NSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDVI  567
            N Q HWN+A+LNLTQN+RK++++MDEELV ACQ ++EEE S ++  AERRR+TWE L+  
Sbjct  423  NGQSHWNQAVLNLTQNIRKMLSQMDEELVAACQRRIEEEDSSASSAAERRRVTWERLEAA  482

Query  566  AA  561
            AA
Sbjct  483  AA  484



>ref|XP_009374054.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=502

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT NV+K   +MDEELV ACQ KLEEE   S+  AE+RRLTWE L+
Sbjct  418  ERNTQNHWNQAVLNLTLNVKKTFCDMDEELVLACQCKLEEENKRSSAAAEKRRLTWERLE  477

Query  572  VIA-----ASNISALTKPANASCLVSC  507
              A     A N  +  KP   +C V C
Sbjct  478  TAAGVQPVACNFLSPIKP--PACPVVC  502



>ref|XP_008337354.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=502

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT NV+K   +MDEELV ACQ KLEEE   S+  AE+RRLTWE L+
Sbjct  418  ERNTQNHWNQAVLNLTLNVKKTFCDMDEELVLACQFKLEEENIRSSAAAEKRRLTWERLE  477

Query  572  VIA-----ASNISALTKPANASCLVSC  507
              A     A N  +  KP   +C V C
Sbjct  478  TAAGVQPVACNFLSPIKP--PACPVVC  502



>ref|XP_009371422.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=502

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 6/80 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT NV+K   +MDEELV ACQ KLEEE   S+  AE+RRLTWE L+
Sbjct  418  ERNTQHHWNQAVLNLTLNVKKTFCDMDEELVIACQCKLEEENLRSSAAAEKRRLTWERLE  477

Query  572  V------IAASNISALTKPA  531
                   +A + +S +  PA
Sbjct  478  TAAGVQPVACNFLSPIKPPA  497



>ref|XP_004139334.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 gb|KGN60641.1| hypothetical protein Csa_2G005870 [Cucumis sativus]
Length=500

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 7/86 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN A+LNLT NV+K++ EMDEELV ACQ  L+EE+S     AE+RRLTWE L+
Sbjct  416  ERNTQKHWNNAVLNLTLNVKKLVHEMDEELVLACQVDLKEEQSKLVAAAEKRRLTWERLE  475

Query  572  VIA-----ASNISALTKPANASCLVS  510
              A     + NIS L +P  A+C V+
Sbjct  476  NAARPQPISPNISFLVEP--ATCAVA  499



>gb|KJB83138.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83139.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83140.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83141.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
Length=506

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS+ HW++ +LNLT+N RK+++E+D+EL  AC+ KLEEE S SN  +E+R+LTWE L+
Sbjct  422  ERNSRNHWHQTVLNLTKNTRKMLSEIDDELTLACERKLEEENSQSNEASEKRKLTWERLE  481

Query  572  VI-----AASNISALTKPANASCLVSC  507
            +      AA+N+    KP  A+C V+C
Sbjct  482  LAAGFEPAAANLVPPLKP--ATCSVAC  506



>ref|XP_008386225.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
 ref|XP_008343968.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
 ref|XP_008362926.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=502

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 6/80 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT N++K   +MDEELV ACQ KLEEE   S+  AE+RRLTWE L+
Sbjct  418  ERNTQHHWNQAVLNLTLNMKKTFCDMDEELVIACQCKLEEENLRSSAAAEKRRLTWERLE  477

Query  572  V------IAASNISALTKPA  531
                   +A + +S +  PA
Sbjct  478  TAAGVQPVACNFLSPIKPPA  497



>ref|XP_010249885.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
Length=503

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 63/87 (72%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK+++E+D+ELV  C+SKLEEE++     AE+RRLTWE L+
Sbjct  419  EKNTRNHWNQSVLNLTVNVRKMLSELDDELVLTCESKLEEEEANQRAAAEKRRLTWERLE  478

Query  572  VIAA-----SNISALTKPANASCLVSC  507
             +A+      N + L  PA A+  ++C
Sbjct  479  NVASIQPMTGNTAVLVTPATAA--IAC  503



>ref|XP_008811587.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Phoenix dactylifera]
Length=509

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NSQ HWN+A+LNLT NVRK+++EMDEEL  ACQ K EE++     V E+R+  WE L+
Sbjct  421  EKNSQSHWNQAVLNLTMNVRKMLSEMDEELFLACQRKFEEDEEKRVAVEEKRKKAWERLE  480

Query  572  VIAA-----SNISALTKPANASCLVS  510
            + AA      N + L +P  A  + +
Sbjct  481  IAAAFQPMTGNTAVLVRPVMAPAIAA  506



>ref|XP_003524519.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Glycine max]
 ref|XP_006579740.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Glycine max]
 gb|KHN15139.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=515

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 63/93 (68%), Gaps = 13/93 (14%)
 Frame = -2

Query  746  NSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV-  570
            N++ HWN+A+LNLTQN+RK++++MDEELV ACQ ++EEE S ++  AERRR+TWE ++  
Sbjct  423  NARSHWNQAVLNLTQNIRKMLSQMDEELVVACQRRIEEEDSSASAAAERRRVTWERIEAA  482

Query  569  --------IAASNISA----LTKPANASCLVSC  507
                    + +S++      L    +A+C V+C
Sbjct  483  AAAASTSCVQSSSVGGGGDVLVPVKSATCSVAC  515



>ref|XP_010254226.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
 ref|XP_010254227.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
Length=507

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK+ +E+D+ELV  CQSK EEE++  N  AE+RRLTWE L+
Sbjct  423  EKNTRNHWNQSVLNLTVNVRKMFSELDDELVLTCQSKFEEEETKQNAAAEKRRLTWERLE  482

Query  572  VIAA  561
             +A+
Sbjct  483  NMAS  486



>gb|KHN10406.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=390

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  746  NSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDVI  567
            + Q H N+A+LNLTQN+RK++++MDEELV ACQ ++EEE S ++  AERRR+TWE L+  
Sbjct  299  DGQSHLNQAVLNLTQNIRKMLSQMDEELVAACQRRIEEEDSSASSAAERRRVTWERLEAA  358

Query  566  AA  561
            AA
Sbjct  359  AA  360



>gb|KJB64864.1| hypothetical protein B456_010G068400 [Gossypium raimondii]
Length=496

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 7/82 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS+ HWN+A+LNLTQ+++K++ EMDEELV AC+ K+EEE S S+   E+R+L WE L+
Sbjct  422  ERNSENHWNQAVLNLTQSIKKMLCEMDEELVLACRQKMEEENSQSSEATEKRKLIWERLE  481

Query  572  VIAASNISALTKPANASCLVSC  507
               A+N+     P  A+C V+C
Sbjct  482  --TAANV---IPP--AACPVAC  496



>ref|XP_006841877.1| hypothetical protein AMTR_s00042p00019010 [Amborella trichopoda]
 gb|ERN03552.1| hypothetical protein AMTR_s00042p00019010 [Amborella trichopoda]
Length=489

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+LNLT NVRK+ +EMDEEL    QS  EEE++ +  V E+RRLTWE L+
Sbjct  402  ERNTRSHWNQAVLNLTLNVRKMFSEMDEELFQMFQSNYEEEEAKAKGVEEKRRLTWERLE  461

Query  572  VIAASNISALTKPANASCLVSC*MI  498
              A S  S   K  N + LV+  +I
Sbjct  462  AAAKSGPSDPAK--NTAVLVTPLII  484



>ref|XP_002324961.1| hypothetical protein POPTR_0018s06320g [Populus trichocarpa]
 gb|EEF03526.1| hypothetical protein POPTR_0018s06320g [Populus trichocarpa]
Length=497

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 5/82 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+++L  TQ++RK+  EMDEELV ACQ KLEE+ SLS+V AE+RRLTWE L+
Sbjct  417  EQNTLNHWNQSVLIQTQHIRKMFCEMDEELVLACQRKLEEQDSLSSVEAEKRRLTWERLE  476

Query  572  VIAASNISALTKPANASCLVSC  507
                 N + L   A+    VSC
Sbjct  477  -----NAADLQPRADNILPVSC  493



>ref|XP_011010867.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like, partial [Populus euphratica]
Length=557

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 5/82 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+++L  TQ++RK+  EMDEELV ACQ KLEE+ SLS+V AE+RRLTWE L+
Sbjct  477  EQNTLNHWNQSVLIQTQHIRKMFCEMDEELVLACQRKLEEQDSLSSVEAEKRRLTWERLE  536

Query  572  VIAASNISALTKPANASCLVSC  507
                 N + L   A+    VSC
Sbjct  537  -----NAADLQPRADNILPVSC  553



>ref|XP_010098941.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
 gb|EXB76243.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
Length=736

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 54/97 (56%), Gaps = 16/97 (16%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT NV+KV  EMDEELV ACQ KLE E       AE+RRL WE L+
Sbjct  641  ERNTQNHWNQAVLNLTLNVKKVFCEMDEELVLACQCKLEGEGVRLKDAAEKRRLAWELLE  700

Query  572  VIAA---------------SNISALTKPANASCLVSC  507
              A                 N     KP  A+C V+C
Sbjct  701  TTAGLPPATTTAATTTAGAGNFLVPVKP-TATCSVAC  736



>gb|KHG22084.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=496

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 7/82 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS+ HWN+A+LNLTQ+++K++ E+DEELV AC+ K+EEE S S    E+R+LTWE L+
Sbjct  422  ERNSENHWNQAVLNLTQSIKKMLCEVDEELVLACRQKIEEENSQSIEATEKRKLTWERLE  481

Query  572  VIAASNISALTKPANASCLVSC  507
               A+N+        A+C V+C
Sbjct  482  --TAANVI-----LPAACPVTC  496



>emb|CBI20930.3| unnamed protein product [Vitis vinifera]
Length=143

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNL+ NVRK+++EMD+EL  AC ++ +EE+S  N+ A++R+ TWE L+
Sbjct  59   ERNAQSHWNQAVLNLSLNVRKMLSEMDDELFLACHARFKEEESRLNLEAQKRKETWEQLE  118

Query  572  VIA-----ASNISALTKPANASCLVSC  507
              A     + N + L  P   S  ++C
Sbjct  119  NEASLQPVSGNTAVLVTPLATS--ITC  143



>dbj|BAJ86218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=486

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MD++L+ ACQ  L+EE+       ERRRL WEHL+
Sbjct  398  ERNARLHWNQSVLNITMNVRKMFFDMDQKLLLACQKNLQEEEEKQAASEERRRLIWEHLE  457

Query  572  VIAASN-------ISALTKPA  531
              AA +        +A  KPA
Sbjct  458  RNAAFHPVTRDISFAAFPKPA  478



>gb|EMS68651.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Triticum urartu]
Length=486

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MD++L+ ACQ   +EE+       ERRRL WEHL+
Sbjct  398  ERNARLHWNQSVLNVTMNVRKMFFDMDQKLLLACQKNFQEEEEKQAATEERRRLIWEHLE  457

Query  572  VIAASN-------ISALTKPA  531
              AA +        +A  KPA
Sbjct  458  KNAAFHPVTRDISFAAFPKPA  478



>gb|EMT02137.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Aegilops tauschii]
Length=486

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MD++L+ ACQ   +EE+       ERRRL WEHL+
Sbjct  398  ERNARLHWNQSVLNVTMNVRKMFFDMDQKLLLACQKNFQEEEEKRAATEERRRLIWEHLE  457

Query  572  VIAASN-------ISALTKPA  531
              AA +        +A  KPA
Sbjct  458  RDAAFHPVTRDISFAAFPKPA  478



>ref|XP_008809266.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Phoenix dactylifera]
Length=509

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NS+ HWN+A+LNLT NVRK+++EMDEEL  ACQ K +EE+     V E+R++TWE L+
Sbjct  421  EKNSRSHWNQAVLNLTMNVRKMLSEMDEELFLACQRKFKEEEERRVAVEEKRKMTWERLE  480

Query  572  VIAA-----SNISALTKP  534
              AA      N + L +P
Sbjct  481  TAAAFRPVTGNTAVLVRP  498



>ref|XP_010670759.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Beta vulgaris subsp. vulgaris]
Length=499

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 6/82 (7%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNLT NVRK+  EMDE L   CQ +  E+++  +V+AE+R+  WE L+
Sbjct  417  ERNTQSHWNQAVLNLTLNVRKIFQEMDEPLFLECQMQYREDEAKLSVIAEQRKENWERLE  476

Query  572  VIAA------SNISALTKPANA  525
              AA       NI+ L  P+ A
Sbjct  477  NAAARLQPITGNIAVLVTPSVA  498



>ref|XP_010913433.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010913512.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=509

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NSQ HWN+A+LNLT NVRK+++EMDEEL  ACQ K EEE+     V E+R++TWE L+
Sbjct  421  EKNSQNHWNQAVLNLTMNVRKMLSEMDEELFLACQRKFEEEEEKRVAVEEKRKMTWERLE  480

Query  572  VIAA  561
              A+
Sbjct  481  TAAS  484



>ref|XP_002284526.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 ref|XP_010648553.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
Length=492

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN+A+LNL+ NVRK+++EMD+EL  AC ++ +EE+S  N+ A++R+ TWE L+
Sbjct  408  ERNAQSHWNQAVLNLSLNVRKMLSEMDDELFLACHARFKEEESRLNLEAQKRKETWEQLE  467

Query  572  VIA-----ASNISALTKPANASCLVSC  507
              A     + N + L  P   S  ++C
Sbjct  468  NEASLQPVSGNTAVLVTPLATS--ITC  492



>ref|XP_004960832.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Setaria italica]
Length=480

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  EMDE L+ ACQ+  +EE+       ERRRL WEHL+
Sbjct  392  ERNARWHWNQSVLNVTMNVRKMFFEMDERLLLACQTNFQEEEKKRAASEERRRLVWEHLE  451

Query  572  VIAA-----SNISALTKPANAS  522
              AA      +I     P +A 
Sbjct  452  RNAAFHPVTGDIGFAVPPTSAP  473



>ref|XP_011087131.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Sesamum indicum]
Length=491

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 7/83 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N Q HWN+A+LNLT NVRKV+ EMD+ L+ +C S  +E++   NVV E+R+  WEHL+
Sbjct  413  EVNMQNHWNQAVLNLTLNVRKVLMEMDDALIMSCISNYQEQQEKMNVVDEKRKEVWEHLE  472

Query  572  VIAASNISALTKP--ANASCLVS  510
              AAS      KP   N + LV+
Sbjct  473  TAAAS-----LKPIAGNTAVLVT  490



>tpg|DAA53185.1| TPA: hypothetical protein ZEAMMB73_340114 [Zea mays]
Length=112

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MDE L+ AC    +EE+    V  ERRRL WE L+
Sbjct  18   ERNTRWHWNQSVLNVTMNVRKMFRDMDERLLQACHDNFQEEEEKRAVTEERRRLMWEQLE  77

Query  572  VIAASNISALTKPA  531
              AA      T  A
Sbjct  78   RSAARGYHQPTTIA  91



>ref|XP_007137075.1| hypothetical protein PHAVU_009G097600g [Phaseolus vulgaris]
 gb|ESW09069.1| hypothetical protein PHAVU_009G097600g [Phaseolus vulgaris]
Length=497

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NSQ HW++A+LNL+ NVRK+  EMDE+L  AC S+ +EE+++ N  AE+R+  W+ L+
Sbjct  419  EKNSQGHWSQAVLNLSHNVRKMFAEMDEKLFLACHSQFKEEEAMLNAAAEKRKEAWKQLE  478

Query  572  VIAA-----SNISALTKP  534
              A+      N + L  P
Sbjct  479  HAASLQPVIGNTAVLVSP  496



>ref|XP_008649389.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Zea mays]
 gb|AFW77313.1| hypothetical protein ZEAMMB73_789762 [Zea mays]
Length=486

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MDE L+ ACQ+  +EE+       ERRRL WEHL+
Sbjct  398  ERNARWHWNQSVLNVTMNVRKMFFDMDERLLLACQTNFQEEEKKRAASEERRRLVWEHLE  457

Query  572  VIAA-----SNISALTKPANAS  522
              AA      +I     P +A 
Sbjct  458  RNAAFHPVTGDIGFAVPPTSAP  479



>ref|XP_003567932.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Brachypodium distachyon]
Length=506

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NSQ HWN+A+LNLT NV K+ +EMDEEL  AC +K +EE      + E+RRLTWE L+
Sbjct  418  EQNSQNHWNQAVLNLTANVMKMFSEMDEELFSACLTKCKEEDDNQASLEEKRRLTWEKLE  477

Query  572  VIAA  561
              AA
Sbjct  478  SAAA  481



>ref|XP_002440704.1| hypothetical protein SORBIDRAFT_09g005420 [Sorghum bicolor]
 gb|EES19134.1| hypothetical protein SORBIDRAFT_09g005420 [Sorghum bicolor]
Length=484

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MDE L+ ACQ+  +EE+       ERRRL WEHL+
Sbjct  396  ERNARWHWNQSVLNVTMNVRKMFLDMDERLLLACQTNFQEEEKKRAASEERRRLVWEHLE  455

Query  572  VIAA-----SNISALTKPANASCLVS  510
              AA      +I     P +A  +  
Sbjct  456  RNAAFHPVTGDIGFAVPPTSAPLVAP  481



>ref|XP_010925297.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010925298.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=507

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T N+RK+ +EMD +L  ACQ K +EE+    V+ ERRRL WE L+
Sbjct  419  ERNARCHWNQSVLNVTMNIRKMFSEMDGDLFLACQRKFQEEEEKRVVLEERRRLIWERLE  478

Query  572  VIAASNISALTKPANASCLVS  510
               A+    +T+  N + LV+
Sbjct  479  --TAATFQPVTR--NTAVLVT  495



>gb|EMS52063.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Triticum urartu]
Length=435

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MDE L+ +CQS  + ++       ERRRLTWE L+
Sbjct  351  ERNARLHWNQSVLNVTMNVRKMFFDMDERLLLSCQSNFQADEEKRAAAEERRRLTWEQLE  410

Query  572  VIAASNISALTKPANAS  522
                 N     +PA AS
Sbjct  411  ----RNADPAFQPAKAS  423



>emb|CAB76153.1| putative B' regulatory subunit of PP2A [Oryza sativa]
Length=143

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 4/82 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E NSQ HWN+A+LNLT NV+K+ +EMD+ L  AC  K +E++     +  +RRLTWE L+
Sbjct  55   EHNSQNHWNQAVLNLTDNVKKMFSEMDDVLFSACLVKYKEDEERQASLESKRRLTWEKLE  114

Query  572  VIAASNISALTKPANASCLVSC  507
              +A++   +T   + + LV C
Sbjct  115  --SAASFQPVT--GHTAVLVGC  132



>ref|XP_003526435.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=497

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NSQ HW++A+LNLT NVRK+  EMDE+L  A  S+ +EE+++ N  AE+R+  W+ L+
Sbjct  419  EKNSQGHWSQAVLNLTHNVRKMFVEMDEKLFLASHSQFKEEEAMLNTAAEKRKEAWKQLE  478

Query  572  VIAASNISALTKPANASCLVS  510
               A+++  +T   N   LVS
Sbjct  479  --HAASLQPVT--GNTPVLVS  495



>ref|XP_004501280.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004501281.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Cicer arietinum]
Length=498

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+  HWN  +LNLT NVRK+  EMDE+L  +CQS+ +EE+++ N  AE+R+  W+ L+
Sbjct  420  ERNAHSHWNPTVLNLTHNVRKMFMEMDEKLFLSCQSQFKEEEAMLNSEAEKRKEAWKQLE  479

Query  572  VIAA-----SNISALTKP  534
              A+      N + L  P
Sbjct  480  HSASLQPVVGNTAVLVSP  497



>ref|XP_008785883.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Phoenix dactylifera]
 ref|XP_008785890.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Phoenix dactylifera]
Length=507

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HW++++LN+T N+RK+ ++MD +L  ACQ K +EE+    V+ ERRRL WE L+
Sbjct  419  ERNARCHWSQSVLNVTMNIRKMFSDMDGDLFLACQRKFQEEEDKRGVMEERRRLIWERLE  478

Query  572  VIAASNISALTKPANASCLVS  510
               A+    +T+  N + LV+
Sbjct  479  --TAATFQPVTR--NTAVLVT  495



>ref|XP_008785874.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Phoenix dactylifera]
Length=526

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HW++++LN+T N+RK+ ++MD +L  ACQ K +EE+    V+ ERRRL WE L+
Sbjct  438  ERNARCHWSQSVLNVTMNIRKMFSDMDGDLFLACQRKFQEEEDKRGVMEERRRLIWERLE  497

Query  572  VIAASNISALTKPANASCLVS  510
               A+    +T+  N + LV+
Sbjct  498  --TAATFQPVTR--NTAVLVT  514



>emb|CDP18419.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N+Q HWN A+LNLT NVR +  EMD+ L  AC  + +EEK   N+ A++R+  WEHL+
Sbjct  412  ENNAQSHWNHAVLNLTLNVRSMFKEMDDALFLACHLRYKEEKEQLNLAAQKRKEAWEHLE  471

Query  572  VIA-----ASNISALTKPANAS  522
              A     A NI+ L  P   S
Sbjct  472  NAASLKPIAENIAVLVTPLATS  493



>ref|XP_002455079.1| hypothetical protein SORBIDRAFT_03g003950 [Sorghum bicolor]
 gb|EES00199.1| hypothetical protein SORBIDRAFT_03g003950 [Sorghum bicolor]
Length=503

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 12/91 (13%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWE---  582
            ERN++ HWN+++LN+T NVRK+  EMDE L+ ACQ+  +EE+       ERRRL WE   
Sbjct  411  ERNTRWHWNQSVLNVTMNVRKMFREMDERLLLACQNNFQEEEEKRAATEERRRLMWEQLE  470

Query  581  -------HLDVIAASNISALTKPANASCLVS  510
                   H  VIAA   ++   P +++ LV+
Sbjct  471  RSAARGHHQPVIAAD--ASFPAPPSSARLVA  499



>ref|NP_001141673.1| uncharacterized protein LOC100273799 [Zea mays]
 gb|ACF86836.1| unknown [Zea mays]
 gb|ACN34163.1| unknown [Zea mays]
 gb|ACR38723.1| unknown [Zea mays]
 tpg|DAA53184.1| TPA: hypothetical protein ZEAMMB73_340114 [Zea mays]
Length=497

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MDE L+ AC    +EE+    V  ERRRL WE L+
Sbjct  403  ERNTRWHWNQSVLNVTMNVRKMFRDMDERLLQACHDNFQEEEEKRAVTEERRRLMWEQLE  462

Query  572  VIAASNISALT  540
              AA      T
Sbjct  463  RSAARGYHQPT  473



>ref|XP_004138753.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 ref|XP_004173408.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 gb|KGN62895.1| Protein phosphatase 2a, regulatory subunit [Cucumis sativus]
Length=515

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+A++NLT NVRK+  EMD+EL  +C ++ +EE+    + A++R+  WE L+
Sbjct  430  EKNAQSHWNQAVVNLTLNVRKIFMEMDDELFISCHAQFKEEEVKETLEAKKRKQIWEQLE  489

Query  572  VIAASNISALT  540
              AA+N+  +T
Sbjct  490  N-AAANVQPMT  499



>ref|XP_010533199.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Tarenaya hassleriana]
Length=500

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N + HWN+A+L+LTQN++K+++EMDEELV  CQ+KLEEE       AE+R   W  L+
Sbjct  416  EQNIRNHWNRAVLSLTQNLKKMLSEMDEELVTECQNKLEEESKRVTSNAEKRESAWRVLE  475

Query  572  VIAASNISA--LTKPAN-ASC-LVSC  507
              AASN +A   + P   ASC +V+C
Sbjct  476  T-AASNFNAPEASPPLKLASCAIVAC  500



>ref|XP_006654758.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Oryza brachyantha]
Length=508

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E NSQ HWN+A+LNLT NV+K+ +EMDEEL  AC  K +E++     +  +R LTWE L+
Sbjct  420  EHNSQNHWNQAVLNLTANVKKMFSEMDEELFSACLIKYKEDEERQGSLESKRMLTWERLE  479

Query  572  VIAA  561
              AA
Sbjct  480  SAAA  483



>ref|XP_010231656.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Brachypodium distachyon]
Length=489

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MD++L+ AC+  L+EE+       ERRRL WEHL+
Sbjct  400  ERNARLHWNQSVLNVTMNVRKMFFDMDQKLLLACEINLQEEEEKQAASEERRRLIWEHLE  459



>gb|EEE64635.1| hypothetical protein OsJ_19488 [Oryza sativa Japonica Group]
Length=140

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E NSQ HWN+A+LNLT NV+K+ +EMD+ L  AC  K +E++     +  +RRLTWE L+
Sbjct  52   EHNSQNHWNQAVLNLTDNVKKMFSEMDDVLFSACLVKYKEDEERQASLESKRRLTWEKLE  111

Query  572  VIAA  561
              A+
Sbjct  112  SAAS  115



>ref|XP_007013747.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
 gb|EOY31366.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
Length=503

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+A+LNLT NVRK+  EMD+ L  +C +  +EE++  +++AE+R+  WE L+
Sbjct  419  EKNAQNHWNQAVLNLTLNVRKIFMEMDDVLFMSCHTHFKEEEAKLSILAEKRKEAWERLE  478

Query  572  VIAASNISALTKPANASCLVS  510
               A+++  +T   N + LV+
Sbjct  479  --NAASLQPIT--GNTAVLVT  495



>ref|XP_006371724.1| hypothetical protein POPTR_0018s01130g, partial [Populus trichocarpa]
 gb|ERP49521.1| hypothetical protein POPTR_0018s01130g, partial [Populus trichocarpa]
Length=118

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+ +LNLT NVRK+ +EMD+ L  AC  +  E++   +V+AE+R+  W+ L+
Sbjct  34   EKNAHDHWNQGVLNLTLNVRKMFSEMDDALYLACLDQFREDEERQSVLAEQRKEAWQRLE  93

Query  572  VIAA-----SNISALTKPANASCLVSC  507
              A+      N + L  P   S  ++C
Sbjct  94   YAASLKPITGNTAVLVTPLATS--IAC  118



>ref|XP_009798807.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Nicotiana sylvestris]
Length=499

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N+Q HWN+A+ NL+ NVRK+ +EMD+ +  AC S  +EE+   N+ AE+R+  WE L+
Sbjct  414  ENNAQNHWNQAVQNLSLNVRKMFSEMDDVVFMACHSHYKEEQEKINLEAEKRKEAWEQLE  473

Query  572  VIA------ASNISALTKPANASCLVSC  507
            + A      A NI  L  P   S  ++C
Sbjct  474  IAASLRPPIAGNIGVLVMPLATS--ITC  499



>ref|XP_003522642.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=496

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NSQ HW++++LNLT NVRK+  EMDE+L  A  S+ +EE+ + N+ AE+R+  W+ L+
Sbjct  418  EKNSQGHWSQSVLNLTYNVRKMFVEMDEKLFLASHSQFKEEEVMLNMAAEKRKEAWKQLE  477

Query  572  VIAASNISALTKPANASCLVS  510
              AAS   A+    N   LVS
Sbjct  478  H-AASLQPAI---GNTPVLVS  494



>gb|EYU21914.1| hypothetical protein MIMGU_mgv1a005231mg [Erythranthe guttata]
Length=492

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N+Q HWN+A+LNLT NV+K+++EMDE LV  C S  E E+   N+  E+RR  WE L+
Sbjct  415  ETNAQSHWNQAVLNLTLNVKKMLSEMDEALVAECVSNYEAEQKGKNLAVEKRREIWERLE  474



>ref|XP_010925115.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010925116.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=509

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NS+ HWN+A+LNLT NVRK+++EMDEEL  ACQ KLEEE+     V E+R++TWE L+
Sbjct  421  EKNSRSHWNQAVLNLTMNVRKMLSEMDEELFLACQRKLEEEEERREAVEEKRKMTWERLE  480

Query  572  VIAA-----SNISALTKP  534
              AA      N + L +P
Sbjct  481  SAAAFQPVTGNTAVLVRP  498



>gb|KHG19967.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=502

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN A+LNLT NVRK+  EMD++L  +C    +EE++  +++AE+R+  W+ L+
Sbjct  418  EKNAQNHWNHAVLNLTINVRKMFMEMDDQLFISCHIHFKEEEAKVSILAEKRKEAWKQLE  477

Query  572  VIA-----ASNISALTKP  534
              A     A N + L  P
Sbjct  478  NAASLKPIAGNTAVLVTP  495



>ref|XP_006643825.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Oryza brachyantha]
Length=491

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 55/91 (60%), Gaps = 10/91 (11%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MDE L+ ACQ+  + ++       ERRRL WE L+
Sbjct  397  ERNTRWHWNQSVLNVTLNVRKMFLDMDERLLLACQNNFQADEEKRAATEERRRLMWEQLE  456

Query  572  VIAA----------SNISALTKPANASCLVS  510
              AA          +N ++   P +++ LV+
Sbjct  457  RNAAAATFHHHPVITNDTSFPAPPSSAPLVA  487



>ref|XP_010109039.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
 gb|EXC20791.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
Length=668

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+Q HWN A+LNLT NVRK+  EM+EEL  +C ++ +EE++  ++ +E+R+  W+ L+
Sbjct  422  ERNAQNHWNPAVLNLTLNVRKIFIEMEEELFASCHAQFKEEEAKLSLASEKRKEAWQRLE  481



>gb|EAY98962.1| hypothetical protein OsI_20919 [Oryza sativa Indica Group]
Length=510

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E NSQ HWN+A+LNLT NV+K+ +EMD+ L  AC  K +E++     +  +RRLTWE L+
Sbjct  422  EHNSQNHWNQAVLNLTDNVKKMFSEMDDVLFSACLVKYKEDEETQASLESKRRLTWEKLE  481

Query  572  VIAA  561
              A+
Sbjct  482  SAAS  485



>dbj|BAG98544.1| unnamed protein product [Oryza sativa Japonica Group]
Length=168

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NV+K+  +MDE L+ ACQ+  + E+       ERRRL WE L+
Sbjct  74   ERNTRWHWNQSVLNVTLNVKKMFLDMDERLLLACQNNFQAEEEKRAATEERRRLMWEQLE  133

Query  572  VIAAS  558
              AA+
Sbjct  134  RNAAA  138



>ref|XP_006654101.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Oryza brachyantha]
Length=483

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  EMDE L+ ACQ   +EE+       ERR+L WE+L+
Sbjct  395  ERNARWHWNQSVLNVTMNVRKMFLEMDEGLLLACQRNFQEEEEKRAASEERRKLIWENLE  454

Query  572  VIAA-----SNISALTKPANASCLVS  510
              A+      +I     PA+A  +  
Sbjct  455  RNASFHPVTGDIGFSVLPASAPLVAP  480



>gb|KDP32288.1| hypothetical protein JCGZ_13213 [Jatropha curcas]
Length=498

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+A+LNLT NVRK+ +EMDE L  +C S+ ++++   ++VAE+R+  W  L+
Sbjct  414  EKNTYSHWNQAVLNLTLNVRKMFSEMDEALFQSCLSQFKDDEEKLSLVAEKRKEAWRRLE  473

Query  572  VIAASNISALTKPANASCLVS  510
               A+N+  +T   N + LV+
Sbjct  474  --NAANLKPIT--GNTAVLVT  490



>ref|XP_001758786.1| predicted protein [Physcomitrella patens]
 gb|EDQ76292.1| predicted protein [Physcomitrella patens]
Length=526

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+  LT NVRK+  EMD+EL   CQ K EE+++ +  V E R LTW+ L+
Sbjct  426  ERNTRSHWNQAVHGLTLNVRKMFVEMDQELFQECQRKYEEDEAKAKGVGEMRDLTWKRLE  485

Query  572  VIA  564
            +  
Sbjct  486  IAG  488



>ref|NP_001148974.1| transposon protein [Zea mays]
 gb|ACG33695.1| transposon protein [Zea mays]
Length=501

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+LNLT NV+K+++EMD++L  +C +K ++EK     +  +RRLTWE L+
Sbjct  413  EQNIQNHWNQAVLNLTVNVKKMLSEMDDDLFSSCLAKYKDEKEKRVSLEAKRRLTWEKLE  472

Query  572  VIAA  561
              AA
Sbjct  473  SAAA  476



>ref|NP_001042191.1| Os01g0178400 [Oryza sativa Japonica Group]
 dbj|BAF04105.1| Os01g0178400, partial [Oryza sativa Japonica Group]
Length=205

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NV+K+  +MDE L+ ACQ+  + E+       ERRRL WE L+
Sbjct  111  ERNTRWHWNQSVLNVTLNVKKMFLDMDERLLLACQNNFQAEEEKRAATEERRRLMWEQLE  170

Query  572  VIAAS  558
              AA+
Sbjct  171  RNAAA  175



>ref|XP_003569694.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Brachypodium distachyon]
Length=484

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  +MDE L+ ACQS  + E+       ERRRL W+ L+
Sbjct  397  ERNARWHWNQSVLNVTMNVRKMFFDMDERLLLACQSNFQLEEEKRTAAEERRRLVWKQLE  456

Query  572  -----VIAAS  558
                 V+A S
Sbjct  457  RNAQPVVAGS  466



>emb|CAC85920.1| protein phosphatase 2A B'kappa subunit [Oryza sativa Japonica 
Group]
 gb|AAT58738.1| protein phosphatase 2A B'kappa subunit [Oryza sativa Japonica 
Group]
Length=510

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E NSQ HWN+A+LNLT NV+K+ +EMD+ L  AC  K +E++     +  +RRLTWE L+
Sbjct  422  EHNSQNHWNQAVLNLTDNVKKMFSEMDDVLFSACLVKYKEDEERQASLESKRRLTWEKLE  481

Query  572  VIAA  561
              A+
Sbjct  482  SAAS  485



>ref|XP_006382064.1| hypothetical protein POPTR_0006s26330g [Populus trichocarpa]
 gb|ERP59861.1| hypothetical protein POPTR_0006s26330g [Populus trichocarpa]
Length=135

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 50/82 (61%), Gaps = 5/82 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN  +LNLT N+RK+ +EMD+ L  AC  +L+E++   +++AE+R+  W+ L+
Sbjct  51   EKNAHNHWNPGVLNLTLNIRKMFSEMDDALYLACLDQLKEDEEKLSLLAEQRKEAWQRLE  110

Query  572  VIAA-----SNISALTKPANAS  522
              A+      N + L  P   S
Sbjct  111  YAASLKPMTGNTAVLVTPLATS  132



>ref|XP_009385620.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009385621.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=509

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A++NL+QNV+ +++EMDEE+  AC+ +L EE+    +  E+R++ WEHL+
Sbjct  421  ERNTRSHWNQAVINLSQNVKNMLSEMDEEIFLACKKELGEEEEKRRIAEEKRKMIWEHLE  480

Query  572  VIAA-----SNISALTKPANASCLVS  510
              AA      N + +  P  A  + +
Sbjct  481  GSAALQPVTGNTAVMVMPTVAPPITA  506



>ref|XP_009407446.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407448.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 5/79 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN + HWN+A+LNLT+NV+K+++EM+EEL  AC+ K E+E+     + E+RR+ WE L+
Sbjct  422  ERNIRSHWNQAVLNLTENVKKMLSEMNEELFTACKKKFEDEEEKRVAMEEKRRMIWECLE  481

Query  572  VIAA-----SNISALTKPA  531
              AA     SN + L  PA
Sbjct  482  TTAAFQPVTSNTAVLVIPA  500



>ref|XP_004498632.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cicer arietinum]
Length=500

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            +RN + HWN A++NLT N+RK+  EMDE+L  +C +  +EE+++  + AE+R+  W+ L+
Sbjct  420  DRNIKSHWNPAVVNLTHNIRKMFVEMDEKLFISCHTHFKEEETILILEAEKRKEAWKQLE  479

Query  572  VIAA-----SNISALTKP  534
              A+      NI+ L  P
Sbjct  480  HAASLKPVIGNIAVLVSP  497



>ref|XP_007161261.1| hypothetical protein PHAVU_001G055500g [Phaseolus vulgaris]
 gb|ESW33255.1| hypothetical protein PHAVU_001G055500g [Phaseolus vulgaris]
Length=491

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            +RN Q HWN A++NLT N+RK+  EMDE+L  +C +  +EE+++    AE+R+  WE L+
Sbjct  415  DRNVQSHWNPAVVNLTHNIRKMFLEMDEKLFISCHNHFKEEEAILTSAAEKRKEAWEQLE  474



>ref|XP_006852143.1| hypothetical protein AMTR_s00049p00063500 [Amborella trichopoda]
 gb|ERN13610.1| hypothetical protein AMTR_s00049p00063500 [Amborella trichopoda]
Length=528

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL  AC +K  E+++   V+ E+R  TW+ L+
Sbjct  435  ERNTKNHWNQAVQSLTLNVRKIFSDLDHELFEACLAKFREDEAKDEVIQEKREATWKRLE  494

Query  572  VIAAS  558
             +AAS
Sbjct  495  DVAAS  499



>ref|XP_009151080.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Brassica rapa]
Length=495

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK+  EMDE L  +C ++ +E++   +  AE+R+ TWE L+
Sbjct  411  EKNAENHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFQEDEGKQSSAAEKRKETWERLE  470

Query  572  VIAASNISALT  540
               A+++  +T
Sbjct  471  --KAASVKPIT  479



>gb|KJB07811.1| hypothetical protein B456_001G045700 [Gossypium raimondii]
Length=502

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN A+LNLT NVRK+  EMD++L  +C    +EE++  ++++E+R+  W+ L+
Sbjct  418  EKNAQNHWNHAVLNLTINVRKMFMEMDDQLFISCHIHFKEEEAKVSILSEKRKEAWKQLE  477

Query  572  VIA-----ASNISALTKP  534
              A     A N + L  P
Sbjct  478  NAASLKPIAGNTAVLVTP  495



>gb|EEE62528.1| hypothetical protein OsJ_17326 [Oryza sativa Japonica Group]
Length=318

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 5/86 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  EMDE L+  CQ   +EE+       ERR+L WE+L+
Sbjct  230  ERNTRWHWNQSVLNVTMNVRKMFLEMDEGLLLTCQRNFQEEEEKRAASEERRKLIWENLE  289

Query  572  VIAA-----SNISALTKPANASCLVS  510
              A+      +I     PA+A  +  
Sbjct  290  RNASFRPVTGDIGFSVLPASAPLVAP  315



>ref|XP_009619322.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Nicotiana tomentosiformis]
Length=499

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N+Q HWN A+ NL+ NVRK+ +EMD+    AC S  +EE+   N+ AE+R+  WE L+
Sbjct  414  ENNAQNHWNHAVQNLSLNVRKMFSEMDDVFFMACHSHYKEEQEKINLEAEKRKEAWERLE  473

Query  572  VIA------ASNISALTKPANASCLVSC  507
              A      A NI  L  P   S  ++C
Sbjct  474  SAASLRPPIAGNIGVLVMPLATS--ITC  499



>ref|XP_003603467.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES73718.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=499

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 8/83 (10%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N   HWN A+LNLT NVRK+  EMDE L   C+S+ +EE++  N  +E+R   W+ L+
Sbjct  421  EKNFHSHWNPAVLNLTHNVRKMFKEMDENLFLTCRSQFKEEEAQLNSESEKRNEAWKQLE  480

Query  572  VIAASNISALTKPA--NASCLVS  510
              A+       KPA  N + LVS
Sbjct  481  HTAS------LKPAVGNTAVLVS  497



>ref|XP_006353657.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum tuberosum]
Length=498

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N+Q HWN A+ NL+ NVR++ +EMD+ L  AC S  +EE+   N+ +E+R+  WE L+
Sbjct  413  ESNAQNHWNHAVQNLSLNVRRMFSEMDDVLFLACHSHYKEEQEKINLESEKRKEAWEQLE  472

Query  572  VIA------ASNISALTKPANASCLVSC  507
              A      A NI+ L  P   S  ++C
Sbjct  473  TAASLRPPVAGNIAVLVMPLATS--ITC  498



>ref|XP_002458327.1| hypothetical protein SORBIDRAFT_03g031350 [Sorghum bicolor]
 gb|EES03447.1| hypothetical protein SORBIDRAFT_03g031350 [Sorghum bicolor]
Length=500

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N Q HWN ++LNLT NV+K+++EMDEEL  AC +  +EE+ +  ++  +RRL WE L+
Sbjct  423  EENIQNHWNVSVLNLTTNVKKMLSEMDEELFSACLAAHKEEEEMRALLKGKRRLAWELLE  482

Query  572  VIAA  561
              AA
Sbjct  483  SAAA  486



>gb|KHF99622.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
zeta-like protein [Gossypium arboreum]
Length=548

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+  HWN A+ + T NVRK+ T++D  L   C S+ +E++     + ERR LTW+HL+
Sbjct  448  ERNTNGHWNLAVQSFTLNVRKIFTDVDHVLFDECLSRFQEDELKEKEMQERRELTWKHLE  507

Query  572  VIAASNISALTKPANASCLVS  510
             +A+S  +A    +N + LVS
Sbjct  508  DVASSTTAA----SNEAVLVS  524



>ref|XP_007221123.1| hypothetical protein PRUPE_ppa018321mg, partial [Prunus persica]
 gb|EMJ22322.1| hypothetical protein PRUPE_ppa018321mg, partial [Prunus persica]
Length=111

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+AI  LT NVR++  EMD EL   CQ +  E+++ +  + E+R LTW+ ++
Sbjct  37   EKNTQGHWNQAIHGLTANVRRMFQEMDPELFEECQEQYLEKETRAREMEEQRELTWKRIE  96

Query  572  VIAAS  558
             +AA+
Sbjct  97   AVAAT  101



>ref|XP_009415355.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN Q HWN+ +LNLTQ V+K+ +EMDEELV AC+ K EE++     + E+RRL WEH++
Sbjct  422  ERNLQSHWNQTVLNLTQYVKKMFSEMDEELVLACKKKFEEKEKKQKTMEEKRRLIWEHME  481

Query  572  VIAAS-----NISALTKPANASCLVSC  507
               A      N + L  P  A  + + 
Sbjct  482  TSTAFHPVTRNTTVLVVPVIAPPIAAA  508



>gb|ACN30940.1| unknown [Zea mays]
Length=501

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+LNLT NV+K+++EMD++L  +C +K ++E+     +  +RRLTWE L+
Sbjct  413  EQNIQNHWNQAVLNLTVNVKKMLSEMDDDLFSSCLAKYKDEEEKRASLEAKRRLTWEKLE  472

Query  572  VIAA  561
              AA
Sbjct  473  SAAA  476



>gb|EEE53979.1| hypothetical protein OsJ_00602 [Oryza sativa Japonica Group]
Length=379

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NV+K+  +MDE L+ ACQ+  + E+       ERRRL WE L+
Sbjct  285  ERNTRWHWNQSVLNVTLNVKKMFLDMDERLLLACQNNFQAEEEKRAATEERRRLMWEQLE  344

Query  572  VIAAS  558
              AA+
Sbjct  345  RNAAA  349



>ref|NP_001054799.1| Os05g0178400 [Oryza sativa Japonica Group]
 gb|AAT77357.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16713.1| Os05g0178400 [Oryza sativa Japonica Group]
 gb|EAY96746.1| hypothetical protein OsI_18666 [Oryza sativa Indica Group]
 dbj|BAG95746.1| unnamed protein product [Oryza sativa Japonica Group]
Length=491

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 5/86 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NVRK+  EMDE L+  CQ   +EE+       ERR+L WE+L+
Sbjct  403  ERNTRWHWNQSVLNVTMNVRKMFLEMDEGLLLTCQRNFQEEEEKRAASEERRKLIWENLE  462

Query  572  VIAA-----SNISALTKPANASCLVS  510
              A+      +I     PA+A  +  
Sbjct  463  RNASFRPVTGDIGFSVLPASAPLVAP  488



>gb|EMS60469.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Triticum urartu]
Length=438

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN A+LNLT NV K+ +EMDEEL  AC +K +E++     + E+RRL W  L+
Sbjct  362  EQNGQNHWNHAVLNLTANVMKMFSEMDEELFSACLTKCKEDEENQASMEEKRRLKWAKLE  421

Query  572  VIAA  561
              AA
Sbjct  422  SAAA  425



>gb|EMT11476.1| hypothetical protein F775_43033 [Aegilops tauschii]
Length=519

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN A+LNLT NV K+ +EMDEEL  AC +K +E++     + E+RRL W  L+
Sbjct  250  EQNGQNHWNHAVLNLTANVMKMFSEMDEELFSACLTKCKEDEENQASMEEKRRLKWAKLE  309

Query  572  VIAA  561
              AA
Sbjct  310  SAAA  313



>ref|XP_002440213.1| hypothetical protein SORBIDRAFT_09g027870 [Sorghum bicolor]
 gb|EES18643.1| hypothetical protein SORBIDRAFT_09g027870 [Sorghum bicolor]
Length=501

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+LNLT NV+K+ +EMD++L  +C +K +EE+     +  +R+LTWE L+
Sbjct  413  EQNIQNHWNQAVLNLTVNVKKMFSEMDDDLFSSCLAKYKEEEEKRVSLEAKRKLTWEKLE  472

Query  572  VIAA  561
              AA
Sbjct  473  AAAA  476



>dbj|BAD67828.1| putative serine/threonine protein phosphatase 2A (PP2A) regulatory 
subunit B' (B'gamma) [Oryza sativa Japonica Group]
 dbj|BAD67990.1| putative serine/threonine protein phosphatase 2A (PP2A) regulatory 
subunit B' (B'gamma) [Oryza sativa Japonica Group]
Length=503

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NV+K+  +MDE L+ ACQ+  + E+       ERRRL WE L+
Sbjct  409  ERNTRWHWNQSVLNVTLNVKKMFLDMDERLLLACQNNFQAEEEKRAATEERRRLMWEQLE  468

Query  572  VIAAS  558
              AA+
Sbjct  469  RNAAA  473



>ref|XP_004969560.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Setaria italica]
Length=355

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N Q HWN ++LNLT NV+K+++EMDEEL  AC +K +E+      + ++RRL WE L+
Sbjct  278  EENIQNHWNVSVLNLTANVKKMLSEMDEELFSACLAKHKEDGERQASLEQKRRLAWERLE  337

Query  572  VIAASNISALTKPANASCLVS  510
              +A+    +T   N + LVS
Sbjct  338  --SAAAFQPVT--GNTAVLVS  354



>gb|EEC70043.1| hypothetical protein OsI_00633 [Oryza sativa Indica Group]
Length=396

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+++LN+T NV+K+  +MDE L+ ACQ+  + E+       ERRRL WE L+
Sbjct  302  ERNTRWHWNQSVLNVTLNVKKMFLDMDERLLLACQNNFQAEEEKRAATEERRRLMWEQLE  361

Query  572  VIAAS  558
              AA+
Sbjct  362  RNAAA  366



>ref|XP_008647861.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647862.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647863.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647864.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 gb|ACN27844.1| unknown [Zea mays]
 gb|ACN28036.1| unknown [Zea mays]
 gb|ACN29212.1| unknown [Zea mays]
 gb|AFW79075.1| transposon protein isoform 1 [Zea mays]
 gb|AFW79076.1| transposon protein isoform 2 [Zea mays]
 gb|AFW79077.1| transposon protein isoform 3 [Zea mays]
 gb|AFW79078.1| transposon protein isoform 4 [Zea mays]
Length=501

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKL--EEEKSLSNVVAERRRLTWEH  579
            E+N Q HWN+A+LNLT NV+K+++EMD++L  +C +K   EEEK +S  +  +RRLTWE 
Sbjct  413  EQNIQNHWNQAVLNLTVNVKKMLSEMDDDLFSSCLAKYKDEEEKRVS--LEAKRRLTWEK  470

Query  578  LDVIAA  561
            L+  AA
Sbjct  471  LESAAA  476



>ref|XP_011026522.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Populus euphratica]
Length=500

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+ +LNLT NVRK+ +EMD+ L  AC  +  E++   +V+AE+R+  W+ L+
Sbjct  416  EKNAHDHWNQGVLNLTLNVRKMFSEMDDALYLACLDQFREDEERQSVLAEQRKEAWQRLE  475

Query  572  VIAASNISALTKPANASCLVS  510
               A+++  +T+  N + LV+
Sbjct  476  --HAASLKPITR--NTAVLVT  492



>gb|KJB42861.1| hypothetical protein B456_007G171000 [Gossypium raimondii]
 gb|KJB42862.1| hypothetical protein B456_007G171000 [Gossypium raimondii]
Length=518

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN+  HWN+A+ + T NVRK+ T++D  L   C S+ +E++     + ERR LTW+HL+
Sbjct  420  ERNTSGHWNQAVQSFTLNVRKMFTDVDHMLFDECLSRFQEDELKEKEMQERRELTWKHLE  479

Query  572  VIAASNISALTKPANASCLVS  510
             + +S  +A    +N + LVS
Sbjct  480  DVVSSTTAA----SNEAVLVS  496



>ref|XP_010493808.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Camelina sativa]
Length=506

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+++LNLT NVRK+  EMDE L  +C S+ +E+++     AE+R+  WE L+
Sbjct  422  EKNAQDHWNQSVLNLTLNVRKMFCEMDEALFMSCHSRFKEDEAKQCSAAEKRKEVWERLE  481



>gb|EPS70113.1| hypothetical protein M569_04647, partial [Genlisea aurea]
Length=465

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWE  582
            E N++ HWN+A++NLT NV+K++ EMDEEL  +C SK  EE++ +  VAE+R   WE
Sbjct  404  EANAEHHWNQAVVNLTLNVKKMVVEMDEELAVSCLSKYREEQNYNKTVAEKRNEMWE  460



>emb|CDX80521.1| BnaC07g29230D [Brassica napus]
Length=496

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++  +  AE+R+ TWE L+
Sbjct  412  EKNAESHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFQEDEAKQSSEAEKRKETWERLE  471

Query  572  VIAASNISALT  540
               A+++  +T
Sbjct  472  --KAASVMPIT  480



>ref|XP_010421407.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Camelina sativa]
Length=506

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+++LNLT NVRK+  EMDE L  +C S+ +E+++     AE+R+  WE L+
Sbjct  422  EKNAQDHWNQSVLNLTLNVRKMFCEMDEALFMSCHSRFKEDEAKQCSAAEKRKQDWERLE  481



>emb|CDX88186.1| BnaA06g27770D [Brassica napus]
Length=495

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK+  EMDE L  +C ++  E+++  +  AE+R+ TWE L+
Sbjct  411  EKNAENHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFREDEAEQSSAAEKRKETWERLE  470

Query  572  VIAASNISALT  540
               A+++  +T
Sbjct  471  --KAASVKPIT  479



>ref|XP_004969559.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Setaria italica]
Length=500

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N Q HWN ++LNLT NV+K+++EMDEEL  AC +K +E+      + ++RRL WE L+
Sbjct  423  EENIQNHWNVSVLNLTANVKKMLSEMDEELFSACLAKHKEDGERQASLEQKRRLAWERLE  482

Query  572  VIAA  561
              AA
Sbjct  483  SAAA  486



>ref|XP_002965046.1| hypothetical protein SELMODRAFT_167051 [Selaginella moellendorffii]
 gb|EFJ33884.1| hypothetical protein SELMODRAFT_167051 [Selaginella moellendorffii]
Length=539

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NS+ HWN+ + NLT NVRK++ EMD EL   CQ + EEE++   VV ++R   W  L+
Sbjct  442  EKNSRSHWNQTVHNLTLNVRKMLVEMDPELFSECQKRFEEEEAKHKVVEDKREAKWRRLE  501



>ref|XP_006338659.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Solanum tuberosum]
 ref|XP_006338660.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Solanum tuberosum]
 ref|XP_006338661.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X3 [Solanum tuberosum]
Length=520

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 10/91 (11%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ NLT NVRK+ +++D EL   C  K EE+K+    V  +R +TW+ L+
Sbjct  435  EKNARGHWNQAVQNLTLNVRKIFSDIDSELFEECLQKFEEDKAQEEEVKRKREITWKRLE  494

Query  572  VIAASNISALTKPANASCLVSC*MIEHQRTP  480
             +A      +   +N   LVS     H+ TP
Sbjct  495  ELA-----GMKAASNEPVLVS-----HKTTP  515



>gb|KHN10390.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=430

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            +RN Q HWN A++NLT N+RK+  EMDE+   +C +  +EE+++     E+R+  W+ L+
Sbjct  354  DRNVQSHWNPAVVNLTHNIRKMFLEMDEKFFISCHNHFKEEEAILISTGEKRKEAWKQLE  413

Query  572  VIAASNISALTKPANASCLVS  510
               A+++  +T   N + LVS
Sbjct  414  --HAASLRPVT--GNTAVLVS  430



>ref|XP_004241801.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Solanum lycopersicum]
Length=498

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N+Q HWN A+ NL+ NVR++ +EMD+ L  AC S  +EE+   ++ +E+R+  WE L+
Sbjct  413  ESNTQNHWNHAVQNLSLNVRRMFSEMDDVLFLACHSHYKEEQEKIDLESEKRKEAWEQLE  472

Query  572  VIA------ASNISALTKPANASCLVSC  507
              A      A NI+ L  P   S  ++C
Sbjct  473  TAASLRPPVAGNIAVLVTPLATS--ITC  498



>ref|XP_006450560.1| hypothetical protein CICLE_v10008015mg [Citrus clementina]
 gb|ESR63800.1| hypothetical protein CICLE_v10008015mg [Citrus clementina]
Length=518

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+A+LNLT NVRK+ +EMD+ L  +C ++  E+ +  ++V +RR+  WE L+
Sbjct  434  EKNAQSHWNQAVLNLTLNVRKMFSEMDDVLFMSCHAQYREQVANLSLVDQRRKEAWEQLE  493

Query  572  VIAASNISALTKPANASCLVS  510
               A+ +  +T   N + LV+
Sbjct  494  --NAARLQPIT--GNTAVLVT  510



>ref|XP_002516615.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF45956.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=498

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+A+LNLT N+RK+ +EMDE L  +C ++ +EE+   +++AE+R+  W  L+
Sbjct  414  EKNALNHWNQAVLNLTLNIRKMFSEMDEVLFLSCLAQFKEEQENLSLMAEKRKEAWRQLE  473

Query  572  VIAA-----SNISALTKPANASCLVSC  507
              A+      N + L  P   S  ++C
Sbjct  474  YAASLKPITGNTAVLVTPLATS--IAC  498



>ref|XP_006476191.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Citrus sinensis]
 gb|KDO79624.1| hypothetical protein CISIN_1g010120mg [Citrus sinensis]
Length=518

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+A+LNLT NVRK+ +EMD+ L  +C ++  E+ +  ++V +RR+  WE L+
Sbjct  434  EKNAQSHWNQAVLNLTLNVRKMFSEMDDVLFMSCHAQYREQVANLSLVDQRRKEAWEQLE  493

Query  572  VIAASNISALTKPANASCLVS  510
               A+ +  +T   N + LV+
Sbjct  494  --NAARLQPIT--GNTAVLVT  510



>ref|XP_004961286.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Setaria italica]
Length=500

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 4/66 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKL--EEEKSLSNVVAERRRLTWEH  579
            E+N Q HWN+A+LNLT NV+K+ +EMDE+L  +C +K   +EEK +S  V  +R+LTWE 
Sbjct  412  EQNIQNHWNQAVLNLTLNVKKMFSEMDEDLFSSCLAKYKEDEEKRVSFEV--KRKLTWEK  469

Query  578  LDVIAA  561
            L+  AA
Sbjct  470  LESAAA  475



>gb|EYU39647.1| hypothetical protein MIMGU_mgv1a005452mg [Erythranthe guttata]
Length=483

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N + HWN+AI+ L+ NVRK+  EMD EL   CQ + EE+++ +  + E+R+LTW+ L+
Sbjct  408  EKNIRGHWNQAIIGLSSNVRKMFIEMDSELFEECQRQYEEKEARTGEMEEQRQLTWKKLE  467

Query  572  VIAASNISALTKPANASCLV  513
             +AA      T P +   +V
Sbjct  468  EVAAQT----TTPGDNMVIV  483



>ref|XP_006476190.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Citrus sinensis]
Length=539

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+A+LNLT NVRK+ +EMD+ L  +C ++  E+ +  ++V +RR+  WE L+
Sbjct  455  EKNAQSHWNQAVLNLTLNVRKMFSEMDDVLFMSCHAQYREQVANLSLVDQRRKEAWEQLE  514

Query  572  VIAASNISALTKPANASCLVS  510
               A+ +  +T   N + LV+
Sbjct  515  --NAARLQPIT--GNTAVLVT  531



>ref|XP_009377509.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=503

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWN+A+LNLT NVRK+  EMD++L  +  +   EE++     A++R+  WE L+
Sbjct  419  ERNSQNHWNQAVLNLTLNVRKMFVEMDDQLFISSHAHYMEEEAKQGSTAKKRKEAWEQLE  478

Query  572  VIAA-----SNISALTKPANASCLVSC  507
              A+      N + L  P   S  ++C
Sbjct  479  NAASLQPVTGNTAVLVMPIATS--IAC  503



>ref|XP_003550157.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform 1 [Glycine max]
Length=492

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            +RN Q HWN A++NLT N+RK+  EMDE+   +C +  +EE+++     E+R+  W+ L+
Sbjct  416  DRNVQSHWNPAVVNLTNNIRKMFLEMDEKFFISCHNHFKEEEAILISTGEKRKEAWKQLE  475

Query  572  VIAASNISALTKPANASCLVS  510
               A+++  +T   N + LVS
Sbjct  476  --HAASLRPVT--GNTAVLVS  492



>ref|XP_003544625.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=492

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            +RN Q HWN A++NLT N+RK+  EMDE+L  +C +  +EE+++    AE+R+  W+ L+
Sbjct  416  DRNVQSHWNPAVVNLTHNIRKMFLEMDEKLFISCHNHFKEEEAILISTAEKRKEAWKQLE  475



>ref|XP_008394018.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=512

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNSQ HWN+A+LNLT NVRK+  EMD++L  +  +   EE++  +  A++R+  WE L+
Sbjct  428  ERNSQNHWNQAVLNLTLNVRKMFVEMDDQLFLSSHAHYMEEEAKQSSAAKKRKEAWEQLE  487

Query  572  VIAA-----SNISALTKPANASCLVSC  507
              A+      N + L  P   S  ++C
Sbjct  488  NAASLQPVTGNTAVLVTPIATS--IAC  512



>gb|KHN03104.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform, partial [Glycine soja]
Length=404

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            +RN Q HWN A++NLT N+RK+  EMDE+L  +C +  +EE+++    AE+R+  W+ L+
Sbjct  328  DRNVQSHWNPAVVNLTHNIRKMFLEMDEKLFISCHNHFKEEEAILISTAEKRKEAWKQLE  387



>ref|XP_006428449.1| hypothetical protein CICLE_v10013819mg, partial [Citrus clementina]
 gb|ESR41689.1| hypothetical protein CICLE_v10013819mg, partial [Citrus clementina]
Length=107

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT NVRK+  +MD EL   CQ++ EE++S +  V E+R LTW+ L 
Sbjct  34   EKNIQSHWNQAVHGLTVNVRKMFLDMDAELFEECQNQYEEKESRAKEVEEQRELTWKRLA  93

Query  572  VIA  564
             +A
Sbjct  94   DVA  96



>dbj|BAK03510.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN A+LNLT NV K+ +EMDEEL   C +K +E++     + E+RRL W  L+
Sbjct  424  EQNGQNHWNHAVLNLTANVMKMFSEMDEELFSVCLTKCKEDEENQVSMEEKRRLKWAKLE  483

Query  572  VIAA  561
              AA
Sbjct  484  SAAA  487



>gb|KFK27832.1| hypothetical protein AALP_AA8G435800 [Arabis alpina]
Length=502

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++     AE+R+  W  L+
Sbjct  418  EKNAQNHWNQSVLNLTLNVRKMFCEMDEALFMSCHTRFQEDEAKQCSAAEKRKEIWARLE  477

Query  572  VIAA  561
             +A+
Sbjct  478  NVAS  481



>ref|XP_006287577.1| hypothetical protein CARUB_v10000786mg [Capsella rubella]
 gb|EOA20475.1| hypothetical protein CARUB_v10000786mg [Capsella rubella]
Length=501

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++     AE+R+  WE L+
Sbjct  417  EKNAQNHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFKEDEAKECSAAEKRKEIWERLE  476



>ref|XP_011019731.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Populus euphratica]
Length=499

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN  +LNLT N+RK+ +EMD+ L  AC  +L+E++   +++AE+R+  W  L+
Sbjct  415  EKNAHNHWNPGVLNLTLNIRKMFSEMDDALYLACLDQLKEDEEKLSLLAEQRKEAWHRLE  474

Query  572  VIAA-----SNISALTKPANASCLVSC  507
              A+      N + L  P   S  ++C
Sbjct  475  YAASLKPMTGNTAVLVTPLATS--IAC  499



>ref|XP_009377393.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
 ref|XP_009377396.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=512

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS  HWN+A+LNL+ NVRK+  EMDE+L  +  +   EE++  ++ A++R+  WE L+
Sbjct  428  ERNSHNHWNQAVLNLSLNVRKMFVEMDEQLFLSSHAHFMEEEAKQSLAAKKRKEAWERLE  487

Query  572  VIAA-----SNISALTKPANASCLVSC  507
              A+      N + L  P   S  ++C
Sbjct  488  NAASLQPVTGNTAVLVTPIATS--IAC  512



>ref|XP_009372941.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=512

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS  HWN+A+LNL+ NVRK+  EMDE+L  +  +   EE++  ++ A++R+  WE L+
Sbjct  428  ERNSHNHWNQAVLNLSLNVRKMFVEMDEQLFLSSHAHFMEEEAKQSMAAKKRKEAWERLE  487

Query  572  VIAA-----SNISALTKPANASCLVSC  507
              A+      N + L  P   S  ++C
Sbjct  488  NAASLQPVTGNTAVLVTPIATS--IAC  512



>ref|XP_002969377.1| hypothetical protein SELMODRAFT_267276 [Selaginella moellendorffii]
 gb|EFJ29465.1| hypothetical protein SELMODRAFT_267276 [Selaginella moellendorffii]
Length=467

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N++ HWN+A+  LT NVRK+ +EMD EL   CQ K +E++  S  + E+R +TW+ L+
Sbjct  384  EMNNRNHWNQAVHGLTCNVRKMFSEMDPELFQECQRKFQEDEEKSKGIEEKREITWKRLE  443

Query  572  VIAAS  558
              AA+
Sbjct  444  AAAAT  448



>ref|XP_002970708.1| hypothetical protein SELMODRAFT_171686 [Selaginella moellendorffii]
 gb|EFJ28034.1| hypothetical protein SELMODRAFT_171686 [Selaginella moellendorffii]
Length=474

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N++ HWN+A+  LT NVRK+ +EMD EL   CQ K +E++  S  + E+R +TW+ L+
Sbjct  384  EMNNRNHWNQAVHGLTCNVRKMFSEMDPELFQECQRKFQEDEEKSKGIEEKREITWKRLE  443

Query  572  VIAAS  558
              AA+
Sbjct  444  AAAAT  448



>ref|XP_004304704.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Fragaria vesca subsp. 
vesca]
Length=522

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 53/81 (65%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL   C  K +E+++    ++ +R LTW+ L+
Sbjct  436  ERNARNHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQEDEAQEKEMSLKRELTWKRLE  495

Query  572  VIAASNISALTKPANASCLVS  510
             IAA   SA    +N + LVS
Sbjct  496  EIAAKKASA----SNEAVLVS  512



>gb|KHG13833.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=523

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN A+ +LT NVRK+ ++ D EL   C  K EE+++  N V  +R  TW+ L+
Sbjct  438  EKNARSHWNPAVQSLTLNVRKIFSDTDPELFEECLHKFEEDQAQENEVKSKRETTWKRLE  497

Query  572  VI----AASNISALTKPA----NASC  519
             I    AASN   L  P     N SC
Sbjct  498  EIAAMKAASNEPVLVSPKATTRNPSC  523



>ref|XP_002962142.1| hypothetical protein SELMODRAFT_63731, partial [Selaginella moellendorffii]
 gb|EFJ37402.1| hypothetical protein SELMODRAFT_63731, partial [Selaginella moellendorffii]
Length=430

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+NS+ HWN+ + NLT NVRK++ EMD EL   CQ + EEE++   VV ++R   W  L+
Sbjct  359  EKNSRSHWNQTVHNLTLNVRKMLVEMDPELFSECQKRFEEEEAKHKVVEDKREAKWRRLE  418



>gb|EPS71240.1| hypothetical protein M569_03516, partial [Genlisea aurea]
Length=471

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E NS+ HWN+ +LNLT NV+K+++E+D EL  AC S   EE+   +  AERR   W HL+
Sbjct  402  EANSESHWNQVVLNLTLNVKKMLSEIDGELAAACVSDCREERKRKDRAAERRTEMWAHLE  461

Query  572  VIAA  561
              A+
Sbjct  462  CAAS  465



>gb|KJB40702.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40703.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40704.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40705.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
Length=523

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN A+ +LT NVRK+ ++ D EL   C  K EE+++  N V  +R  TW+ L+
Sbjct  438  EKNARSHWNPAVQSLTLNVRKIFSDTDPELFEECLHKFEEDQAQENEVKSKREATWKRLE  497

Query  572  VI----AASNISALTKPA----NASC  519
             I    AASN   L  P     N SC
Sbjct  498  EIAAMKAASNEPVLVSPKATTRNPSC  523



>gb|KDO52089.1| hypothetical protein CISIN_1g0107852mg, partial [Citrus sinensis]
Length=119

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL   C  K +E+++    +  +R  TW+ L+
Sbjct  34   ERNARKHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQEDEAKEEEIKMKREATWKRLE  93

Query  572  VI----AASNISALTKPANAS  522
             I    AASN   L  P  A+
Sbjct  94   EIAAMKAASNEPVLISPKTAT  114



>emb|CDX87083.1| BnaC09g03980D [Brassica napus]
Length=352

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK++ EMDE+L  +C ++ +EE++    V E+R+  W  L+
Sbjct  277  EKNAENHWNQSVLNLTLNVRKMLCEMDEDLFMSCHARFQEEEAKQCSVIEKRKEKWARLE  336

Query  572  VIAASNISALT  540
              +A+++  +T
Sbjct  337  --SAASMKPVT  345



>ref|XP_004169443.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cucumis sativus]
Length=524

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS+ HWN+A+ NLTQNVRK+ ++ D EL   C  K +EE++    +  +R   W+ L+
Sbjct  439  ERNSRNHWNQAVQNLTQNVRKIFSDADPELFEECLLKFQEEETQEKDMKSKREAKWKRLE  498

Query  572  VI----AASNISALTKP  534
             I    AASN + L  P
Sbjct  499  EIAALKAASNEAVLVTP  515



>gb|KGN45729.1| hypothetical protein Csa_6G008600 [Cucumis sativus]
Length=524

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS+ HWN+A+ NLTQNVRK+ ++ D EL   C  K +EE++    +  +R   W+ L+
Sbjct  439  ERNSRNHWNQAVQNLTQNVRKIFSDADPELFEECLLKFQEEETQEKDMKSKREAKWKRLE  498

Query  572  VI----AASNISALTKP  534
             I    AASN + L  P
Sbjct  499  EIAALKAASNEAVLVTP  515



>ref|XP_004138464.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine protein phosphatase 
2A 59 kDa regulatory subunit B' eta isoform-like [Cucumis 
sativus]
Length=524

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS+ HWN+A+ NLTQNVRK+ ++ D EL   C  K +EE++    +  +R   W+ L+
Sbjct  439  ERNSRNHWNQAVQNLTQNVRKIFSDADPELFEECLLKFQEEETQEKDMKSKREAKWKRLE  498

Query  572  VI----AASNISALTKP  534
             I    AASN + L  P
Sbjct  499  EIAALKAASNEAVLVTP  515



>ref|XP_001774044.1| predicted protein [Physcomitrella patens]
 gb|EDQ61096.1| predicted protein [Physcomitrella patens]
Length=520

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+  LT NVRK+  EMD++L   CQ K  E+++ +  V E R +TW+ L+
Sbjct  412  ERNTRSHWNQAVHGLTLNVRKMFMEMDQDLFHECQRKYREDEAKAKEVEEMREITWKRLE  471

Query  572  VIAASNIS  549
                  IS
Sbjct  472  AAGNKRIS  479



>ref|XP_010543448.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform [Tarenaya hassleriana]
Length=495

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 5/76 (7%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N   HWN+A+  LT NVRK+  EMD EL   CQ + EE+K+ S  V ERR+L W+ L 
Sbjct  419  EKNVGSHWNQAVHGLTVNVRKMFMEMDAELFEQCQVEYEEKKARSKEVEERRQLAWKRLA  478

Query  572  VIAA-----SNISALT  540
              AA     +NI  +T
Sbjct  479  EAAAQREEDTNIDMVT  494



>gb|KDP30791.1| hypothetical protein JCGZ_13734 [Jatropha curcas]
Length=544

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D+EL   C  K +E++     + ERR LTW+ L+
Sbjct  449  ERNTRGHWNQAVQSLTLNVRKIFSDADQELFDECLVKFQEDEVKEQEMQERRELTWKRLE  508

Query  572  VIAAS  558
             +AAS
Sbjct  509  EVAAS  513



>ref|XP_004497127.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Cicer arietinum]
Length=489

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N + HWN+AIL LT NVRK+  EMD EL   CQ    E+++ +  + E+R LTW+ L+
Sbjct  414  ENNMKSHWNRAILGLTANVRKMFLEMDAELFEECQKNYLEKEARAAELEEKRELTWKQLE  473

Query  572  VIAASNI  552
             +AA  +
Sbjct  474  AVAAQAV  480



>gb|KCW48799.1| hypothetical protein EUGRSUZ_K02441 [Eucalyptus grandis]
Length=538

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN Q HWN+A+  LT NVRK+  EMD EL   CQS+  E+++ +  V E+R LTW+ L 
Sbjct  424  ERNIQSHWNQAVHGLTVNVRKMFLEMDVELFEECQSQYAEKEAKAREVEEQRALTWKKLA  483

Query  572  VIAA  561
             +AA
Sbjct  484  DVAA  487



>ref|XP_008445128.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Cucumis melo]
Length=515

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+A++NLT NVRK+  EMD+EL  +C +  +EE++   + A++R+  WE L+
Sbjct  430  EKNAQSHWNQAVVNLTLNVRKIFMEMDDELFLSCHAHFKEEEAKEALEAKKRKQIWEQLE  489

Query  572  VIAASNISALT  540
              AA+N+  +T
Sbjct  490  N-AAANVQPMT  499



>gb|KHN05593.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' alpha isoform [Glycine soja]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N + HWN+A+L LT NVRK+  EMD EL   CQ +  E+++ +  + E+R LTW+ L+
Sbjct  411  ENNLKSHWNRAVLGLTANVRKMFLEMDAELFEECQKQYLEKEARARELEEKRELTWKKLE  470

Query  572  VIAASNI  552
             +AA  +
Sbjct  471  AVAAQAV  477



>ref|XP_006589705.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like isoform X1 [Glycine max]
 ref|XP_006589706.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like isoform X2 [Glycine max]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N + HWN+A+L LT NVRK+  EMD EL   CQ +  E+++ +  + E+R LTW+ L+
Sbjct  411  ENNLKSHWNRAVLGLTANVRKMFLEMDAELFEECQKQYLEKEARARELEEKRELTWKKLE  470

Query  572  VIAASNI  552
             +AA  +
Sbjct  471  AVAAQAV  477



>gb|EPS62004.1| hypothetical protein M569_12788, partial [Genlisea aurea]
Length=473

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N++ HWN+A+LNLT NV+K++ EMD+EL  AC S   E+K   +  +ERR   W +L+
Sbjct  410  EANAESHWNQAVLNLTLNVKKMVAEMDDELAVACISNYREDKKRKDTESERRDQMWLNLE  469

Query  572  VIAA  561
              AA
Sbjct  470  NAAA  473



>ref|XP_010037138.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Eucalyptus grandis]
 gb|KCW48800.1| hypothetical protein EUGRSUZ_K02441 [Eucalyptus grandis]
Length=497

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN Q HWN+A+  LT NVRK+  EMD EL   CQS+  E+++ +  V E+R LTW+ L 
Sbjct  424  ERNIQSHWNQAVHGLTVNVRKMFLEMDVELFEECQSQYAEKEAKAREVEEQRALTWKKLA  483

Query  572  VIAA  561
             +AA
Sbjct  484  DVAA  487



>ref|XP_008383627.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=512

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS  HWN+A+LNL+ NVRK+  EMDE+L  +  +   EE++  +  A++R+  WE L+
Sbjct  428  ERNSHNHWNQAVLNLSLNVRKMFVEMDEQLFLSSHAHFMEEEAKQSSAAKKRKEAWERLE  487

Query  572  VIAA-----SNISALTKPANASCLVSC  507
              A+      N + L  P   S  ++C
Sbjct  488  NAASLQPVTGNTAVLVTPIATS--ITC  512



>ref|XP_002870241.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46500.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRKV+ E D+ L   C +K +E+++  N V  +R  TW+ L+
Sbjct  857  ERNTRGHWNQAVQSLTLNVRKVLAETDQILFDECLAKFQEDEANENEVVAKREATWKLLE  916

Query  572  VIAAS  558
             +AAS
Sbjct  917  DLAAS  921



>ref|XP_008441374.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis melo]
 gb|ADN34067.1| protein phosphatase 2a [Cucumis melo subsp. melo]
Length=524

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS+ HWN+A+ NLTQNVRK+ ++ D EL   C  K +EE++    +  +R   W+ L+
Sbjct  439  ERNSRNHWNQAVQNLTQNVRKIFSDADPELFDECLLKFQEEETQEKDMKSKREAKWKRLE  498

Query  572  VIAA  561
             IAA
Sbjct  499  EIAA  502



>gb|KHG10267.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
alpha-like protein [Gossypium arboreum]
Length=476

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN  +  LT NVRK+ +EMD ELV  CQ +L E+++ +  VAE+R +TW+ L+
Sbjct  412  EKNIQSHWNTEVHGLTVNVRKMFSEMDAELVNECQKQLAEKQAKAREVAEQREMTWKKLE  471

Query  572  VIAA  561
              A+
Sbjct  472  DAAS  475



>ref|XP_007027455.1| Phosphatase 2A regulatory B subunit family protein, ALPHA [Theobroma 
cacao]
 gb|EOY07957.1| Phosphatase 2A regulatory B subunit family protein, ALPHA [Theobroma 
cacao]
Length=496

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN Q HWN+A+  LT NVRK+  EMD EL   CQ +  E+++ +  V E+R +TW+ L 
Sbjct  423  ERNIQSHWNQAVHGLTVNVRKMFMEMDAELFDECQRQFAEKEARAREVEEQREMTWKKLA  482

Query  572  VIAA  561
             +AA
Sbjct  483  DVAA  486



>ref|XP_008233254.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Prunus mume]
Length=455

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+AI  LT NVR++  EMD EL   CQ +  E+++ +  + E+R LTW+ ++
Sbjct  381  EKNTQGHWNQAIHGLTANVRRMFQEMDPELFEECQEQYLEKETRAREMEEQRELTWKRIE  440

Query  572  VIAAS  558
             +AA+
Sbjct  441  AVAAT  445



>ref|NP_197933.1| protein phosphatase 2A regulatory B subunit [Arabidopsis thaliana]
 sp|Q93YV6.1|2A5I_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' iota isoform; Short=AtB' iota; Short=PP2A, 
B' subunit, iota isoform [Arabidopsis thaliana]
 gb|AAL24096.1| putative AtBgamma protein [Arabidopsis thaliana]
 gb|AAN13126.1| putative AtBgamma protein [Arabidopsis thaliana]
 gb|AED93456.1| protein phosphatase 2A regulatory B subunit [Arabidopsis thaliana]
Length=500

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++     AE+R+  W  L+
Sbjct  416  EKNAQNHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFKEDEAKQCSAAEKRKEVWARLE  475



>emb|CDY05497.1| BnaA02g31940D [Brassica napus]
Length=485

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++      E+R+ TW  L+
Sbjct  401  EKNAESHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFQEDEAEQCSAEEKRKETWARLE  460

Query  572  VIAA  561
             +A+
Sbjct  461  KVAS  464



>emb|CDY54903.1| BnaC02g48620D [Brassica napus]
Length=486

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++      E+R+ TW  L+
Sbjct  402  EKNAESHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFQEDEAEQCSAEEKRKETWARLE  461

Query  572  VIAA  561
             +A+
Sbjct  462  KVAS  465



>ref|XP_008343496.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Malus domestica]
Length=205

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ++N+Q HWN+AI  LT NV ++  EMD EL   CQ +  E+++ +  + E+R LTW+ ++
Sbjct  131  DKNTQGHWNQAIHGLTGNVXRMFQEMDTELFAKCQQQYLEKENRTRELEEQRELTWKRIE  190

Query  572  VIAAS  558
             +AA+
Sbjct  191  AVAAN  195



>ref|XP_011012347.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011012348.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=524

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL   C  K ++E+S  N +  +R  TW+ L+
Sbjct  439  ERNARQHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQKEESQENEIKSKREATWKRLE  498

Query  572  VIAASNISALTKPANASCLVSC*MIEHQRTPS  477
             IAA   +     +N   L+S  +   +RTPS
Sbjct  499  EIAAMKAT-----SNEPVLISPKIT--RRTPS  523



>ref|XP_006375537.1| hypothetical protein POPTR_0014s15520g [Populus trichocarpa]
 gb|ERP53334.1| hypothetical protein POPTR_0014s15520g [Populus trichocarpa]
Length=191

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D+EL   C  K EE++       E+R LTW+ L+
Sbjct  96   ERNTRGHWNQAVQSLTLNVRKIFSDADQELFDECLVKFEEDEVKQMETREKRELTWKRLE  155

Query  572  VIAAS  558
             +A S
Sbjct  156  DLATS  160



>ref|XP_011010241.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011010242.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011010243.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=524

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL   C  K ++E+S  N +  +R  TW+ L+
Sbjct  439  ERNARQHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQKEESQENEIKSKREATWKRLE  498

Query  572  VIAASNISALTKPANASCLVSC*MIEHQRTPS  477
             IAA   +     +N   L+S  +   +RTPS
Sbjct  499  EIAAMKAT-----SNEPVLISPKIT--RRTPS  523



>ref|XP_005649013.1| PP2A-widerborst subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE24469.1| PP2A-widerborst subunit [Coccomyxa subellipsoidea C-169]
Length=524

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN + HWN  +L LT NVRK+  +MDE L   C+ + E E++      E+RR TW+ LD
Sbjct  443  ERNEKQHWNPQVLGLTSNVRKMFRDMDEGLYEECRLRYEAEEAQKAAQEEQRRKTWQQLD  502

Query  572  VIAASNISA  546
              A   ++A
Sbjct  503  AAAHRQLTA  511



>ref|XP_010111637.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
 gb|EXC31382.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
Length=525

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL   C  K +E+++    +  +R +TW+ L+
Sbjct  440  ERNTRSHWNQAVHSLTLNVRKIFSDVDPELFEECLLKFQEDEAQEKEINAKREMTWKRLE  499

Query  572  VIAASNISALTKPANASCLVSC*MIEHQRTPS  477
             IAA   +     +N   LVS  +I   R PS
Sbjct  500  EIAAKKAA-----SNEPVLVSSKII--ARAPS  524



>ref|XP_009411828.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411829.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D ELV  C  K EE+++       +R  TW+ L+
Sbjct  436  ERNTRSHWNQAVQSLTLNVRKIFSDHDPELVAECLKKFEEDEAKDKQYIMKREATWKRLE  495

Query  572  VIAAS  558
             IAAS
Sbjct  496  EIAAS  500



>ref|XP_009411832.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=513

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D ELV  C  K EE+++       +R  TW+ L+
Sbjct  436  ERNTRSHWNQAVQSLTLNVRKIFSDHDPELVAECLKKFEEDEAKDKQYIMKREATWKRLE  495

Query  572  VIAAS  558
             IAAS
Sbjct  496  EIAAS  500



>ref|XP_009411830.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=521

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D ELV  C  K EE+++       +R  TW+ L+
Sbjct  436  ERNTRSHWNQAVQSLTLNVRKIFSDHDPELVAECLKKFEEDEAKDKQYIMKREATWKRLE  495

Query  572  VIAAS  558
             IAAS
Sbjct  496  EIAAS  500



>ref|XP_004307335.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Fragaria vesca subsp. 
vesca]
Length=432

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+ I +LT NVR++  EMD EL   CQ +  E+ + +  + E+R LTW+ ++
Sbjct  358  EKNTQGHWNQGIHDLTTNVRRIFQEMDSELFKECQEQYLEKVTRARSLEEQRELTWKKIE  417

Query  572  VIAAS  558
             +AA+
Sbjct  418  TVAAT  422



>ref|XP_002323997.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEF04130.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=530

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL   C  K ++E+S  N +  +R  TW+ L+
Sbjct  439  ERNARQHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQKEESRENEIKSKREATWKRLE  498

Query  572  VIAA----SNISALTKP  534
             IAA    SN   L  P
Sbjct  499  EIAAMKATSNEPVLISP  515



>ref|XP_011081886.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Sesamum indicum]
Length=490

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N++ HWN+A+LNLT NVRK++ EMD+ LV AC S  +EE+   ++  ++R+  WE L+
Sbjct  413  EANAENHWNQAVLNLTLNVRKMLVEMDDVLVMACISNYQEEQQRKDLEVKKRKEVWERLE  472



>gb|EYU29254.1| hypothetical protein MIMGU_mgv1a005961mg [Erythranthe guttata]
Length=463

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N+Q HWN +ILNLT NV+K++ EMDE LV AC S   EE+   +   E+R   WE L+
Sbjct  385  ELNAQNHWNHSILNLTFNVKKMLAEMDEPLVSACISNYREEQERQDSEIEKRSEIWERLE  444

Query  572  VIAASNISALT  540
               A+N+  L 
Sbjct  445  --NAANLQPLV  453



>gb|KCW80466.1| hypothetical protein EUGRSUZ_C018112, partial [Eucalyptus grandis]
Length=118

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 51/87 (59%), Gaps = 7/87 (8%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN A+LNLT +V+++ +EMDEEL  +C ++ +EE+       E+R   W+ L+
Sbjct  34   EKNTRGHWNPAVLNLTISVKRMFSEMDEELFLSCLAQSQEEEERLRQAVEKRNEAWKRLE  93

Query  572  VIA-----ASNISALTKPANASCLVSC  507
              A       NI+ L  P   S  ++C
Sbjct  94   TAASHQPVGRNIAILVSPLATS--IAC  118



>ref|XP_008812431.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Phoenix dactylifera]
Length=503

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT NVRK+  EMD EL   CQ +  E+   +  + E+R L W  L+
Sbjct  431  EKNMQGHWNQAVHGLTANVRKMFLEMDSELFEECQRQYTEKVEKAKTLEEQRELAWRRLE  490

Query  572  VIAASNI  552
             + A+N+
Sbjct  491  AVVAANL  497



>ref|XP_010935325.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Elaeis guineensis]
Length=504

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT NVRK+  EMD EL   CQ +  E+K  +  + E+R L W  L+
Sbjct  429  EKNMQGHWNQAVHGLTSNVRKMFLEMDSELFEECQRQYMEKKEKAKALEEQRELAWRRLE  488

Query  572  VIAASNISA  546
             + A+  + 
Sbjct  489  AVVAAKAAG  497



>ref|XP_002874266.1| hypothetical protein ARALYDRAFT_489409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50525.1| hypothetical protein ARALYDRAFT_489409 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++     AE+R+  W  L+
Sbjct  415  EKNAQNHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFKEDEAKLCSAAEKRKEVWARLE  474



>ref|XP_009786927.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nicotiana sylvestris]
Length=551

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+A+ +LT NVRK+ ++ D+ L   C  K +E +  +  + ERR LTW+ L+
Sbjct  456  EKNTNGHWNQAVQSLTSNVRKIFSDADQALFDECLEKFQEAEIKNKEMQERRELTWKRLE  515

Query  572  VIAASNISALTKPANASCLVS  510
             +AASN       +N + LVS
Sbjct  516  DVAASNFV-----SNEAVLVS  531



>ref|XP_010907766.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Elaeis guineensis]
Length=515

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D EL   C  K EE++S    +  RR   W+ L+
Sbjct  437  ERNTKSHWNQAVQSLTLNVRKIFSDHDPELFTECLKKFEEDESKKEEIKSRREAAWKRLE  496

Query  572  VIAASNISALTKPAN  528
             IA S  ++  +  N
Sbjct  497  EIATSKAASPQRSMN  511



>ref|XP_010910784.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Elaeis guineensis]
Length=129

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+  + D+EL   C  + +E+++    + ++R LTW+ L+
Sbjct  35   ERNTREHWNQAVQSLTLNVRKLFLDADQELFEECLIRFQEDEAKEKELQQKRELTWKRLE  94

Query  572  VIAAS  558
             +AAS
Sbjct  95   DVAAS  99



>ref|XP_004292963.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Fragaria vesca subsp. vesca]
Length=525

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+A+LNLT NVRK+  EMD++L  +  ++  EE++  +  A++R+  WE L+
Sbjct  441  EKNAHNHWNQAVLNLTLNVRKLFVEMDDQLFLSIHAQYMEEEARQSSEAKKRKEAWERLE  500

Query  572  VIAA-----SNISALTKP  534
              A+      NI+ L  P
Sbjct  501  NAASLQPVTGNIAVLVTP  518



>ref|XP_007049146.1| Phosphatase 2A regulatory B subunit family protein, GAMMA [Theobroma 
cacao]
 gb|EOX93303.1| Phosphatase 2A regulatory B subunit family protein, GAMMA [Theobroma 
cacao]
Length=545

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D+ L   C ++ +E+++    + ++R LTW+ L+
Sbjct  450  ERNTRGHWNQAVQSLTLNVRKIFSDADQSLFDECLARFQEDEAKEKEMLKKRELTWKRLE  509

Query  572  VIAASNISALTKPANASCLVS  510
             +AAS     T  +N + LVS
Sbjct  510  DVAAS-----TAVSNEAVLVS  525



>ref|XP_010907764.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Elaeis guineensis]
 ref|XP_010907765.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Elaeis guineensis]
Length=522

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 6/88 (7%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D EL   C  K EE++S    +  RR   W+ L+
Sbjct  437  ERNTKSHWNQAVQSLTLNVRKIFSDHDPELFTECLKKFEEDESKKEEIKSRREAAWKRLE  496

Query  572  VIAASNISALTKPANASCLVSC*MIEHQ  489
             IA S  +     +N + L+S  ++ HQ
Sbjct  497  EIATSKAA-----SNEAVLISH-VMPHQ  518



>gb|KDO40519.1| hypothetical protein CISIN_1g011191mg [Citrus sinensis]
Length=491

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT NVRK+  +MD EL   CQ++ EE++S +  V E+R LTW+ L 
Sbjct  418  EKNIQSHWNQAVHGLTVNVRKMFLDMDAELFEECQNQYEEKESRAKEVEEQRELTWKRLA  477

Query  572  VIA  564
             +A
Sbjct  478  DVA  480



>ref|XP_010486565.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform [Camelina sativa]
Length=491

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT N++K+  EMD EL   CQ + EE+++ S  V E+R+ TW+ L 
Sbjct  414  EKNIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQAKSKQVEEQRQYTWKRLA  473

Query  572  VIAA  561
              AA
Sbjct  474  EAAA  477



>ref|XP_006491669.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Citrus sinensis]
Length=491

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT NVRK+  +MD EL   CQ++ EE++S +  V E+R LTW+ L 
Sbjct  418  EKNIQSHWNQAVHGLTVNVRKMFLDMDAELFEECQNQYEEKESRAKEVEEQRELTWKRLA  477

Query  572  VIA  564
             +A
Sbjct  478  DVA  480



>ref|XP_002976536.1| hypothetical protein SELMODRAFT_232803 [Selaginella moellendorffii]
 gb|EFJ22205.1| hypothetical protein SELMODRAFT_232803 [Selaginella moellendorffii]
Length=442

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+ +  LT NVRK+  EMD++L   CQ K  EE+  S  + E+R   W+ L+
Sbjct  353  ERNTRNHWNQTVHGLTVNVRKMFLEMDKDLFDECQRKYLEEEEKSKGLEEKRENNWKRLE  412

Query  572  VIAASNISA  546
              AAS I A
Sbjct  413  AAAASRIEA  421



>ref|XP_009620794.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nicotiana tomentosiformis]
Length=554

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+  HWN+A+ +LT NVRK+ ++ D+ L   C  + +E++  +    ERR LTW+ L+
Sbjct  459  EKNTHGHWNQAVQSLTSNVRKIFSDADQALFDECLERFQEDEIKNKETQERRELTWKRLE  518

Query  572  VIAASNISALTKPANASCLVS  510
             +AASN       +N + LVS
Sbjct  519  DVAASNFV-----SNEAVLVS  534



>ref|XP_007201959.1| hypothetical protein PRUPE_ppa004682mg [Prunus persica]
 gb|EMJ03158.1| hypothetical protein PRUPE_ppa004682mg [Prunus persica]
Length=496

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN Q HWN+A+  LT NVRK+  EMD +L   CQ +L E ++ S  V E+R LTW+ L 
Sbjct  423  ERNIQSHWNQAVHGLTVNVRKMFLEMDADLFEECQRQLAEREARSREVEEQRELTWKKLA  482

Query  572  VIAA  561
              AA
Sbjct  483  DAAA  486



>ref|XP_009137092.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Brassica rapa]
Length=935

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN   HWN+ + NLT NVRKV+ E D+ L   C +K +E+++    VA +R  TW+ L+
Sbjct  843  ERNMCSHWNQTVKNLTLNVRKVLAETDQALFDECLAKFQEDEASKAEVAAKREATWKLLE  902

Query  572  VIAAS  558
             +AAS
Sbjct  903  DLAAS  907



>ref|XP_008241387.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform [Prunus mume]
Length=496

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN Q HWN+A+  LT NVRK+  EMD +L   CQ +L E ++ S  V E+R LTW+ L 
Sbjct  423  ERNIQSHWNQAVHGLTVNVRKMFLEMDADLFEECQRQLAEREARSREVEEQRELTWKKLA  482

Query  572  VIAA  561
              AA
Sbjct  483  DAAA  486



>emb|CDP15283.1| unnamed protein product [Coffea canephora]
Length=170

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT NVRK+  EMD EL   CQ +  E+++ +  + E+R+LTW+ L 
Sbjct  104  EKNIQSHWNQAVHGLTVNVRKMFLEMDVELFEECQRQYAEKEARAKELEEQRQLTWQRLA  163

Query  572  VIAASN  555
              AA  
Sbjct  164  AAAAQG  169



>gb|KJB46507.1| hypothetical protein B456_007G372900 [Gossypium raimondii]
Length=442

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN  +  LT NVRK+  EMD ELV  CQ +L E+++ +  VAE+R +TW+ L+
Sbjct  378  EKNIQSHWNTEVHGLTVNVRKMFLEMDAELVDECQKQLAEKQAKAREVAEQREMTWKKLE  437



>ref|XP_006368169.1| hypothetical protein POPTR_0001s00210g [Populus trichocarpa]
 gb|ERP64738.1| hypothetical protein POPTR_0001s00210g [Populus trichocarpa]
Length=211

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N   HWN+A+  LT NVRK+  EMD EL   CQ +  E+KS +  V E+R LTW+ L 
Sbjct  137  EKNIHGHWNQAVHGLTVNVRKMFLEMDTELFEECQRQHAEKKSRARDVEEQRELTWKRLA  196

Query  572  VIAA  561
             +AA
Sbjct  197  DVAA  200



>gb|KJB46506.1| hypothetical protein B456_007G372900 [Gossypium raimondii]
Length=476

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN  +  LT NVRK+  EMD ELV  CQ +L E+++ +  VAE+R +TW+ L+
Sbjct  412  EKNIQSHWNTEVHGLTVNVRKMFLEMDAELVDECQKQLAEKQAKAREVAEQREMTWKKLE  471



>ref|XP_008799955.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like isoform X2 [Phoenix dactylifera]
Length=199

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D EL   C  K EE+++    +  +R  TW  L+
Sbjct  114  ERNAKTHWNQAVQSLTLNVRKIFSDHDPELFAECLKKFEEDEAKEQEIKSKRESTWRRLE  173

Query  572  VIAASNISA  546
             IA S  ++
Sbjct  174  EIATSKAAS  182



>ref|NP_187599.1| serine/threonine protein phosphatase 2A regulatory subunit B 
prime beta isoform [Arabidopsis thaliana]
 sp|O04376.1|2A5B_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' beta isoform; Short=AtB' beta; Short=PP2A, 
B' subunit, beta isoform [Arabidopsis thaliana]
 gb|AAF23248.1|AC015985_6 B' regulatory subunit of PP2A (AtB'beta) [Arabidopsis thaliana]
 gb|AAB58901.1| B' regulatory subunit of PP2A [Arabidopsis thaliana]
 gb|AAL60047.1| putative B' regulatory subunit of PP2A AtB'beta [Arabidopsis 
thaliana]
 gb|AAM44900.1| putative B' regulatory subunit of PP2A AtB'beta [Arabidopsis 
thaliana]
 gb|AEE74825.1| serine/threonine protein phosphatase 2A regulatory subunit B 
prime beta isoform [Arabidopsis thaliana]
Length=499

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT N++K+  EMD EL   CQ + EE+++ S  V E+R+ TW+ L 
Sbjct  421  EKNIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQAKSKEVEEQRQYTWKRLA  480

Query  572  VIAA  561
              AA
Sbjct  481  EAAA  484



>ref|XP_002973366.1| hypothetical protein SELMODRAFT_99313 [Selaginella moellendorffii]
 gb|EFJ25740.1| hypothetical protein SELMODRAFT_99313 [Selaginella moellendorffii]
Length=468

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+ +  LT NVRK+  EMD++L   CQ K  EE+  S  + E+R   W+ L+
Sbjct  379  ERNTRNHWNQTVHGLTVNVRKMFLEMDKDLFDECQRKYLEEEEKSKGLEEKRENNWKRLE  438

Query  572  VIAASNISA  546
              AAS + A
Sbjct  439  AAAASRVEA  447



>ref|XP_004243528.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Solanum lycopersicum]
Length=545

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ +LT NVRK+ ++ D+ L   C  K +E++       E+R LTW+ L+
Sbjct  457  EKNTRGHWNQAVQSLTLNVRKIFSDADQALFDECLEKFKEDERKDKETQEKRELTWKRLE  516

Query  572  VIAASNI  552
             IAASN 
Sbjct  517  DIAASNF  523



>ref|XP_010696300.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Beta vulgaris subsp. vulgaris]
Length=496

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT NVRK+  EMD EL   CQ + E++ + +  V E+R+LTW+ L 
Sbjct  427  EKNIQSHWNQAVHGLTVNVRKMFLEMDVELFEECQRQYEDKVARAKEVEEQRQLTWKRLA  486

Query  572  VIAASNI  552
             +A  ++
Sbjct  487  EVAGDDM  493



>ref|XP_006297503.1| hypothetical protein CARUB_v10013525mg [Capsella rubella]
 gb|EOA30401.1| hypothetical protein CARUB_v10013525mg [Capsella rubella]
Length=497

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT N++K+  EMD EL   CQ + EE+++ S  V E+R+ TW+ L 
Sbjct  420  EKNIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQAKSKEVEEQRQYTWKRLA  479

Query  572  VIA  564
             +A
Sbjct  480  EVA  482



>ref|XP_008813321.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' alpha isoform-like [Phoenix dactylifera]
Length=509

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT NVRK+  EMD EL   CQ +  E+K  +  + E+R L W  L+
Sbjct  434  EKNMQGHWNQAVHGLTANVRKMFLEMDNELFEECQRQYMEKKEKAKALEEQRELAWRRLE  493

Query  572  VIAASNISA  546
             + A+  + 
Sbjct  494  AVVAAKAAG  502



>ref|XP_006394804.1| hypothetical protein EUTSA_v10004060mg [Eutrema salsugineum]
 gb|ESQ32090.1| hypothetical protein EUTSA_v10004060mg [Eutrema salsugineum]
Length=500

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++     AE+R+  W  L+
Sbjct  416  EKNAENHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFQEDEAKQCSAAEKRKEIWAKLE  475



>gb|KJB16761.1| hypothetical protein B456_002G246300 [Gossypium raimondii]
Length=488

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN Q HWN+AI  LT NV K+  EMD EL   C+++ EE+K+ +  V E+R + WE L 
Sbjct  415  ERNIQHHWNEAIHGLTANVLKMFLEMDAELFDECETRFEEKKAKARDVEEQREMIWEKLA  474

Query  572  VIAA  561
              AA
Sbjct  475  DAAA  478



>ref|XP_001768015.1| predicted protein [Physcomitrella patens]
 gb|EDQ67290.1| predicted protein [Physcomitrella patens]
Length=466

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+  LT NVRK+  EMD+EL   CQ K +E+++ +  + E R  TW+ L+
Sbjct  358  ERNTRSHWNQAVHGLTLNVRKMFLEMDQELFQECQRKYQEDEAKAKGMEEVREQTWKRLE  417



>ref|XP_006357949.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Solanum tuberosum]
Length=545

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 5/81 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ +LT NVRK+ ++ D+ L   C  K +E++       ERR LTW+ L+
Sbjct  457  EKNTRGHWNEAVQSLTLNVRKIFSDADQALFDECLEKFKEDEIKDKEAQERRELTWKRLE  516

Query  572  VIAASNISALTKPANASCLVS  510
             +AASN       +N + LVS
Sbjct  517  DLAASNFV-----SNEAVLVS  532



>ref|XP_009368942.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' alpha isoform-like [Pyrus x bretschneideri]
 ref|XP_009368983.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' alpha isoform-like [Pyrus x bretschneideri]
Length=454

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+AI  LT NVR++  EMD EL   CQ +  E+++ +    E+R LTW+ ++
Sbjct  381  EKNTQGHWNQAIHGLTGNVRRMFQEMDAELFEECQKQYFEKETRTREQEEQRELTWKRIE  440

Query  572  VIAA  561
             +AA
Sbjct  441  AVAA  444



>ref|XP_011086721.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=509

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ +LT NVRK+  ++D +L  +CQ K + +++  N V ERR   W+ L+
Sbjct  434  EKNARHHWNQAVHSLTLNVRKIFYDLDPDLFKSCQIKFQNDEAKENEVKERREAIWKRLE  493

Query  572  VIAA  561
             +AA
Sbjct  494  EVAA  497



>ref|XP_010541630.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Tarenaya hassleriana]
 ref|XP_010541631.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Tarenaya hassleriana]
Length=504

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N+Q HWN+++ NLT NVRK+  EMDE L  +C +  +EE++     AE+R   W  L+
Sbjct  420  EKNAQNHWNQSVQNLTLNVRKMFCEMDEALFLSCHASFKEEEAKLRSAAEKREEMWTKLE  479

Query  572  VIAASNISALTKPANASCLVS  510
               A+++  +T   N + LV+
Sbjct  480  --RAASVKPIT--GNTAVLVT  496



>ref|XP_009409882.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' alpha isoform-like [Musa acuminata subsp. 
malaccensis]
Length=489

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+AI  LT NVRK+  +MD EL   CQ + EE+++ +  V E+R L W  L+
Sbjct  414  EKNMQAHWNQAIHGLTANVRKMFLDMDSELFEECQRQYEEKEAKAKSVEEQRELAWRRLE  473

Query  572  VI  567
             +
Sbjct  474  AV  475



>ref|XP_003588682.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES58933.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=494

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ++N + HWN A++NLT N+RK+  EMDE+L  +C +  +E++++    AE+R+  W+ L+
Sbjct  414  DKNIKSHWNPAVVNLTHNIRKMFLEMDEKLFISCHTNFKEDEAILISEAEKRKEAWKQLE  473

Query  572  VIAA-----SNISALTKP  534
              A+      N + L  P
Sbjct  474  QAASLKPVIGNTAVLVSP  491



>ref|XP_001766428.1| predicted protein [Physcomitrella patens]
 gb|EDQ68756.1| predicted protein [Physcomitrella patens]
Length=458

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+  LT NVRK+  EMD+EL   CQ K  E+++ +  V E R  TW+ L+
Sbjct  358  ERNTRSHWNQAVHGLTLNVRKMFLEMDQELFIECQRKYLEDEAKAQGVEEMRETTWKRLE  417

Query  572  VIA  564
               
Sbjct  418  AYG  420



>ref|XP_010243212.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform [Nelumbo nucifera]
Length=511

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT+NVR++  EMD+EL   CQ +  E+++ +  + E+R LTW+ L+
Sbjct  437  EKNIQSHWNEAVHGLTENVRRMFLEMDKELYEQCQRQYLEKEANAKELEEQRELTWKRLE  496

Query  572  VIAA  561
             +AA
Sbjct  497  AVAA  500



>ref|XP_008379151.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=515

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 52/81 (64%), Gaps = 5/81 (6%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ +LT NVRK+ +++D EL   C  K  E+++   V +E+R  TW+ L+
Sbjct  430  EKNARNHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFXEDEAQETVNSEKRHDTWKRLE  489

Query  572  VIAASNISALTKPANASCLVS  510
             +AA N +     +N + LVS
Sbjct  490  ELAAKNAT-----SNEAVLVS  505



>emb|CDY07942.1| BnaC03g35810D [Brassica napus]
Length=491

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N Q HWN+A+  LT N++K+  EMD EL   CQ + EE+++ S  V E+R L+W+ L 
Sbjct  412  EKNIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQARSKEVEEQRLLSWKRLA  471

Query  572  VIAA  561
              AA
Sbjct  472  EAAA  475



>ref|XP_010250854.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250855.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250856.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250857.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
Length=525

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ +LT NVRK+ +++D EL   C  K +E++S    +  +R  TW+ L+
Sbjct  440  EKNARNHWNQAVQSLTLNVRKIFSDLDPELFDECLLKFQEDESKEKDITAKREATWKRLE  499

Query  572  VIAAS  558
             IAAS
Sbjct  500  EIAAS  504



>emb|CAB10320.1| phosphatase like protein [Arabidopsis thaliana]
 emb|CAB78583.1| phosphatase like protein [Arabidopsis thaliana]
Length=969

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRKV+ E D+ L   C +K +E+++    V  +R  TW+ L+
Sbjct  878  ERNTRGHWNQAVQSLTLNVRKVMAETDQILFDECLAKFQEDEANETEVVAKREATWKLLE  937

Query  572  VIAAS  558
             +AAS
Sbjct  938  ELAAS  942



>gb|KDP46344.1| hypothetical protein JCGZ_10184 [Jatropha curcas]
Length=522

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERNS+ HWN+A+ +LT NVRK+ +++D EL   C  K +E+++    +  +R  TW+ L+
Sbjct  437  ERNSRQHWNQAVQSLTLNVRKIFSDVDPELFEDCLLKFQEDETQEKEIKSKREATWKRLE  496

Query  572  VI----AASNISALTKP  534
             I    AASN   L  P
Sbjct  497  EIAAMKAASNEPVLVSP  513



>ref|XP_010932304.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Elaeis guineensis]
Length=517

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ ++ D EL   C  K EE+++    +  +R  TW+ L+
Sbjct  432  ERNAKSHWNQAVQSLTLNVRKIFSDHDPELFAECLKKFEEDEAKEKEIKSKREATWKRLE  491

Query  572  VIAAS  558
             IA S
Sbjct  492  EIATS  496



>ref|XP_010464647.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Camelina sativa]
Length=493

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHL  576
            E+N Q HWN+A+  LT N++K+  EMD EL   CQ + EE+++ S  V E+R+ TW+ L
Sbjct  416  EKNIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQAKSKQVDEQRQYTWKRL  474



>ref|XP_007031732.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 ref|XP_007031733.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY02658.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY02659.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
Length=525

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ +LT NVRK+ ++ D EL   C  K +E+++  N V  +R  TW+ L+
Sbjct  440  EKNARNHWNQAVQSLTLNVRKIFSDSDPELFEECLQKFQEDEARENEVKSKREATWKRLE  499

Query  572  VI----AASNISALTKP  534
             I    AASN   L  P
Sbjct  500  EIAAMKAASNEPVLVSP  516



>ref|XP_006469972.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Citrus sinensis]
Length=501

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL   C  K +E+++    +  +R  TW+ L+
Sbjct  416  ERNARKHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQEDEAKEEEIKMKREATWKRLE  475

Query  572  VI----AASNISALTKPANAS  522
             I    AASN   L  P  A+
Sbjct  476  EIAAMKAASNEPVLISPKTAT  496



>ref|XP_006357177.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Solanum tuberosum]
Length=524

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 10/94 (11%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ +LT NVRK+ +++D EL   C  K EE+++       +R +TW+ L+
Sbjct  439  EKNARGHWNQAVQSLTLNVRKIFSDVDPELFEECLRKFEEDQAHEEENKTKREMTWKRLE  498

Query  572  VIAASNISALTKPANASCLVSC*MIEHQRTPSVS  471
             IAA   +     +N   LVS     H+ TP+ S
Sbjct  499  EIAAMKTA-----SNEPVLVS-----HRITPNSS  522



>ref|XP_006447169.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006447170.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006469971.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Citrus sinensis]
 gb|ESR60409.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 gb|ESR60410.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
Length=524

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+ +LT NVRK+ +++D EL   C  K +E+++    +  +R  TW+ L+
Sbjct  439  ERNARKHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQEDEAKEEEIKMKREATWKRLE  498

Query  572  VI----AASNISALTKPANAS  522
             I    AASN   L  P  A+
Sbjct  499  EIAAMKAASNEPVLISPKTAT  519



>ref|XP_010478286.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Camelina sativa]
Length=497

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHL  576
            E+N Q HWN+A+  LT N++K+  EMD EL   CQ + EE+++ S  V E+R+ TW+ L
Sbjct  420  EKNIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQAKSKQVEEQRQYTWKRL  478



>ref|XP_009377048.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform [Pyrus x bretschneideri]
Length=497

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N Q HWN+A+  LT NVRK+ +EMD EL   CQ +L E+++ +  V E+R LTW+ L 
Sbjct  424  EMNIQNHWNQAVHGLTVNVRKMFSEMDAELFEECQRQLAEKEARAREVVEQRELTWKKLA  483

Query  572  VIAA  561
              AA
Sbjct  484  DAAA  487



>ref|XP_001767940.1| predicted protein [Physcomitrella patens]
 gb|EDQ67215.1| predicted protein [Physcomitrella patens]
Length=433

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            ERN++ HWN+A+  LT NVRK+  EMD+EL   CQ K +E+++ +  + E R  TW+ L+
Sbjct  358  ERNTRSHWNQAVHGLTLNVRKMFLEMDQELFQECQRKYQEDEAKAKGMEEVREQTWKRLE  417

Query  572  VIAASNISALT  540
                 + ++ T
Sbjct  418  AAGRQSTTSST  428



>ref|XP_008387532.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Malus domestica]
Length=497

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E N Q HWN+A+  LT NVRK+ +EMD EL   CQ +L E+++ +  V E+R LTW+ L 
Sbjct  424  EMNIQNHWNQAVHGLTVNVRKMFSEMDAELFEDCQRQLAEKEASAREVVEQRELTWKKLA  483

Query  572  VIAA  561
              AA
Sbjct  484  DAAA  487



>ref|XP_002323499.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEF05260.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=493

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N   HWN+A+  LT NVRK+  EMD EL   CQ +  E+KS +  V E+R LTW+ L 
Sbjct  419  EKNIHGHWNQAVHGLTVNVRKMFLEMDTELFEECQRQHAEKKSRARDVEEQRELTWKRLA  478

Query  572  VIAA  561
             +AA
Sbjct  479  DVAA  482



>ref|XP_009412705.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N++ HWN+A+ +LT NVRK+ T+ D +LV  C  K EE+++    +  +   TW+ L+
Sbjct  412  EKNTKSHWNQAVQSLTLNVRKIFTDHDPDLVSECLKKFEEDEAKDKEIRSKGEATWKRLE  471

Query  572  VIAAS  558
             IAAS
Sbjct  472  EIAAS  476



>ref|XP_011006622.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' beta isoform-like [Populus euphratica]
Length=492

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  752  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD  573
            E+N   HWN+A+  LT NVRK+  EMD EL   CQ +  E+KS +  V E+R LTW+ L 
Sbjct  419  EKNIHGHWNQAVHGLTVNVRKMFLEMDTELFEECQRQHAEKKSRARDVEEQRELTWKRLA  478

Query  572  VIAA  561
             +AA
Sbjct  479  DVAA  482



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260