BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002J16

Length=689
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089810.1|  PREDICTED: U-box domain-containing protein 13      236   2e-69   Sesamum indicum [beniseed]
gb|EYU36264.1|  hypothetical protein MIMGU_mgv1a002554mg                235   4e-69   Erythranthe guttata [common monkey flower]
ref|XP_009774572.1|  PREDICTED: U-box domain-containing protein 1...    228   2e-67   Nicotiana sylvestris
emb|CDP09042.1|  unnamed protein product                                229   4e-67   Coffea canephora [robusta coffee]
gb|KJB55896.1|  hypothetical protein B456_009G100000                    225   5e-67   Gossypium raimondii
ref|XP_009629379.1|  PREDICTED: U-box domain-containing protein 1...    229   1e-66   Nicotiana tomentosiformis
ref|XP_009774522.1|  PREDICTED: U-box domain-containing protein 1...    229   1e-66   Nicotiana sylvestris
ref|XP_009599897.1|  PREDICTED: U-box domain-containing protein 1...    228   2e-66   Nicotiana tomentosiformis
gb|KJB55894.1|  hypothetical protein B456_009G100000                    225   4e-66   Gossypium raimondii
ref|XP_010106453.1|  U-box domain-containing protein 13                 227   4e-66   Morus notabilis
ref|XP_007204993.1|  hypothetical protein PRUPE_ppa003509mg             225   5e-66   
ref|XP_010322360.1|  PREDICTED: U-box domain-containing protein 1...    225   6e-66   Solanum lycopersicum
ref|XP_002283992.1|  PREDICTED: U-box domain-containing protein 13      226   9e-66   Vitis vinifera
ref|XP_009777581.1|  PREDICTED: U-box domain-containing protein 1...    226   1e-65   Nicotiana sylvestris
gb|KHG14011.1|  U-box domain-containing 13 -like protein                226   1e-65   Gossypium arboreum [tree cotton]
ref|XP_008223401.1|  PREDICTED: U-box domain-containing protein 13      226   1e-65   Prunus mume [ume]
ref|XP_004241233.1|  PREDICTED: U-box domain-containing protein 1...    225   2e-65   Solanum lycopersicum
gb|KJB55893.1|  hypothetical protein B456_009G100000                    225   2e-65   Gossypium raimondii
ref|XP_006350763.1|  PREDICTED: U-box domain-containing protein 1...    223   3e-65   Solanum tuberosum [potatoes]
ref|XP_010253199.1|  PREDICTED: U-box domain-containing protein 1...    224   3e-65   Nelumbo nucifera [Indian lotus]
gb|EPS68981.1|  hypothetical protein M569_05787                         224   4e-65   Genlisea aurea
ref|XP_006348996.1|  PREDICTED: U-box domain-containing protein 1...    224   8e-65   Solanum tuberosum [potatoes]
gb|KJB08865.1|  hypothetical protein B456_001G109500                    223   1e-64   Gossypium raimondii
ref|XP_006350762.1|  PREDICTED: U-box domain-containing protein 1...    223   1e-64   Solanum tuberosum [potatoes]
ref|XP_007016448.1|  Plant U-box 13 isoform 2                           223   2e-64   
ref|XP_011042684.1|  PREDICTED: U-box domain-containing protein 1...    223   2e-64   Populus euphratica
ref|XP_006424806.1|  hypothetical protein CICLE_v10027966mg             221   2e-64   
ref|XP_007016447.1|  U-box domain-containing protein 13 isoform 1       223   3e-64   
gb|KDP44223.1|  hypothetical protein JCGZ_05690                         222   3e-64   Jatropha curcas
ref|XP_003539679.1|  PREDICTED: U-box domain-containing protein 1...    221   5e-64   Glycine max [soybeans]
ref|XP_004250960.1|  PREDICTED: U-box domain-containing protein 13      221   5e-64   Solanum lycopersicum
ref|XP_008466866.1|  PREDICTED: U-box domain-containing protein 1...    218   5e-64   Cucumis melo [Oriental melon]
ref|XP_006424807.1|  hypothetical protein CICLE_v10027966mg             221   5e-64   Citrus clementina [clementine]
ref|XP_002534105.1|  Spotted leaf protein, putative                     221   6e-64   Ricinus communis
gb|KHN32120.1|  U-box domain-containing protein 13                      221   6e-64   Glycine soja [wild soybean]
gb|KHG05758.1|  U-box domain-containing 13 -like protein                221   9e-64   Gossypium arboreum [tree cotton]
ref|XP_003537996.1|  PREDICTED: U-box domain-containing protein 1...    220   1e-63   Glycine max [soybeans]
ref|XP_002298363.1|  armadillo/beta-catenin repeat family protein       220   2e-63   
ref|XP_011000261.1|  PREDICTED: U-box domain-containing protein 1...    220   2e-63   Populus euphratica
ref|XP_007132072.1|  hypothetical protein PHAVU_011G064700g             220   2e-63   Phaseolus vulgaris [French bean]
ref|XP_004505870.1|  PREDICTED: U-box domain-containing protein 1...    220   2e-63   Cicer arietinum [garbanzo]
ref|XP_002313440.1|  armadillo/beta-catenin repeat family protein       219   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010426083.1|  PREDICTED: U-box domain-containing protein 13      218   9e-63   Camelina sativa [gold-of-pleasure]
gb|KEH30143.1|  armadillo/beta-catenin repeat protein                   218   1e-62   Medicago truncatula
ref|XP_010503261.1|  PREDICTED: U-box domain-containing protein 1...    216   3e-62   Camelina sativa [gold-of-pleasure]
gb|KJB20104.1|  hypothetical protein B456_003G133100                    214   3e-62   Gossypium raimondii
ref|XP_008784531.1|  PREDICTED: protein spotted leaf 11-like            217   4e-62   
ref|XP_009353692.1|  PREDICTED: U-box domain-containing protein 1...    214   5e-62   
ref|XP_008385130.1|  PREDICTED: U-box domain-containing protein 1...    216   7e-62   
gb|KFK33987.1|  hypothetical protein AALP_AA5G087000                    215   9e-62   Arabis alpina [alpine rockcress]
ref|XP_002877490.1|  armadillo/beta-catenin repeat family protein       215   1e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_006290265.1|  hypothetical protein CARUB_v10016804mg             215   1e-61   Capsella rubella
ref|NP_190235.1|  U-box domain-containing protein 13                    215   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009353694.1|  PREDICTED: U-box domain-containing protein 1...    215   1e-61   Pyrus x bretschneideri [bai li]
gb|KJB20105.1|  hypothetical protein B456_003G133100                    214   2e-61   Gossypium raimondii
ref|XP_006418891.1|  hypothetical protein EUTSA_v10002430mg             214   2e-61   Eutrema salsugineum [saltwater cress]
ref|XP_008357448.1|  PREDICTED: U-box domain-containing protein 1...    214   2e-61   
ref|XP_004294506.1|  PREDICTED: U-box domain-containing protein 13      214   3e-61   Fragaria vesca subsp. vesca
ref|XP_010535503.1|  PREDICTED: U-box domain-containing protein 13      213   5e-61   Tarenaya hassleriana [spider flower]
gb|KHG02811.1|  U-box domain-containing 13 -like protein                213   9e-61   Gossypium arboreum [tree cotton]
ref|XP_010920613.1|  PREDICTED: protein spotted leaf 11-like            213   1e-60   Elaeis guineensis
ref|XP_009150335.1|  PREDICTED: U-box domain-containing protein 13      212   1e-60   Brassica rapa
emb|CDX68379.1|  BnaC01g24570D                                          212   1e-60   
ref|XP_010033135.1|  PREDICTED: U-box domain-containing protein 1...    207   2e-59   Eucalyptus grandis [rose gum]
ref|XP_009343828.1|  PREDICTED: U-box domain-containing protein 1...    209   3e-59   Pyrus x bretschneideri [bai li]
emb|CDX99112.1|  BnaA06g18030D                                          207   7e-59   
ref|XP_010033134.1|  PREDICTED: U-box domain-containing protein 1...    207   7e-59   Eucalyptus grandis [rose gum]
ref|XP_009149975.1|  PREDICTED: U-box domain-containing protein 1...    207   8e-59   Brassica rapa
ref|XP_010521829.1|  PREDICTED: U-box domain-containing protein 1...    201   7e-58   
emb|CDX86080.1|  BnaC03g55950D                                          204   9e-58   
ref|XP_002881013.1|  armadillo/beta-catenin repeat family protein       204   1e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_004150186.1|  PREDICTED: U-box domain-containing protein 1...    203   3e-57   Cucumis sativus [cucumbers]
ref|XP_004167730.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    203   3e-57   
ref|XP_010521828.1|  PREDICTED: U-box domain-containing protein 1...    202   6e-57   Tarenaya hassleriana [spider flower]
emb|CDY31736.1|  BnaA04g16720D                                          202   7e-57   Brassica napus [oilseed rape]
sp|Q9ZV31.1|PUB12_ARATH  RecName: Full=U-box domain-containing pr...    202   7e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59543.1|  unknown protein                                         202   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357382.1|  PREDICTED: U-box domain-containing protein 1...    194   1e-56   Malus domestica [apple tree]
ref|XP_008357389.1|  PREDICTED: U-box domain-containing protein 1...    194   1e-56   Malus domestica [apple tree]
ref|XP_009140947.1|  PREDICTED: U-box domain-containing protein 12      201   1e-56   Brassica rapa
ref|XP_010685786.1|  PREDICTED: U-box domain-containing protein 13      201   3e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK26672.1|  hypothetical protein AALP_AA8G277900                    199   3e-56   Arabis alpina [alpine rockcress]
ref|XP_008802759.1|  PREDICTED: protein spotted leaf 11-like            200   3e-56   Phoenix dactylifera
ref|XP_009380658.1|  PREDICTED: protein spotted leaf 11-like            200   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26673.1|  hypothetical protein AALP_AA8G277900                    199   5e-56   Arabis alpina [alpine rockcress]
ref|NP_565676.4|  U-box E3 ubiquitin ligase                             202   6e-56   
ref|XP_006409917.1|  hypothetical protein EUTSA_v10016364mg             197   7e-56   Eutrema salsugineum [saltwater cress]
ref|XP_010252136.1|  PREDICTED: U-box domain-containing protein 1...    196   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_006409918.1|  hypothetical protein EUTSA_v10016364mg             198   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010470044.1|  PREDICTED: U-box domain-containing protein 1...    198   2e-55   Camelina sativa [gold-of-pleasure]
emb|CDX77213.1|  BnaC04g40080D                                          198   2e-55   
ref|XP_010252135.1|  PREDICTED: U-box domain-containing protein 1...    197   4e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010414478.1|  PREDICTED: U-box domain-containing protein 1...    198   8e-55   
gb|KCW85583.1|  hypothetical protein EUGRSUZ_B02378                     196   9e-55   Eucalyptus grandis [rose gum]
ref|XP_009341425.1|  PREDICTED: U-box domain-containing protein 1...    188   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_009399873.1|  PREDICTED: protein spotted leaf 11-like            195   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010510574.1|  PREDICTED: U-box domain-containing protein 12      194   4e-54   Camelina sativa [gold-of-pleasure]
tpg|DAA44667.1|  TPA: putative ARM repeat-containing protein cont...    195   5e-54   
ref|XP_006293619.1|  hypothetical protein CARUB_v10022571mg             196   6e-54   
ref|XP_008647602.1|  PREDICTED: uncharacterized protein LOC100502...    194   1e-53   
ref|XP_009343842.1|  PREDICTED: U-box domain-containing protein 1...    186   1e-53   Pyrus x bretschneideri [bai li]
dbj|BAJ94942.1|  predicted protein                                      192   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004984736.1|  PREDICTED: protein spotted leaf 11-like isof...    191   2e-53   Setaria italica
gb|EMT15169.1|  Protein spotted leaf 11                                 192   3e-53   
ref|XP_010922355.1|  PREDICTED: protein spotted leaf 11-like            192   3e-53   Elaeis guineensis
gb|EMS51624.1|  E3 ubiquitin-protein ligase SPL11                       192   3e-53   Triticum urartu
ref|XP_004984735.1|  PREDICTED: protein spotted leaf 11-like isof...    191   4e-53   
ref|XP_008448400.1|  PREDICTED: U-box domain-containing protein 13      189   2e-52   Cucumis melo [Oriental melon]
ref|XP_006649845.1|  PREDICTED: protein spotted leaf 11-like            190   3e-52   Oryza brachyantha
ref|NP_001049711.1|  Os03g0275900                                       188   1e-51   
gb|EEC74963.1|  hypothetical protein OsI_10954                          188   1e-51   Oryza sativa Indica Group [Indian rice]
gb|ABG22055.1|  Spotted leaf protein 11, putative, expressed            186   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99652.1|  Spotted leaf protein 11, putative, expressed            186   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004163228.1|  PREDICTED: U-box domain-containing protein 1...    187   2e-51   
ref|XP_004143106.1|  PREDICTED: U-box domain-containing protein 1...    187   2e-51   Cucumis sativus [cucumbers]
ref|XP_009421341.1|  PREDICTED: protein spotted leaf 11-like            187   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004962703.1|  PREDICTED: protein spotted leaf 11-like            187   3e-51   Setaria italica
gb|EEC69528.1|  hypothetical protein OsI_38799                          186   3e-51   Oryza sativa Indica Group [Indian rice]
ref|NP_001067077.2|  Os12g0570000                                       186   3e-51   
sp|A2ZLU6.2|SL11_ORYSI  RecName: Full=Protein spotted leaf 11; Al...    186   5e-51   Oryza sativa Indica Group [Indian rice]
gb|EAZ20925.1|  hypothetical protein OsJ_36575                          186   6e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664118.1|  PREDICTED: protein spotted leaf 11-like            184   7e-51   Oryza brachyantha
tpg|DAA47121.1|  TPA: putative ARM repeat-containing protein cont...    184   1e-50   
gb|EMT11433.1|  Protein spotted leaf 11                                 184   1e-50   
dbj|BAJ85648.1|  predicted protein                                      184   4e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS63526.1|  E3 ubiquitin-protein ligase SPL11                       184   4e-50   Triticum urartu
ref|NP_001130347.1|  uncharacterized protein LOC100191442               174   8e-50   
ref|XP_009407488.1|  PREDICTED: protein spotted leaf 11-like            181   3e-49   
ref|XP_003578975.1|  PREDICTED: protein spotted leaf 11-like            181   4e-49   Brachypodium distachyon [annual false brome]
gb|ADB85351.1|  putative spotted leaf protein 11                        179   7e-48   Phyllostachys edulis [kikko-chiku]
gb|AGQ04508.1|  spotted leaf 11                                         167   1e-47   Oryza meyeriana var. granulata
ref|XP_003561780.1|  PREDICTED: protein spotted leaf 11-like            176   3e-47   Brachypodium distachyon [annual false brome]
ref|XP_009402317.1|  PREDICTED: protein spotted leaf 11-like            176   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGQ04498.1|  spotted leaf 11                                         166   3e-47   Oryza glumipatula
gb|AGQ04503.1|  spotted leaf 11                                         165   4e-47   Oryza sativa Indica Group [Indian rice]
gb|AGQ04501.1|  spotted leaf 11                                         165   6e-47   Oryza meridionalis [Australian wild rice]
gb|AGQ04499.1|  spotted leaf 11                                         165   6e-47   Oryza longistaminata [long-staminate rice]
gb|AGQ04496.1|  spotted leaf 11                                         165   6e-47   Oryza sativa f. spontanea
gb|ADQ12763.1|  ARM protein                                             164   8e-47   Picea jezoensis [Yeddo spruce]
ref|XP_002443392.1|  hypothetical protein SORBIDRAFT_08g018765          173   9e-47   
gb|ADQ12754.1|  ARM protein                                             164   1e-46   Picea abies
gb|AGQ04505.1|  spotted leaf 11                                         164   2e-46   Oryza punctata
gb|AGQ04506.1|  spotted leaf 11                                         164   2e-46   Oryza officinalis
ref|XP_008672017.1|  PREDICTED: uncharacterized protein LOC100191...    172   4e-46   
gb|AGQ04507.1|  spotted leaf 11                                         162   7e-46   Oryza australiensis
ref|XP_008810592.1|  PREDICTED: LOW QUALITY PROTEIN: protein spot...    171   1e-45   
ref|XP_004515619.1|  PREDICTED: U-box domain-containing protein 1...    164   3e-43   Cicer arietinum [garbanzo]
ref|XP_007140288.1|  hypothetical protein PHAVU_008G099500g             156   4e-41   Phaseolus vulgaris [French bean]
ref|XP_002529604.1|  E3 ubiquitin ligase PUB14, putative                155   4e-40   
gb|KEH22840.1|  armadillo/beta-catenin repeat protein                   152   3e-39   Medicago truncatula
ref|XP_001772291.1|  predicted protein                                  151   1e-38   
gb|KHN43042.1|  U-box domain-containing protein 10                      150   1e-38   Glycine soja [wild soybean]
ref|XP_009785565.1|  PREDICTED: U-box domain-containing protein 1...    151   1e-38   Nicotiana sylvestris
ref|XP_011084290.1|  PREDICTED: U-box domain-containing protein 14      150   2e-38   Sesamum indicum [beniseed]
ref|XP_003528526.1|  PREDICTED: U-box domain-containing protein 1...    150   2e-38   Glycine max [soybeans]
ref|XP_003555889.1|  PREDICTED: U-box domain-containing protein 1...    150   4e-38   Glycine max [soybeans]
ref|XP_009760654.1|  PREDICTED: U-box domain-containing protein 14      149   4e-38   Nicotiana sylvestris
gb|KHN32252.1|  U-box domain-containing protein 10                      149   5e-38   Glycine soja [wild soybean]
ref|XP_008454770.1|  PREDICTED: U-box domain-containing protein 1...    149   6e-38   Cucumis melo [Oriental melon]
ref|XP_010105768.1|  U-box domain-containing protein 11                 149   7e-38   Morus notabilis
ref|XP_010241804.1|  PREDICTED: U-box domain-containing protein 14      149   7e-38   
ref|XP_002526006.1|  E3 ubiquitin ligase PUB14, putative                149   7e-38   Ricinus communis
ref|XP_009630244.1|  PREDICTED: U-box domain-containing protein 1...    149   7e-38   Nicotiana tomentosiformis
ref|XP_011038670.1|  PREDICTED: U-box domain-containing protein 1...    148   7e-38   Populus euphratica
ref|XP_006833209.1|  hypothetical protein AMTR_s00072p00171260          149   8e-38   
ref|XP_004140474.1|  PREDICTED: U-box domain-containing protein 1...    148   9e-38   
ref|XP_011070638.1|  PREDICTED: U-box domain-containing protein 1...    148   1e-37   Sesamum indicum [beniseed]
ref|XP_004161193.1|  PREDICTED: U-box domain-containing protein 1...    148   1e-37   
ref|XP_011038668.1|  PREDICTED: U-box domain-containing protein 1...    148   1e-37   Populus euphratica
gb|KDP30475.1|  hypothetical protein JCGZ_16154                         148   1e-37   Jatropha curcas
ref|XP_002968976.1|  hypothetical protein SELMODRAFT_231208             147   2e-37   
ref|XP_011075713.1|  PREDICTED: U-box domain-containing protein 1...    147   2e-37   Sesamum indicum [beniseed]
ref|XP_002990024.1|  hypothetical protein SELMODRAFT_184959             147   3e-37   
ref|XP_002315888.2|  hypothetical protein POPTR_0010s12410g             147   3e-37   
ref|XP_007009958.1|  U-box domain-containing protein 14                 147   4e-37   
ref|XP_010067333.1|  PREDICTED: U-box domain-containing protein 14      147   4e-37   Eucalyptus grandis [rose gum]
ref|XP_010253985.1|  PREDICTED: U-box domain-containing protein 1...    146   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_009594953.1|  PREDICTED: U-box domain-containing protein 14      146   4e-37   Nicotiana tomentosiformis
ref|XP_010681970.1|  PREDICTED: U-box domain-containing protein 11      147   5e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002270524.1|  PREDICTED: U-box domain-containing protein 14      146   6e-37   Vitis vinifera
gb|EYU30050.1|  hypothetical protein MIMGU_mgv1a002663mg                146   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_004236974.1|  PREDICTED: U-box domain-containing protein 1...    146   7e-37   Solanum lycopersicum
gb|KEH30893.1|  armadillo/beta-catenin repeat protein                   145   8e-37   Medicago truncatula
gb|KDO64708.1|  hypothetical protein CISIN_1g006669mg                   145   8e-37   Citrus sinensis [apfelsine]
ref|XP_006361678.1|  PREDICTED: U-box domain-containing protein 1...    145   9e-37   Solanum tuberosum [potatoes]
ref|XP_010666679.1|  PREDICTED: U-box domain-containing protein 14      145   9e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008233282.1|  PREDICTED: U-box domain-containing protein 14      145   1e-36   Prunus mume [ume]
ref|XP_007157719.1|  hypothetical protein PHAVU_002G092600g             145   1e-36   Phaseolus vulgaris [French bean]
ref|XP_008364702.1|  PREDICTED: U-box domain-containing protein 14      145   1e-36   Malus domestica [apple tree]
emb|CDO99779.1|  unnamed protein product                                145   1e-36   Coffea canephora [robusta coffee]
ref|XP_006495051.1|  PREDICTED: U-box domain-containing protein 1...    145   1e-36   
gb|KDO64707.1|  hypothetical protein CISIN_1g006669mg                   145   1e-36   Citrus sinensis [apfelsine]
ref|XP_010552723.1|  PREDICTED: U-box domain-containing protein 11      145   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_011023140.1|  PREDICTED: U-box domain-containing protein 1...    145   2e-36   Populus euphratica
ref|XP_010935715.1|  PREDICTED: U-box domain-containing protein 1...    144   2e-36   Elaeis guineensis
emb|CDY15272.1|  BnaC06g07580D                                          139   2e-36   Brassica napus [oilseed rape]
gb|KEH30892.1|  armadillo/beta-catenin repeat protein                   145   2e-36   Medicago truncatula
ref|XP_006850733.1|  hypothetical protein AMTR_s00025p00052670          145   2e-36   
ref|XP_003607915.1|  U-box domain-containing protein                    145   2e-36   
ref|XP_008789545.1|  PREDICTED: U-box domain-containing protein 1...    144   2e-36   
ref|XP_011023132.1|  PREDICTED: U-box domain-containing protein 1...    145   2e-36   Populus euphratica
ref|XP_008789544.1|  PREDICTED: U-box domain-containing protein 1...    145   2e-36   Phoenix dactylifera
ref|XP_002986139.1|  ubiquitin-protein ligase, PUB13                    145   2e-36   Selaginella moellendorffii
ref|XP_006841267.1|  hypothetical protein AMTR_s00135p00108920          145   2e-36   
ref|XP_002984952.1|  ubiquitin-protein ligase, PUB13                    145   2e-36   Selaginella moellendorffii
ref|XP_010274639.1|  PREDICTED: U-box domain-containing protein 1...    145   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004505257.1|  PREDICTED: U-box domain-containing protein 1...    145   2e-36   Cicer arietinum [garbanzo]
ref|XP_004250056.1|  PREDICTED: U-box domain-containing protein 1...    144   3e-36   
ref|XP_010935713.1|  PREDICTED: U-box domain-containing protein 1...    144   3e-36   
emb|CDY04746.1|  BnaC05g18430D                                          144   3e-36   
ref|XP_009115567.1|  PREDICTED: U-box domain-containing protein 11      144   3e-36   Brassica rapa
ref|XP_010935712.1|  PREDICTED: U-box domain-containing protein 1...    144   3e-36   Elaeis guineensis
emb|CDY21412.1|  BnaA09g30150D                                          144   3e-36   Brassica napus [oilseed rape]
ref|XP_010935714.1|  PREDICTED: U-box domain-containing protein 1...    144   3e-36   Elaeis guineensis
ref|XP_006360416.1|  PREDICTED: U-box domain-containing protein 1...    144   4e-36   Solanum tuberosum [potatoes]
ref|XP_006448286.1|  hypothetical protein CICLE_v10014584mg             144   4e-36   Citrus clementina [clementine]
ref|XP_006436479.1|  hypothetical protein CICLE_v10030962mg             141   6e-36   
emb|CDX87794.1|  BnaC02g31550D                                          137   7e-36   
ref|XP_004307361.1|  PREDICTED: U-box domain-containing protein 14      143   7e-36   Fragaria vesca subsp. vesca
ref|XP_009103205.1|  PREDICTED: U-box domain-containing protein 1...    142   8e-36   Brassica rapa
ref|XP_004298462.1|  PREDICTED: U-box domain-containing protein 11      143   9e-36   Fragaria vesca subsp. vesca
gb|EYU39871.1|  hypothetical protein MIMGU_mgv1a002720mg                143   9e-36   Erythranthe guttata [common monkey flower]
emb|CDP00753.1|  unnamed protein product                                143   9e-36   Coffea canephora [robusta coffee]
ref|XP_010504312.1|  PREDICTED: U-box domain-containing protein 14      143   9e-36   Camelina sativa [gold-of-pleasure]
gb|KJB73521.1|  hypothetical protein B456_011G237300                    143   1e-35   Gossypium raimondii
ref|XP_010940632.1|  PREDICTED: U-box domain-containing protein 12      143   1e-35   Elaeis guineensis
ref|XP_010427209.1|  PREDICTED: U-box domain-containing protein 1...    143   1e-35   
ref|XP_007045104.1|  U-box domain-containing protein 10                 143   1e-35   
ref|XP_010516027.1|  PREDICTED: U-box domain-containing protein 1...    142   1e-35   Camelina sativa [gold-of-pleasure]
emb|CAB41099.1|  putative protein                                       142   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191045.2|  U-box domain-containing protein 14                    142   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010112203.1|  U-box domain-containing protein 14                 142   1e-35   Morus notabilis
ref|XP_010557715.1|  PREDICTED: U-box domain-containing protein 14      142   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_004142402.1|  PREDICTED: U-box domain-containing protein 1...    142   1e-35   Cucumis sativus [cucumbers]
ref|XP_002876275.1|  armadillo/beta-catenin repeat family protein       142   1e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_004157535.1|  PREDICTED: U-box domain-containing protein 1...    142   1e-35   
gb|ACN40705.1|  unknown                                                 142   1e-35   Picea sitchensis
ref|XP_006436478.1|  hypothetical protein CICLE_v10030962mg             142   2e-35   
ref|XP_003535520.1|  PREDICTED: U-box domain-containing protein 1...    142   2e-35   Glycine max [soybeans]
emb|CBI26916.3|  unnamed protein product                                142   2e-35   Vitis vinifera
ref|XP_008362668.1|  PREDICTED: U-box domain-containing protein 1...    142   2e-35   
gb|KDO48789.1|  hypothetical protein CISIN_1g006877mg                   141   2e-35   Citrus sinensis [apfelsine]
ref|XP_002311496.2|  hypothetical protein POPTR_0008s12760g             142   2e-35   Populus trichocarpa [western balsam poplar]
emb|CDY25764.1|  BnaA07g10180D                                          142   2e-35   Brassica napus [oilseed rape]
ref|XP_008800544.1|  PREDICTED: U-box domain-containing protein 1...    142   2e-35   Phoenix dactylifera
emb|CDY12497.1|  BnaC07g13370D                                          142   2e-35   Brassica napus [oilseed rape]
ref|XP_002280520.1|  PREDICTED: U-box domain-containing protein 11      142   2e-35   Vitis vinifera
emb|CDY12733.1|  BnaC04g29080D                                          135   2e-35   Brassica napus [oilseed rape]
emb|CDX78273.1|  BnaA09g34680D                                          142   2e-35   
ref|XP_009116165.1|  PREDICTED: U-box domain-containing protein 14      142   2e-35   Brassica rapa
gb|KDP38040.1|  hypothetical protein JCGZ_04683                         142   3e-35   Jatropha curcas
gb|KDO48788.1|  hypothetical protein CISIN_1g006877mg                   141   3e-35   Citrus sinensis [apfelsine]
ref|XP_008446840.1|  PREDICTED: U-box domain-containing protein 14      141   3e-35   Cucumis melo [Oriental melon]
ref|XP_006436481.1|  hypothetical protein CICLE_v10030962mg             141   3e-35   Citrus clementina [clementine]
dbj|BAD93765.1|  hypothetical protein                                   133   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34724.1|  hypothetical protein AALP_AA5G184200                    141   5e-35   Arabis alpina [alpine rockcress]
emb|CDX92966.1|  BnaA03g36880D                                          134   5e-35   
emb|CDX73439.1|  BnaC08g25640D                                          142   6e-35   
ref|XP_010259497.1|  PREDICTED: U-box domain-containing protein 1...    140   7e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010066634.1|  PREDICTED: U-box domain-containing protein 11      140   7e-35   Eucalyptus grandis [rose gum]
ref|XP_007143751.1|  hypothetical protein PHAVU_007G098700g             140   8e-35   Phaseolus vulgaris [French bean]
ref|XP_006403526.1|  hypothetical protein EUTSA_v10010199mg             140   8e-35   Eutrema salsugineum [saltwater cress]
gb|KJB15482.1|  hypothetical protein B456_002G180200                    140   9e-35   Gossypium raimondii
ref|XP_004496239.1|  PREDICTED: U-box domain-containing protein 1...    140   1e-34   Cicer arietinum [garbanzo]
ref|XP_006290746.1|  hypothetical protein CARUB_v10016842mg             140   1e-34   Capsella rubella
gb|KHG15771.1|  U-box domain-containing 14 -like protein                140   1e-34   Gossypium arboreum [tree cotton]
gb|KGN51512.1|  hypothetical protein Csa_5G571550                       138   1e-34   Cucumis sativus [cucumbers]
ref|XP_009596674.1|  PREDICTED: U-box domain-containing protein 1...    140   2e-34   Nicotiana tomentosiformis
ref|XP_004167232.1|  PREDICTED: U-box domain-containing protein 1...    138   2e-34   
gb|KFK44389.1|  hypothetical protein AALP_AA1G251200                    139   2e-34   Arabis alpina [alpine rockcress]
ref|XP_008467150.1|  PREDICTED: U-box domain-containing protein 1...    139   2e-34   
ref|XP_008467149.1|  PREDICTED: U-box domain-containing protein 1...    139   3e-34   Cucumis melo [Oriental melon]
ref|XP_007221973.1|  hypothetical protein PRUPE_ppa002756mg             139   3e-34   Prunus persica
ref|XP_003556245.1|  PREDICTED: U-box domain-containing protein 1...    139   3e-34   Glycine max [soybeans]
gb|KHN00867.1|  U-box domain-containing protein 14                      139   3e-34   Glycine soja [wild soybean]
ref|XP_009368915.1|  PREDICTED: U-box domain-containing protein 14      139   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_004150480.1|  PREDICTED: U-box domain-containing protein 1...    139   4e-34   
ref|XP_010498796.1|  PREDICTED: U-box domain-containing protein 1...    138   4e-34   Camelina sativa [gold-of-pleasure]
gb|EAY99303.1|  hypothetical protein OsI_21270                          138   4e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010477585.1|  PREDICTED: U-box domain-containing protein 1...    138   4e-34   
ref|XP_011031687.1|  PREDICTED: U-box domain-containing protein 14      138   4e-34   
ref|NP_001056535.2|  Os06g0102700                                       138   4e-34   
ref|XP_010460079.1|  PREDICTED: U-box domain-containing protein 11      138   5e-34   
ref|XP_002311996.1|  armadillo/beta-catenin repeat family protein       138   5e-34   
sp|Q5VRH9.1|PUB12_ORYSJ  RecName: Full=U-box domain-containing pr...    138   6e-34   
ref|XP_006416130.1|  hypothetical protein EUTSA_v10007104mg             137   8e-34   
ref|XP_009417655.1|  PREDICTED: U-box domain-containing protein 10      138   1e-33   
ref|XP_002315320.1|  armadillo/beta-catenin repeat family protein       137   1e-33   
ref|XP_009797524.1|  PREDICTED: U-box domain-containing protein 1...    137   1e-33   
ref|XP_007218867.1|  hypothetical protein PRUPE_ppa003139mg             136   2e-33   
ref|XP_010471108.1|  PREDICTED: U-box domain-containing protein 1...    137   2e-33   
ref|XP_006300861.1|  hypothetical protein CARUB_v10019954mg             137   2e-33   
gb|KHN07831.1|  U-box domain-containing protein 13                      137   2e-33   
dbj|BAD94539.1|  hypothetical protein                                   130   2e-33   
ref|XP_011024385.1|  PREDICTED: U-box domain-containing protein 1...    136   3e-33   
ref|XP_011041060.1|  PREDICTED: U-box domain-containing protein 1...    136   3e-33   
ref|XP_010427916.1|  PREDICTED: U-box domain-containing protein 10      136   3e-33   
dbj|BAD94341.1|  hypothetical protein                                   133   3e-33   
ref|XP_008243346.1|  PREDICTED: U-box domain-containing protein 11      136   3e-33   
ref|XP_008775205.1|  PREDICTED: U-box domain-containing protein 1...    135   5e-33   
ref|XP_003557288.1|  PREDICTED: U-box domain-containing protein 12      135   5e-33   
gb|KEH43492.1|  armadillo/beta-catenin repeat protein                   134   5e-33   
ref|XP_008339570.1|  PREDICTED: U-box domain-containing protein 1...    135   5e-33   
ref|XP_002890550.1|  armadillo/beta-catenin repeat family protein       135   5e-33   
ref|XP_006580747.1|  PREDICTED: U-box domain-containing protein 1...    130   6e-33   
gb|EMS57563.1|  U-box domain-containing protein 12                      134   6e-33   
ref|XP_010415797.1|  PREDICTED: U-box domain-containing protein 1...    135   7e-33   
ref|XP_009357795.1|  PREDICTED: U-box domain-containing protein 1...    134   1e-32   
gb|KHN37791.1|  U-box domain-containing protein 14                      134   1e-32   
ref|NP_173716.1|  ARM repeat superfamily protein                        134   1e-32   
gb|AAO00878.1|  unknown protein                                         134   1e-32   
ref|XP_003550969.1|  PREDICTED: U-box domain-containing protein 1...    132   1e-32   
gb|AAB72157.1|  hypothetical protein                                    134   1e-32   
gb|KEH43493.1|  armadillo/beta-catenin repeat protein                   134   1e-32   
dbj|BAJ85388.1|  predicted protein                                      134   2e-32   
ref|XP_006344225.1|  PREDICTED: U-box domain-containing protein 1...    134   2e-32   
ref|XP_006306975.1|  hypothetical protein CARUB_v10008550mg             134   2e-32   
gb|AGT17414.1|  hypothetical protein SHCRBa_140_J14_R_360               132   4e-32   
ref|XP_006655674.1|  PREDICTED: U-box domain-containing protein 1...    131   5e-32   
ref|XP_002888814.1|  armadillo/beta-catenin repeat family protein       132   6e-32   
ref|NP_001117582.1|  ARM repeat superfamily protein                     130   8e-32   
gb|AAD55500.1|AC008148_10  Unknown protein                              131   9e-32   
ref|XP_006603220.1|  PREDICTED: U-box domain-containing protein 1...    127   1e-31   
gb|AFW88819.1|  putative ARM repeat-containing protein containing...    125   1e-31   
ref|XP_010916174.1|  PREDICTED: U-box domain-containing protein 1...    131   2e-31   
ref|XP_002436313.1|  hypothetical protein SORBIDRAFT_10g000280          131   2e-31   
ref|XP_004238849.1|  PREDICTED: U-box domain-containing protein 11      131   2e-31   
gb|ACF80473.1|  unknown                                                 124   2e-31   
ref|NP_177258.3|  ARM repeat superfamily protein                        130   3e-31   
gb|ACG29722.1|  spotted leaf protein 11                                 130   3e-31   
ref|NP_001145851.1|  uncharacterized protein LOC100279362               130   3e-31   
gb|AEN82124.1|  AT3G46510-like protein                                  123   3e-31   
gb|ADG38562.1|  AT3G46510-like protein                                  123   3e-31   
ref|XP_004964257.1|  PREDICTED: U-box domain-containing protein 1...    130   3e-31   
gb|AFW86270.1|  putative ARM repeat-containing protein containing...    130   4e-31   
gb|ACL52909.1|  unknown                                                 129   9e-31   
gb|KFK41527.1|  hypothetical protein AALP_AA2G141100                    129   1e-30   
ref|XP_009391057.1|  PREDICTED: U-box domain-containing protein 12      129   1e-30   
ref|XP_009105771.1|  PREDICTED: U-box domain-containing protein 1...    127   1e-30   
ref|XP_006575977.1|  PREDICTED: U-box domain-containing protein 1...    122   2e-30   
ref|XP_009105769.1|  PREDICTED: U-box domain-containing protein 1...    127   3e-30   
ref|XP_002965709.1|  ubiquitin-protein ligase, PUB12                    127   5e-30   
emb|CDX72769.1|  BnaC06g32170D                                          127   5e-30   
ref|XP_002454334.1|  hypothetical protein SORBIDRAFT_04g028890          127   7e-30   
ref|XP_004953824.1|  PREDICTED: U-box domain-containing protein 1...    126   1e-29   
emb|CDX96295.1|  BnaA07g29060D                                          126   1e-29   
ref|XP_002971622.1|  ubiquitin-protein ligase, PUB12                    126   1e-29   
ref|XP_001767444.1|  predicted protein                                  120   1e-29   
ref|XP_001772932.1|  predicted protein                                  125   1e-29   
gb|AFW63815.1|  putative ARM repeat-containing protein containing...    125   2e-29   
gb|ADG38568.1|  AT3G46510-like protein                                  118   4e-29   
gb|KHN29326.1|  U-box domain-containing protein 15                      124   4e-29   
ref|NP_001131869.1|  uncharacterized protein LOC100193248               124   4e-29   
ref|XP_003533598.1|  PREDICTED: U-box domain-containing protein 1...    124   6e-29   
ref|NP_001183666.1|  uncharacterized protein LOC100502260               117   9e-29   
emb|CBI31426.3|  unnamed protein product                                122   2e-28   
gb|EEC73944.1|  hypothetical protein OsI_08816                          122   3e-28   
ref|NP_001048024.1|  Os02g0732200                                       122   3e-28   
gb|EAZ24511.1|  hypothetical protein OsJ_08271                          122   4e-28   
gb|EMT21789.1|  U-box domain-containing protein 11                      121   4e-28   
ref|XP_006390814.1|  hypothetical protein EUTSA_v10018269mg             121   7e-28   
ref|XP_006649017.1|  PREDICTED: U-box domain-containing protein 1...    121   8e-28   
dbj|BAJ97560.1|  predicted protein                                      121   9e-28   
dbj|BAK01935.1|  predicted protein                                      121   9e-28   
ref|XP_003573013.2|  PREDICTED: U-box domain-containing protein 1...    120   1e-27   
ref|XP_010111712.1|  U-box domain-containing protein 15                 120   1e-27   
gb|EPS61838.1|  hypothetical protein M569_12951                         119   3e-27   
ref|XP_003551670.2|  PREDICTED: U-box domain-containing protein 1...    119   3e-27   
ref|XP_006422439.1|  hypothetical protein CICLE_v10028003mg             119   3e-27   
ref|XP_009415649.1|  PREDICTED: U-box domain-containing protein 1...    119   4e-27   
ref|XP_006486608.1|  PREDICTED: U-box domain-containing protein 1...    119   4e-27   
ref|NP_001159210.1|  uncharacterized protein LOC100304296               112   4e-27   
gb|AFK47818.1|  unknown                                                 111   6e-27   
gb|KJB32737.1|  hypothetical protein B456_005G258700                    117   1e-26   
ref|XP_008389989.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    115   1e-26   
gb|KHG28766.1|  U-box domain-containing 15 -like protein                117   2e-26   
ref|XP_009334185.1|  PREDICTED: U-box domain-containing protein 1...    115   6e-26   
ref|XP_006582784.1|  PREDICTED: U-box domain-containing protein 1...    111   7e-26   
ref|XP_008387871.1|  PREDICTED: U-box domain-containing protein 1...    115   9e-26   
ref|XP_009334180.1|  PREDICTED: U-box domain-containing protein 1...    115   1e-25   
ref|XP_011000894.1|  PREDICTED: U-box domain-containing protein 1...    115   1e-25   
ref|XP_001753438.1|  predicted protein                                  115   1e-25   
ref|XP_011000893.1|  PREDICTED: U-box domain-containing protein 1...    115   1e-25   
ref|XP_002313587.2|  hypothetical protein POPTR_0009s16740g             114   2e-25   
gb|KJB29690.1|  hypothetical protein B456_005G114100                    112   2e-25   
gb|KDP42027.1|  hypothetical protein JCGZ_03090                         114   3e-25   
emb|CBI19855.3|  unnamed protein product                                114   4e-25   
gb|KJB29691.1|  hypothetical protein B456_005G114100                    112   4e-25   
ref|XP_010061171.1|  PREDICTED: U-box domain-containing protein 15      113   6e-25   
gb|KCW68091.1|  hypothetical protein EUGRSUZ_F01774                     113   6e-25   
ref|XP_002280063.2|  PREDICTED: U-box domain-containing protein 1...    113   7e-25   
ref|XP_010266170.1|  PREDICTED: U-box domain-containing protein 15      112   7e-25   
ref|XP_006828720.1|  hypothetical protein AMTR_s00001p00030110          112   9e-25   
ref|XP_011000892.1|  PREDICTED: U-box domain-containing protein 1...    112   1e-24   
ref|XP_007041624.1|  Plant U-Box 15 isoform 2                           110   1e-24   
ref|XP_009624791.1|  PREDICTED: U-box domain-containing protein 1...    111   1e-24   
gb|KJB29689.1|  hypothetical protein B456_005G114100                    112   1e-24   
gb|KHG07068.1|  U-box domain-containing 15 -like protein                112   1e-24   
ref|XP_010094554.1|  U-box domain-containing protein 15                 112   1e-24   
emb|CDX95193.1|  BnaC09g16770D                                          112   2e-24   
ref|XP_002525798.1|  E3 ubiquitin ligase PUB14, putative                111   2e-24   
ref|XP_011088699.1|  PREDICTED: U-box domain-containing protein 1...    110   2e-24   
emb|CAN59900.1|  hypothetical protein VITISV_002888                     111   2e-24   
emb|CBI37755.3|  unnamed protein product                                111   2e-24   
emb|CAN75366.1|  hypothetical protein VITISV_030646                     112   2e-24   
ref|XP_004238429.1|  PREDICTED: U-box domain-containing protein 15      111   3e-24   
ref|XP_007041623.1|  U-box domain-containing protein 15 isoform 1       111   3e-24   
ref|XP_009624790.1|  PREDICTED: U-box domain-containing protein 1...    111   3e-24   
ref|XP_009759338.1|  PREDICTED: U-box domain-containing protein 15      111   3e-24   
ref|XP_007139800.1|  hypothetical protein PHAVU_008G059800g             110   3e-24   
ref|XP_002279546.1|  PREDICTED: U-box domain-containing protein 15      110   3e-24   
gb|KJB14264.1|  hypothetical protein B456_002G116600                    110   4e-24   
ref|XP_006342249.1|  PREDICTED: U-box domain-containing protein 1...    110   4e-24   
gb|EPS71103.1|  hypothetical protein M569_03654                         110   5e-24   
ref|XP_011088698.1|  PREDICTED: U-box domain-containing protein 1...    110   6e-24   
ref|XP_009113439.1|  PREDICTED: U-box domain-containing protein 15      110   6e-24   
ref|XP_006473917.1|  PREDICTED: U-box domain-containing protein 1...    110   7e-24   
gb|KDP36792.1|  hypothetical protein JCGZ_08083                         110   7e-24   
emb|CDY68037.1|  BnaA09g53450D                                          110   8e-24   
ref|XP_006435360.1|  hypothetical protein CICLE_v10003715mg             110   8e-24   
ref|XP_001774545.1|  predicted protein                                  106   8e-24   
ref|XP_004292907.1|  PREDICTED: U-box domain-containing protein 15      109   1e-23   
gb|EYU38026.1|  hypothetical protein MIMGU_mgv1a002670mg                109   1e-23   
ref|XP_002301921.1|  hypothetical protein POPTR_0002s01090g             109   1e-23   
ref|XP_011035017.1|  PREDICTED: U-box domain-containing protein 1...    109   1e-23   
ref|XP_011074094.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    108   2e-23   
gb|KHG01616.1|  U-box domain-containing 15 -like protein                108   2e-23   
ref|XP_010692545.1|  PREDICTED: U-box domain-containing protein 15      108   3e-23   
ref|XP_008221130.1|  PREDICTED: U-box domain-containing protein 15      108   3e-23   
ref|XP_007221969.1|  hypothetical protein PRUPE_ppa002735mg             107   4e-23   
gb|EAZ35525.1|  hypothetical protein OsJ_19806                          107   5e-23   
gb|EAZ02423.1|  hypothetical protein OsI_24524                          106   1e-22   
ref|NP_001058633.2|  Os06g0726900                                       106   1e-22   
ref|XP_004250057.1|  PREDICTED: U-box domain-containing protein 1...    105   2e-22   
ref|XP_002510676.1|  Spotted leaf protein, putative                     105   2e-22   
gb|EYU36563.1|  hypothetical protein MIMGU_mgv1a002804mg                105   2e-22   
ref|XP_009396584.1|  PREDICTED: U-box domain-containing protein 1...    105   4e-22   
dbj|BAK07343.1|  predicted protein                                      105   4e-22   
ref|XP_010670739.1|  PREDICTED: U-box domain-containing protein 4       105   5e-22   
ref|XP_009395374.1|  PREDICTED: U-box domain-containing protein 1...    104   5e-22   
ref|XP_007142063.1|  hypothetical protein PHAVU_008G249400g             105   6e-22   
ref|XP_001778307.1|  predicted protein                                  103   6e-22   
ref|XP_010028832.1|  PREDICTED: U-box domain-containing protein 1...    104   6e-22   
ref|XP_006575440.1|  PREDICTED: U-box domain-containing protein 4...    104   7e-22   
ref|XP_006575441.1|  PREDICTED: U-box domain-containing protein 4...    104   7e-22   
ref|XP_010556057.1|  PREDICTED: U-box domain-containing protein 15      103   9e-22   
gb|EMS48189.1|  U-box domain-containing protein 15                      103   1e-21   
gb|EMT32806.1|  U-box domain-containing protein 15                      103   1e-21   
gb|KJB15966.1|  hypothetical protein B456_002G206200                    102   2e-21   
gb|KHN40971.1|  U-box domain-containing protein 4                       103   2e-21   
gb|KHN08833.1|  U-box domain-containing protein 4                     99.8    2e-21   
gb|KJB15967.1|  hypothetical protein B456_002G206200                    102   2e-21   
ref|XP_002437630.1|  hypothetical protein SORBIDRAFT_10g030800          102   2e-21   
gb|KCW62621.1|  hypothetical protein EUGRSUZ_G001261                    100   2e-21   
gb|KHG04395.1|  U-box domain-containing 15 -like protein                102   2e-21   
gb|KJB15965.1|  hypothetical protein B456_002G206200                    102   3e-21   
ref|XP_008372845.1|  PREDICTED: U-box domain-containing protein 1...    102   3e-21   
ref|XP_002524955.1|  ubiquitin-protein ligase, putative                 102   4e-21   
gb|KCW54795.1|  hypothetical protein EUGRSUZ_I00736                     102   6e-21   
ref|XP_009373396.1|  PREDICTED: U-box domain-containing protein 1...    101   6e-21   
ref|XP_010028138.1|  PREDICTED: U-box domain-containing protein 4       102   6e-21   
gb|AFG71430.1|  hypothetical protein 2_6623_01                        95.9    7e-21   
gb|EAZ07380.1|  hypothetical protein OsI_29632                          101   7e-21   
ref|XP_004149702.1|  PREDICTED: U-box domain-containing protein 4...    101   9e-21   
ref|XP_008457779.1|  PREDICTED: U-box domain-containing protein 4...    101   9e-21   
ref|NP_001062063.1|  Os08g0481200                                       100   1e-20   
ref|XP_009367853.1|  PREDICTED: U-box domain-containing protein 4...    101   1e-20   
ref|XP_007018033.1|  Plant U-Box 15, putative                           100   1e-20   
ref|XP_008235953.1|  PREDICTED: U-box domain-containing protein 1...    100   1e-20   
ref|XP_009367873.1|  PREDICTED: U-box domain-containing protein 4...    101   1e-20   
ref|XP_002980963.1|  hypothetical protein SELMODRAFT_420513           97.4    1e-20   
ref|XP_007199735.1|  hypothetical protein PRUPE_ppa002658mg             100   1e-20   
ref|XP_006845980.1|  hypothetical protein AMTR_s00155p00026110          101   1e-20   
ref|XP_010935272.1|  PREDICTED: U-box domain-containing protein 15      100   1e-20   
gb|AFG71436.1|  hypothetical protein 2_6623_01                        94.7    1e-20   
gb|AFG71426.1|  hypothetical protein 2_6623_01                        94.4    2e-20   
ref|XP_006466521.1|  PREDICTED: U-box domain-containing protein 4...    100   2e-20   
gb|AFG71427.1|  hypothetical protein 2_6623_01                        94.4    2e-20   
gb|KJB43859.1|  hypothetical protein B456_007G219900                    100   2e-20   
ref|XP_010942967.1|  PREDICTED: U-box domain-containing protein 4...    100   2e-20   
ref|XP_003624019.1|  U-box domain-containing protein                    100   2e-20   
ref|XP_006466517.1|  PREDICTED: U-box domain-containing protein 4...    100   2e-20   
gb|KDO79024.1|  hypothetical protein CISIN_1g003348mg                   100   2e-20   
ref|XP_006426022.1|  hypothetical protein CICLE_v10024899mg             100   2e-20   
ref|XP_011013975.1|  PREDICTED: U-box domain-containing protein 4...    100   2e-20   
gb|KJB43858.1|  hypothetical protein B456_007G219900                    100   2e-20   
ref|XP_006659509.1|  PREDICTED: U-box domain-containing protein 1...    100   2e-20   
gb|AFG71443.1|  hypothetical protein 2_6623_01                        94.4    2e-20   
gb|KCW45403.1|  hypothetical protein EUGRSUZ_L00910                   99.0    2e-20   
ref|XP_002306495.2|  hypothetical protein POPTR_0005s18820g             100   2e-20   
ref|XP_007201804.1|  hypothetical protein PRUPE_ppa001702mg             100   2e-20   
ref|XP_011008564.1|  PREDICTED: U-box domain-containing protein 4...    100   3e-20   
emb|CDP02559.1|  unnamed protein product                                100   3e-20   
gb|KDO79033.1|  hypothetical protein CISIN_1g003348mg                 99.8    3e-20   
ref|XP_004492777.1|  PREDICTED: U-box domain-containing protein 1...  99.8    3e-20   
ref|XP_009797979.1|  PREDICTED: U-box domain-containing protein 4...    100   3e-20   
ref|XP_008645102.1|  PREDICTED: U-box domain-containing protein 15    99.8    3e-20   
ref|XP_011025265.1|  PREDICTED: U-box domain-containing protein 4...    100   3e-20   
gb|KDP32027.1|  hypothetical protein JCGZ_12488                       99.8    3e-20   
ref|XP_010531283.1|  PREDICTED: U-box domain-containing protein 4       100   3e-20   



>ref|XP_011089810.1| PREDICTED: U-box domain-containing protein 13 [Sesamum indicum]
Length=663

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 142/149 (95%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLLNEG+QRGKKDAATALFNLCIYQGNKGKAVRAGV+P LM+LLTEPQG+MVDEALAIL
Sbjct  484  VTLLNEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVIPILMRLLTEPQGSMVDEALAIL  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV +LV VI NGSPRNKENAAAVLVHLCSG+ QH+VEAQELG+
Sbjct  544  AILASHPEGKAAIGAAEAVPILVDVIRNGSPRNKENAAAVLVHLCSGDQQHLVEAQELGV  603

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDLAQ+GTERG+RKAAQLLE++NRF
Sbjct  604  MGPLLDLAQHGTERGKRKAAQLLERMNRF  632



>gb|EYU36264.1| hypothetical protein MIMGU_mgv1a002554mg [Erythranthe guttata]
Length=659

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 143/149 (96%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGV+PTLMQLLTEPQG+MVDEALAIL
Sbjct  483  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMQLLTEPQGSMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV VI +GSPRNKENAAAVLVHLCSG+ QH+V+AQELG+
Sbjct  543  AILASHPEGKAAIGTAEAVLVLVDVIGSGSPRNKENAAAVLVHLCSGDQQHLVQAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDLAQ+GTERG+RKAAQLLE++NRF
Sbjct  603  MGPLLDLAQHGTERGKRKAAQLLERMNRF  631



>ref|XP_009774572.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Nicotiana sylvestris]
Length=568

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL++G+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQG MVDEALAIL
Sbjct  384  VTLLSDGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGGMVDEALAIL  443

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK AIG A AV VLV VIANGSPRNKENA AVLVHLCSG+Q H+VE QEL +
Sbjct  444  AILASHPEGKAAIGAAGAVPVLVNVIANGSPRNKENAVAVLVHLCSGDQHHIVEVQELEV  503

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDL QNGT+RG+RKA QLLE+INR+
Sbjct  504  MGPLLDLVQNGTDRGKRKATQLLERINRY  532



>emb|CDP09042.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEPQG MVDEALAIL
Sbjct  477  VMLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPQGGMVDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV VI NGSPRNKENAAAVLVHLCSG+ QH+VEAQELG+
Sbjct  537  AILASHPEGKAAIGAAEAVPVLVDVIGNGSPRNKENAAAVLVHLCSGDQQHLVEAQELGV  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG LLDLAQNGTERGRRKA QLLE++NR+
Sbjct  597  MGYLLDLAQNGTERGRRKATQLLERMNRY  625



>gb|KJB55896.1| hypothetical protein B456_009G100000 [Gossypium raimondii]
Length=475

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  287  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  346

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLC+G+ QH+ EAQELG+
Sbjct  347  AILSSHPEGKSAIGAAEAVPVLVDVIGNGSPRNRENAAAVLVHLCAGDQQHLAEAQELGV  406

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE+++RF
Sbjct  407  MGPLMDLAQNGTDRGKRKAAQLLERMSRF  435


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+    R ++ A TAL NL I + NKG  +  G VP ++Q+L +             
Sbjct  205  VTLLSTPDSRTQEHAVTALLNLSICEENKGSIISFGAVPGIVQVLKK-------------  251

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  252  ----------------------------GSMEARENAAAALFSLSVVDENKVTIGASGAI  283

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  284  PPLVTLLSEGTQRGKKDAATAL  305



>ref|XP_009629379.1| PREDICTED: U-box domain-containing protein 13-like [Nicotiana 
tomentosiformis]
Length=665

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL++G+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQG MVDEALAIL
Sbjct  481  VTLLSDGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGGMVDEALAIL  540

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK AIG A AV VLV VIANGSPRNKENA AVLVHLCSG+Q H+VE QEL +
Sbjct  541  AILASHPEGKAAIGAAGAVPVLVNVIANGSPRNKENAVAVLVHLCSGDQHHIVEVQELEV  600

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDL QNGT+RG+RKA QLLE+INR+
Sbjct  601  MGPLLDLVQNGTDRGKRKATQLLERINRY  629



>ref|XP_009774522.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Nicotiana sylvestris]
Length=665

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL++G+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQG MVDEALAIL
Sbjct  481  VTLLSDGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGGMVDEALAIL  540

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK AIG A AV VLV VIANGSPRNKENA AVLVHLCSG+Q H+VE QEL +
Sbjct  541  AILASHPEGKAAIGAAGAVPVLVNVIANGSPRNKENAVAVLVHLCSGDQHHIVEVQELEV  600

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDL QNGT+RG+RKA QLLE+INR+
Sbjct  601  MGPLLDLVQNGTDRGKRKATQLLERINRY  629



>ref|XP_009599897.1| PREDICTED: U-box domain-containing protein 13-like [Nicotiana 
tomentosiformis]
Length=663

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKA+RAGVVPTLM+LLTEPQG MVDEALAIL
Sbjct  483  VALLSEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVVPTLMRLLTEPQGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI+NGSPRNKENAAAVLVHLCSG+Q H+VEAQ+LG+
Sbjct  543  AILSSHPEGKAAIGAAEAVPVLVDVISNGSPRNKENAAAVLVHLCSGDQHHLVEAQQLGL  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DL QNGTERG+RKA QLLE++NR+
Sbjct  603  MGPLMDLVQNGTERGKRKATQLLERLNRY  631



>gb|KJB55894.1| hypothetical protein B456_009G100000 [Gossypium raimondii]
 gb|KJB55895.1| hypothetical protein B456_009G100000 [Gossypium raimondii]
Length=574

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  386  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  445

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLC+G+ QH+ EAQELG+
Sbjct  446  AILSSHPEGKSAIGAAEAVPVLVDVIGNGSPRNRENAAAVLVHLCAGDQQHLAEAQELGV  505

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE+++RF
Sbjct  506  MGPLMDLAQNGTDRGKRKAAQLLERMSRF  534


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+    R ++ A TAL NL I + NKG  +  G VP ++Q+L +             
Sbjct  304  VTLLSTPDSRTQEHAVTALLNLSICEENKGSIISFGAVPGIVQVLKK-------------  350

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  351  ----------------------------GSMEARENAAAALFSLSVVDENKVTIGASGAI  382

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  383  PPLVTLLSEGTQRGKKDAATAL  404



>ref|XP_010106453.1| U-box domain-containing protein 13 [Morus notabilis]
 gb|EXC10629.1| U-box domain-containing protein 13 [Morus notabilis]
Length=664

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDE LAIL
Sbjct  487  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDETLAIL  546

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLC+G+ QH+VEAQELG+
Sbjct  547  AILASHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQHLVEAQELGV  606

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE+++RF
Sbjct  607  MGPLVDLAQNGTDRGKRKAAQLLERMSRF  635


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+    R ++ A TAL NL I + NKG  V +G VP ++ +L +             
Sbjct  405  VSLLSTPDSRTQEHAVTALLNLSICEDNKGSIVSSGAVPGIVHVLKK-------------  451

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   + + +    LG +
Sbjct  452  ----------------------------GSMEARENAAATLFSLSVVDGNKITIGALGAI  483

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  484  PPLVTLLSEGTQRGKKDAATAL  505



>ref|XP_007204993.1| hypothetical protein PRUPE_ppa003509mg [Prunus persica]
 gb|EMJ06192.1| hypothetical protein PRUPE_ppa003509mg [Prunus persica]
Length=569

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLMQLLTEP G MVDEALAIL
Sbjct  386  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMQLLTEPGGGMVDEALAIL  445

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV VI  GSPRN+ENAAAVLVHLCSG+ QH+VEAQELG+
Sbjct  446  AILASHPEGKSAIGAAEAVPVLVEVIGTGSPRNRENAAAVLVHLCSGDQQHIVEAQELGV  505

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L++LAQNGT+RG+RKAAQLLE+INRF
Sbjct  506  MGSLMELAQNGTDRGKRKAAQLLERINRF  534



>ref|XP_010322360.1| PREDICTED: U-box domain-containing protein 13 isoform X2 [Solanum 
lycopersicum]
Length=572

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL++G+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM LLTEPQG+M+DEALAIL
Sbjct  392  VTLLSDGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVVTLMGLLTEPQGSMIDEALAIL  451

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQH-VVEAQELGI  332
            AIL+SHPEGK  IG A AV VLV VI +GSPRNKENAAAVLVHLCSG+QH +V+ QELGI
Sbjct  452  AILSSHPEGKTTIGAAGAVPVLVNVITSGSPRNKENAAAVLVHLCSGDQHYLVDVQELGI  511

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDL QNGTERGRRKA QLLE+INR+
Sbjct  512  MGPLLDLVQNGTERGRRKATQLLERINRY  540



>ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 13 [Vitis vinifera]
Length=682

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  483  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK AIG ++AV VLV VI NGSPRN+ENAAAVLVHLC+G+Q H+ EAQELG+
Sbjct  543  AILASHPEGKAAIGSSEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQHHLAEAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE++ RF
Sbjct  603  MGPLVDLAQNGTDRGKRKAAQLLERMGRF  631



>ref|XP_009777581.1| PREDICTED: U-box domain-containing protein 13-like [Nicotiana 
sylvestris]
Length=663

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKA+R+GVVPTLM+LLTEPQG MVDEALAIL
Sbjct  483  VALLSEGTQRGKKDAATALFNLCIYQGNKGKAIRSGVVPTLMRLLTEPQGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL+SHPEGK AIG A+A+ VLV VI++GSPRNKENAAAVLVHLCSG+Q H+VEAQ+LG+
Sbjct  543  AILSSHPEGKAAIGAAEAIPVLVDVISSGSPRNKENAAAVLVHLCSGDQHHLVEAQQLGL  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DL QNGTERGRRKA QLLE++NR+
Sbjct  603  MGPLMDLVQNGTERGRRKATQLLERLNRY  631



>gb|KHG14011.1| U-box domain-containing 13 -like protein [Gossypium arboreum]
Length=671

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  483  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLC+G+ QH+ EAQELG+
Sbjct  543  AILSSHPEGKSAIGAAEAVPVLVDVIGNGSPRNRENAAAVLVHLCAGDQQHLAEAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDLAQNGT+RG+RKAAQLLE+++RF
Sbjct  603  MGPLLDLAQNGTDRGKRKAAQLLERMSRF  631


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+    R ++ A TAL NL I + NKG  +  G VP+++Q+L +             
Sbjct  401  VTLLSTPDSRTQEHAVTALLNLSICEENKGSIISFGAVPSIVQVLKK-------------  447

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  448  ----------------------------GSMEARENAAAALFSLSVVDENKVTIGASGAI  479

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  480  PPLVTLLSEGTQRGKKDAATAL  501



>ref|XP_008223401.1| PREDICTED: U-box domain-containing protein 13 [Prunus mume]
Length=666

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLMQLLTEP G MVDEALAIL
Sbjct  484  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMQLLTEPGGGMVDEALAIL  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV VI  GSPRN+ENAAAVLVHLCSG+ QH+VEAQELG+
Sbjct  544  AILASHPEGKSAIGAAEAVPVLVEVIGTGSPRNRENAAAVLVHLCSGDQQHIVEAQELGV  603

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L++LAQNGT+RG+RKAAQLLE+INRF
Sbjct  604  MGSLMELAQNGTDRGKRKAAQLLERINRF  632



>ref|XP_004241233.1| PREDICTED: U-box domain-containing protein 13 isoform X1 [Solanum 
lycopersicum]
Length=661

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL++G+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM LLTEPQG+M+DEALAIL
Sbjct  481  VTLLSDGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVVTLMGLLTEPQGSMIDEALAIL  540

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQH-VVEAQELGI  332
            AIL+SHPEGK  IG A AV VLV VI +GSPRNKENAAAVLVHLCSG+QH +V+ QELGI
Sbjct  541  AILSSHPEGKTTIGAAGAVPVLVNVITSGSPRNKENAAAVLVHLCSGDQHYLVDVQELGI  600

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDL QNGTERGRRKA QLLE+INR+
Sbjct  601  MGPLLDLVQNGTERGRRKATQLLERINRY  629



>gb|KJB55893.1| hypothetical protein B456_009G100000 [Gossypium raimondii]
Length=671

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  483  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLC+G+ QH+ EAQELG+
Sbjct  543  AILSSHPEGKSAIGAAEAVPVLVDVIGNGSPRNRENAAAVLVHLCAGDQQHLAEAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE+++RF
Sbjct  603  MGPLMDLAQNGTDRGKRKAAQLLERMSRF  631


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+    R ++ A TAL NL I + NKG  +  G VP ++Q+L +             
Sbjct  401  VTLLSTPDSRTQEHAVTALLNLSICEENKGSIISFGAVPGIVQVLKK-------------  447

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  448  ----------------------------GSMEARENAAAALFSLSVVDENKVTIGASGAI  479

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  480  PPLVTLLSEGTQRGKKDAATAL  501



>ref|XP_006350763.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Solanum tuberosum]
Length=572

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL++G+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM LL EPQG M+DEALAIL
Sbjct  392  VTLLSDGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVVTLMGLLMEPQGGMIDEALAIL  451

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL+SHPEGK  IG A AV VLV VI NGSPRNKENAAAVLVHLCSG+Q H+V+ QELGI
Sbjct  452  AILSSHPEGKTTIGAAGAVPVLVNVITNGSPRNKENAAAVLVHLCSGDQHHLVDVQELGI  511

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DL QNGTERGRRKA QLLE+INR+
Sbjct  512  MGPLVDLVQNGTERGRRKATQLLERINRY  540



>ref|XP_010253199.1| PREDICTED: U-box domain-containing protein 13-like [Nelumbo nucifera]
Length=652

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL EGSQRGKKDAATALFNLCIYQGNKG+AVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  469  VTLLGEGSQRGKKDAATALFNLCIYQGNKGRAVRAGVVPTLMRLLTEPGGGMVDEALAIL  528

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLCSG+ +H+ EAQELG+
Sbjct  529  AILASHAEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCSGDPKHLAEAQELGV  588

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLLDLAQNGT+RG+RKAAQL++++NRF
Sbjct  589  MGPLLDLAQNGTDRGKRKAAQLIDRMNRF  617



>gb|EPS68981.1| hypothetical protein M569_05787, partial [Genlisea aurea]
Length=634

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 138/150 (92%), Gaps = 2/150 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL EG+QRGKKDAATALFNLCIYQGNKGKAVRAGV+PTLM+LLTEPQGNM+DEALAIL
Sbjct  477  VSLLGEGNQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMKLLTEPQGNMMDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSG--EQHVVEAQELG  335
            AILA HPEGK AIG A+AV +LV VI NGSPRNKENAAAVLVHLCS   +Q++ EAQELG
Sbjct  537  AILAGHPEGKAAIGAAEAVPILVDVIGNGSPRNKENAAAVLVHLCSSGDQQYLAEAQELG  596

Query  334  IMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +M PLLDLAQNGTERGRRKAAQLLE++NR+
Sbjct  597  LMVPLLDLAQNGTERGRRKAAQLLERMNRY  626



>ref|XP_006348996.1| PREDICTED: U-box domain-containing protein 13-like [Solanum tuberosum]
Length=664

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKG+A+RAGVVPTLMQLLT+PQG MVDEALAIL
Sbjct  483  VALLSEGTQRGKKDAATALFNLCIYQGNKGRAIRAGVVPTLMQLLTKPQGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL+SHPEGK AIG A AV VLV VI+NGSPRNKENAAAVLVHLCSG+Q H+VEAQ LG+
Sbjct  543  AILSSHPEGKAAIGAADAVPVLVDVISNGSPRNKENAAAVLVHLCSGDQHHLVEAQRLGL  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +GPL DL QNGTERGRRKA QLLE++NR 
Sbjct  603  IGPLTDLVQNGTERGRRKATQLLERMNRL  631



>gb|KJB08865.1| hypothetical protein B456_001G109500 [Gossypium raimondii]
Length=669

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVP LM+LLTEP G MVDEALAIL
Sbjct  483  VVLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPILMRLLTEPGGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLVGVI NGSPRN+EN AAVLVHLCSG+ QH+ EAQELG+
Sbjct  543  AILASHPEGKSAIGAAEAVPVLVGVIGNGSPRNRENGAAVLVHLCSGDQQHLAEAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE++NRF
Sbjct  603  MGPLVDLAQNGTDRGKRKAAQLLERMNRF  631



>ref|XP_006350762.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Solanum tuberosum]
Length=661

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL++G+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM LL EPQG M+DEALAIL
Sbjct  481  VTLLSDGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVVTLMGLLMEPQGGMIDEALAIL  540

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL+SHPEGK  IG A AV VLV VI NGSPRNKENAAAVLVHLCSG+Q H+V+ QELGI
Sbjct  541  AILSSHPEGKTTIGAAGAVPVLVNVITNGSPRNKENAAAVLVHLCSGDQHHLVDVQELGI  600

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DL QNGTERGRRKA QLLE+INR+
Sbjct  601  MGPLVDLVQNGTERGRRKATQLLERINRY  629



>ref|XP_007016448.1| Plant U-box 13 isoform 2 [Theobroma cacao]
 gb|EOY34067.1| Plant U-box 13 isoform 2 [Theobroma cacao]
Length=666

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  484  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV V+ NGSPRN+ENAAAVLVHLC+G+ QH+ EAQELG+
Sbjct  544  AILASHPEGKAAIGAAEAVPVLVDVVGNGSPRNRENAAAVLVHLCAGDQQHLAEAQELGV  603

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+ LAQNGT+RG+RKAAQLLE+++RF
Sbjct  604  MGPLVALAQNGTDRGKRKAAQLLERMSRF  632


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+    R ++ A TAL NL I + NKG  + +G VP ++Q+L +             
Sbjct  402  VSLLSTPDSRTQEHAVTALLNLSICEENKGSIISSGAVPGIVQVLKK-------------  448

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  449  ----------------------------GSMEARENAAATLFSLSVVDENKVTIGASGAI  480

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  481  PPLVTLLSEGTQRGKKDAATAL  502



>ref|XP_011042684.1| PREDICTED: U-box domain-containing protein 13-like [Populus euphratica]
Length=663

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTE  G M+DEALAIL
Sbjct  486  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTETGGGMIDEALAIL  545

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK  IG A+AV VLV VI NGSPRN+ENAAAVLVHLCSG+Q H+VEAQE G+
Sbjct  546  AILASHPEGKTIIGAAEAVPVLVEVIRNGSPRNRENAAAVLVHLCSGDQKHLVEAQEHGV  605

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKA QLLE+I+RF
Sbjct  606  MGPLVDLAQNGTDRGKRKAQQLLERISRF  634


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 58/142 (41%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++   TAL NL I + NKG  V AG VP ++ +L +             
Sbjct  404  VGLLSTPDSRTQEHTITALLNLSICEENKGSIVSAGAVPGIVHVLKK-------------  450

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  451  ----------------------------GSMEARENAAATLFSLSVVDENKVTIGSLGAI  482

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  483  PPLVTLLSEGTQRGKKDAATAL  504



>ref|XP_006424806.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 gb|ESR38046.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 gb|KDO72885.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
 gb|KDO72886.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
 gb|KDO72887.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
Length=564

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM LLTEP G MVDEALAIL
Sbjct  387  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAIL  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLC+G+ Q++ EA+ELG+
Sbjct  447  AILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGV  506

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE+++RF
Sbjct  507  MGPLVDLAQNGTDRGKRKAAQLLERMSRF  535



>ref|XP_007016447.1| U-box domain-containing protein 13 isoform 1 [Theobroma cacao]
 gb|EOY34066.1| U-box domain-containing protein 13 isoform 1 [Theobroma cacao]
Length=693

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  511  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  570

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV V+ NGSPRN+ENAAAVLVHLC+G+ QH+ EAQELG+
Sbjct  571  AILASHPEGKAAIGAAEAVPVLVDVVGNGSPRNRENAAAVLVHLCAGDQQHLAEAQELGV  630

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+ LAQNGT+RG+RKAAQLLE+++RF
Sbjct  631  MGPLVALAQNGTDRGKRKAAQLLERMSRF  659


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+    R ++ A TAL NL I + NKG  + +G VP ++Q+L +             
Sbjct  429  VSLLSTPDSRTQEHAVTALLNLSICEENKGSIISSGAVPGIVQVLKK-------------  475

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  476  ----------------------------GSMEARENAAATLFSLSVVDENKVTIGASGAI  507

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  508  PPLVTLLSEGTQRGKKDAATAL  529



>gb|KDP44223.1| hypothetical protein JCGZ_05690 [Jatropha curcas]
Length=663

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  484  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLCSG+Q H+ EAQELG+
Sbjct  544  AILASHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCSGDQKHLAEAQELGV  603

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L+DLAQNGT+RG+RKA QLLE+++R+
Sbjct  604  MGSLIDLAQNGTDRGKRKAQQLLERMSRY  632


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+    R ++ A TAL NL I + NKG  + AG VP ++ +L +             
Sbjct  402  VSLLSTPDSRTQEHAVTALLNLSICEDNKGSIISAGAVPGIVHVLKK-------------  448

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  449  ----------------------------GSMEARENAAATLFSLSVVDENKVTIGSSGAI  480

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  481  PPLVTLLSEGTQRGKKDAATAL  502



>ref|XP_003539679.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max]
Length=662

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGSQRGKKDAATALFNLCIYQGNKGKAVRAGV+PTLM+LLTEP G MVDEALAIL
Sbjct  483  VTLLSEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGKV I  ++AV VLV  I NGSPRNKENAAAVLVHLCSG+ Q++ +AQELG+
Sbjct  543  AILASHPEGKVTIRASEAVPVLVEFIGNGSPRNKENAAAVLVHLCSGDQQYLAQAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLL+LAQNGT+RG+RKA QLLE+++R 
Sbjct  603  MGPLLELAQNGTDRGKRKAGQLLERMSRL  631


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 61/142 (43%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+    R ++ A TAL NL IY+ NKG  V +G VP ++ +L +             
Sbjct  401  VSLLSVPDSRTQEHAVTALLNLSIYENNKGSIVSSGAVPGIVHVLKK-------------  447

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  448  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGSLGAI  479

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   G++RG++ AA  L
Sbjct  480  PPLVTLLSEGSQRGKKDAATAL  501



>ref|XP_004250960.1| PREDICTED: U-box domain-containing protein 13 [Solanum lycopersicum]
Length=663

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKG+A+RAGVVPTLM LLT+PQG MVDEALAIL
Sbjct  483  VALLSEGTQRGKKDAATALFNLCIYQGNKGRAIRAGVVPTLMLLLTKPQGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL+SHPEGK AIG A AV VLV VIANGSPRNKENAAAVLVHLCSG+Q H+VEAQ LG+
Sbjct  543  AILSSHPEGKAAIGAADAVPVLVDVIANGSPRNKENAAAVLVHLCSGDQHHLVEAQRLGL  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +GPL+DL QNGTERGRRKA QLLE++NR 
Sbjct  603  IGPLMDLVQNGTERGRRKATQLLERMNRL  631



>ref|XP_008466866.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis melo]
Length=511

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEP   MVDEALAIL
Sbjct  324  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPGTGMVDEALAIL  383

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSG-EQHVVEAQELGI  332
            AILASHPEGK AI  AKAV VLV VI  GSPRN+ENAAAVLVHLCSG EQH+VEA+ELG+
Sbjct  384  AILASHPEGKAAIRSAKAVPVLVDVIGTGSPRNRENAAAVLVHLCSGDEQHLVEARELGV  443

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +  L+DLA+NGT+RG+RKAAQLLE+INR 
Sbjct  444  ISSLIDLARNGTDRGKRKAAQLLERINRL  472



>ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 ref|XP_006488304.1| PREDICTED: U-box domain-containing protein 13-like [Citrus sinensis]
 gb|ESR38047.1| hypothetical protein CICLE_v10027966mg [Citrus clementina]
 gb|KDO72884.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis]
Length=661

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM LLTEP G MVDEALAIL
Sbjct  484  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMHLLTEPGGGMVDEALAIL  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI NGSPRN+ENAAAVLVHLC+G+ Q++ EA+ELG+
Sbjct  544  AILSSHPEGKAAIGAAEAVPVLVEVIGNGSPRNRENAAAVLVHLCAGDQQYLAEAKELGV  603

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE+++RF
Sbjct  604  MGPLVDLAQNGTDRGKRKAAQLLERMSRF  632



>ref|XP_002534105.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF28280.1| Spotted leaf protein, putative [Ricinus communis]
Length=662

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTEP G MVDEALAIL
Sbjct  485  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAIL  544

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV VI NGSPRNKENAAAV+VHLC+G+Q H+ EAQELGI
Sbjct  545  AILASHPEGKSAIGAAEAVPVLVEVIGNGSPRNKENAAAVMVHLCAGDQKHLAEAQELGI  604

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQ GT+RG+RKA QLLE ++RF
Sbjct  605  MGPLVDLAQTGTDRGKRKARQLLECMSRF  633


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 58/142 (41%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  + AG VP ++ +L +             
Sbjct  403  VDLLSTPDSRTQEHAVTALLNLSICEDNKGSIISAGAVPGIVHVLKK-------------  449

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  450  ----------------------------GSMEARENAAATLFSLSVVDENKVTIGSSGAI  481

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  482  PPLVTLLSEGTQRGKKDAATAL  503



>gb|KHN32120.1| U-box domain-containing protein 13 [Glycine soja]
Length=662

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGSQRGKKDAATALFNLCIYQGNKGKAVRAGV+PTLM+LLTEP G MVDEALAIL
Sbjct  483  VTLLSEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGKV I  ++AV VLV  I NGSPRNKENAAAVLVHLCSG+ Q++ +AQELG+
Sbjct  543  AILASHPEGKVTIRASEAVPVLVEFIGNGSPRNKENAAAVLVHLCSGDQQYLAQAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLL+LAQNGT+RG+RKA QLLE+++R 
Sbjct  603  MGPLLELAQNGTDRGKRKAGQLLERMSRL  631


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 61/142 (43%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+    R ++ A TAL NL IY+ NKG  V +G VP ++ +L +             
Sbjct  401  VSLLSVPDSRTQEHAVTALLNLSIYENNKGSIVSSGAVPGIVHVLKK-------------  447

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  448  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGSLGAI  479

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   G++RG++ AA  L
Sbjct  480  PPLVTLLSEGSQRGKKDAATAL  501



>gb|KHG05758.1| U-box domain-containing 13 -like protein [Gossypium arboreum]
Length=669

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 137/149 (92%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVP LM+LLTEP G MVDEALAIL
Sbjct  483  VVLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPILMRLLTEPGGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLVGVI NGSPRN+EN AAVLVHLCSG+ QH+ EAQELG+
Sbjct  543  AILASHPEGKSAIGAAEAVPVLVGVIGNGSPRNRENGAAVLVHLCSGDQQHLAEAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
             GPL+DLAQNGT+RG+RKAAQLLE++NRF
Sbjct  603  KGPLVDLAQNGTDRGKRKAAQLLERMNRF  631



>ref|XP_003537996.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max]
 gb|KHN21961.1| U-box domain-containing protein 13 [Glycine soja]
Length=661

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGV+PTLM+LLTEP G MVDEALAIL
Sbjct  482  VTLLSEGNQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK  I  ++AV VLV  I NGSPRNKENAAAVLVHLCSG+ Q++ +AQELG+
Sbjct  542  AILASHPEGKATIRASEAVPVLVEFIGNGSPRNKENAAAVLVHLCSGDQQYLAQAQELGV  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLL+LAQNGT+RG+RKA QLLE+++R 
Sbjct  602  MGPLLELAQNGTDRGKRKAGQLLERMSRL  630


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL IY+ NKG  V +G VP ++ +L +             
Sbjct  400  VGLLSVPDSRTQEHAVTALLNLSIYENNKGSIVSSGAVPGIVHVLKK-------------  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  447  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGSLGAI  478

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   G +RG++ AA  L
Sbjct  479  PPLVTLLSEGNQRGKKDAATAL  500



>ref|XP_002298363.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE83168.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=663

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG++RGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM LLTE  G MVDEALAIL
Sbjct  486  VTLLSEGTRRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMCLLTETGGGMVDEALAIL  545

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK  IG A+AV VLV VI NGSPRN+ENAAAVLVHLCSG+Q H+VEAQE G+
Sbjct  546  AILASHPEGKATIGAAEAVPVLVEVIRNGSPRNRENAAAVLVHLCSGDQKHMVEAQEHGV  605

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKA QLLE+I+RF
Sbjct  606  MGPLVDLAQNGTDRGKRKAQQLLERISRF  634



>ref|XP_011000261.1| PREDICTED: U-box domain-containing protein 13-like [Populus euphratica]
Length=665

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCI+QGNKGKAVRAGVVPTLM LLTE  G MVDEALAIL
Sbjct  488  VTLLSEGTQRGKKDAATALFNLCIFQGNKGKAVRAGVVPTLMCLLTETGGGMVDEALAIL  547

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASHPEGK  IG A+AV VLV VI NGSPRN+ENAAAVLVHLCSG+Q H+VEAQE G+
Sbjct  548  AILASHPEGKATIGAAEAVPVLVEVIRNGSPRNRENAAAVLVHLCSGDQKHMVEAQEHGV  607

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKA QLLE+I+RF
Sbjct  608  MGPLVDLAQNGTDRGKRKAQQLLERISRF  636



>ref|XP_007132072.1| hypothetical protein PHAVU_011G064700g [Phaseolus vulgaris]
 gb|ESW04066.1| hypothetical protein PHAVU_011G064700g [Phaseolus vulgaris]
Length=670

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGV+PTLM+LLTEP G MVDEALAIL
Sbjct  491  VILLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAIL  550

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHP+GK  I  A+AV VLV  I NGSPRNKENAAAVLVHLCSG+ Q++ +AQELG+
Sbjct  551  AILASHPDGKATIRAAEAVPVLVEFIGNGSPRNKENAAAVLVHLCSGDQQYLAQAQELGV  610

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPLL+LAQNGT+RG+RKAAQLLE+I+R 
Sbjct  611  MGPLLELAQNGTDRGKRKAAQLLERISRL  639


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL IY+ NKG  V +G VP ++ +L +             
Sbjct  409  VGLLSVPDSRTQEHAVTALLNLSIYENNKGSIVSSGAVPGIVHVLKK-------------  455

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  456  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGSSGAI  487

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  488  PPLVILLSEGTQRGKKDAATAL  509



>ref|XP_004505870.1| PREDICTED: U-box domain-containing protein 13-like [Cicer arietinum]
Length=661

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGV+PTLM+LLTEP G MVDEALAIL
Sbjct  481  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPTGGMVDEALAIL  540

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHP+GK AIG A+AV VLV  I NGSPRNKENAAAVLVHLCSG+ Q++V+AQELG+
Sbjct  541  AILASHPDGKAAIGAAEAVPVLVEFIGNGSPRNKENAAAVLVHLCSGDRQYLVQAQELGV  600

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M PLL+LAQNGT+RG+RKA QL+E+++RF
Sbjct  601  MAPLLELAQNGTDRGKRKATQLIERMSRF  629


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 58/142 (41%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL IY+ NKG  V +G VP ++ +L               
Sbjct  399  VGLLSVPDSRTQEHAVTALLNLSIYESNKGSIVSSGAVPGIVHVL---------------  443

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  444  --------------------------KRGSMEARENAAATLFSLSVIDENKVTIGSSGAI  477

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  478  SPLVTLLSEGTQRGKKDAATAL  499



>ref|XP_002313440.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE87395.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=663

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM+LLTE  G MVDEA+AIL
Sbjct  486  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTETGGGMVDEAMAIL  545

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASH EGK  IG A+AV VLV VI NGSPRN+ENAAAVLVHLCSG+Q H+VEAQE G+
Sbjct  546  AILASHSEGKAIIGAAEAVPVLVEVIRNGSPRNRENAAAVLVHLCSGDQKHLVEAQEHGV  605

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKA QLLE+I+RF
Sbjct  606  MGPLVDLAQNGTDRGKRKAQQLLERISRF  634


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG VP ++ +L +             
Sbjct  404  VGLLSTPDSRTQEHAITALLNLSICEENKGSIVSAGAVPGIVHVLKK-------------  450

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  451  ----------------------------GSMEARENAAATLFSLSVVDENKVTIGSLGAI  482

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  483  PPLVTLLSEGTQRGKKDAATAL  504



>ref|XP_010426083.1| PREDICTED: U-box domain-containing protein 13 [Camelina sativa]
Length=655

 Score =   218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  480  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  539

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  GSPRNKENAAAVLVHLCSG+ QH+VEAQ+LG+
Sbjct  540  AILSSHPEGKAIIGSSDAVPSLVQFIRTGSPRNKENAAAVLVHLCSGDPQHLVEAQKLGL  599

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA+NGT+RG+RKAAQLLE+I+R 
Sbjct  600  MGPLIDLAENGTDRGKRKAAQLLERISRL  628


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ + TAL NL I + NKG  V AG +P ++Q+L +             
Sbjct  398  VGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKK-------------  444

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  445  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGALGAI  476

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  477  PPLVVLLNEGTQRGKKDAATAL  498



>gb|KEH30143.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=662

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGV+PTLM+LLTEP G MVDEALAIL
Sbjct  481  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVIPTLMRLLTEPSGGMVDEALAIL  540

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV  I NGSPRNKENAAAVLVHLCSG+ Q++ +AQELG+
Sbjct  541  AILASHPEGKAAIGAAEAVPVLVKFIGNGSPRNKENAAAVLVHLCSGDRQYIAQAQELGV  600

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M PLL+LAQNGT+RG+RKA QL+E+++R 
Sbjct  601  MAPLLELAQNGTDRGKRKATQLIERMSRI  629


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 58/142 (41%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL IY+ NKG  V +G VP ++ +L               
Sbjct  399  VGLLSVPDSRTQEHAVTALLNLSIYESNKGSIVSSGAVPGIVHVLKR-------------  445

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  446  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGSSGAI  477

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  478  SPLVTLLSEGTQRGKKDAATAL  499



>ref|XP_010503261.1| PREDICTED: U-box domain-containing protein 13-like [Camelina 
sativa]
Length=657

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  482  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  G+PRNKENAAAVLVHLCSG+ QH+VEAQ+LG+
Sbjct  542  AILSSHPEGKAIIGSSDAVPSLVAFIRTGTPRNKENAAAVLVHLCSGDPQHLVEAQKLGL  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA+NGT+RG+RKAAQLLE+I+R 
Sbjct  602  MGPLIDLAENGTDRGKRKAAQLLERISRL  630


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ + TAL NL I + NKG  V AG +P ++Q+L +             
Sbjct  400  VGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKK-------------  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  447  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGALGAI  478

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  479  PPLVVLLNEGTQRGKKDAATAL  500



>gb|KJB20104.1| hypothetical protein B456_003G133100 [Gossypium raimondii]
Length=539

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGK VRAGV+PTLM+LLTEP G MVDEALAIL
Sbjct  364  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKTVRAGVIPTLMRLLTEPGGGMVDEALAIL  423

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPE K AIG AKA+ VLV  I NG PRNKENAAAVLVHLC+G+ QH+ +A+ELG+
Sbjct  424  AILASHPEAKFAIGAAKAMPVLVDFIGNGLPRNKENAAAVLVHLCAGDQQHLADAEELGV  483

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L+DLAQNGT+RG+RKAAQLL++++RF
Sbjct  484  MGHLVDLAQNGTDRGKRKAAQLLQRLSRF  512


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V +L+    R ++ A TAL NL I + NKG  + +G VP ++Q+L +             
Sbjct  282  VKILSTPDSRTQEHAVTALLNLSICEDNKGSIISSGAVPGIVQVLKK-------------  328

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  329  ----------------------------GSMEARENAAATLFSLSVVDENKVAIGASGAI  360

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  361  PPLVTLLSEGTQRGKKDAATAL  382



>ref|XP_008784531.1| PREDICTED: protein spotted leaf 11-like [Phoenix dactylifera]
Length=674

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 138/151 (91%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+EGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLM LLTEP G MVDEALAIL
Sbjct  483  VSLLSEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMGLLTEPGGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK+AIG A+AV VLV VI +GSPRNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  543  AILSSHPEGKLAIGAAEAVPVLVKVIRSGSPRNKENAAAVLVHLCNGEQQQQHLAEAQER  602

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            G+MGPL +LAQ+GT+RG+RKAAQLLE++NRF
Sbjct  603  GVMGPLEELAQSGTDRGKRKAAQLLERMNRF  633



>ref|XP_009353692.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Pyrus x bretschneideri]
Length=564

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM+LLTEP G MVDEALAIL
Sbjct  386  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAIL  445

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SH EGK AIG A+AV VLV VI  GSPRN+ENAAAVLVHLCSG+ QH+VEAQELG+
Sbjct  446  AILSSHGEGKAAIGAAEAVPVLVEVIGTGSPRNRENAAAVLVHLCSGDQQHIVEAQELGV  505

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  LL+LAQNGT+RG+RKAAQLLE++NRF
Sbjct  506  MTLLLELAQNGTDRGKRKAAQLLERMNRF  534



>ref|XP_008385130.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
Length=693

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM+LLTEP G MVDEALAIL
Sbjct  513  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAIL  572

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SH EGK AIG A+AV VLV VI  GSPRN+ENAAAVLVHLCSG+ QH+VEAQELG+
Sbjct  573  AILSSHAEGKAAIGAAEAVPVLVEVIGTGSPRNRENAAAVLVHLCSGDQQHIVEAQELGV  632

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  LL+LAQNGT+RG+RKAAQLLE++NRF
Sbjct  633  MTSLLELAQNGTDRGKRKAAQLLERMNRF  661



>gb|KFK33987.1| hypothetical protein AALP_AA5G087000 [Arabis alpina]
Length=661

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  482  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  GSPRN+ENAAAVLVHLCSG+ QH+VEAQ+LG+
Sbjct  542  AILSSHPEGKTIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSGDPQHLVEAQKLGL  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  602  MGPLIDLAGNGTDRGKRKAAQLLERISRL  630


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ + TAL NL I + NKG  V AG +P ++Q+L +             
Sbjct  400  VGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKK-------------  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  447  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGALGAI  478

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  479  PPLVVLLNEGTQRGKKDAATAL  500



>ref|XP_002877490.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH53749.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=660

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  482  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  GSPRN+ENAAAVLVHLCSG+ QH+VEAQ+LG+
Sbjct  542  AILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSGDPQHLVEAQKLGL  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  602  MGPLIDLAGNGTDRGKRKAAQLLERISRL  630


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ + TAL NL I + NKG  V AG +P ++Q+L +             
Sbjct  400  VGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKK-------------  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  447  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGALGAI  478

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  479  PPLVVLLNEGTQRGKKDAATAL  500



>ref|XP_006290265.1| hypothetical protein CARUB_v10016804mg [Capsella rubella]
 gb|EOA23163.1| hypothetical protein CARUB_v10016804mg [Capsella rubella]
Length=657

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  482  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  GSPRN+ENAAAVLVHLCSG+ QH+VEAQ+LG+
Sbjct  542  AILSSHPEGKSIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSGDPQHLVEAQKLGL  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  602  MGPLIDLAGNGTDRGKRKAAQLLERISRL  630


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ + TAL NL I + NKG  V AG +P ++Q+L +             
Sbjct  400  VGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKK-------------  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  447  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGALGAI  478

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  479  PPLVVLLNEGTQRGKKDAATAL  500



>ref|NP_190235.1| U-box domain-containing protein 13 [Arabidopsis thaliana]
 sp|Q9SNC6.1|PUB13_ARATH RecName: Full=U-box domain-containing protein 13; AltName: Full=Plant 
U-box protein 13 [Arabidopsis thaliana]
 emb|CAB62321.1| arm repeat containing protein homolog [Arabidopsis thaliana]
 gb|AAK68731.1| arm repeat containing protein homolog [Arabidopsis thaliana]
 gb|AAM91213.1| arm repeat containing protein homolog [Arabidopsis thaliana]
 gb|AEE78167.1| U-box domain-containing protein 13 [Arabidopsis thaliana]
Length=660

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  482  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  GSPRN+ENAAAVLVHLCSG+ QH+VEAQ+LG+
Sbjct  542  AILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSGDPQHLVEAQKLGL  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  602  MGPLIDLAGNGTDRGKRKAAQLLERISRL  630


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ + TAL NL I + NKG  V AG +P ++Q+L +             
Sbjct  400  VGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKK-------------  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  447  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGALGAI  478

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  479  PPLVVLLNEGTQRGKKDAATAL  500



>ref|XP_009353694.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Pyrus x bretschneideri]
Length=661

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM+LLTEP G MVDEALAIL
Sbjct  483  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SH EGK AIG A+AV VLV VI  GSPRN+ENAAAVLVHLCSG+ QH+VEAQELG+
Sbjct  543  AILSSHGEGKAAIGAAEAVPVLVEVIGTGSPRNRENAAAVLVHLCSGDQQHIVEAQELGV  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  LL+LAQNGT+RG+RKAAQLLE++NRF
Sbjct  603  MTLLLELAQNGTDRGKRKAAQLLERMNRF  631



>gb|KJB20105.1| hypothetical protein B456_003G133100 [Gossypium raimondii]
Length=660

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGK VRAGV+PTLM+LLTEP G MVDEALAIL
Sbjct  485  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKTVRAGVIPTLMRLLTEPGGGMVDEALAIL  544

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPE K AIG AKA+ VLV  I NG PRNKENAAAVLVHLC+G+ QH+ +A+ELG+
Sbjct  545  AILASHPEAKFAIGAAKAMPVLVDFIGNGLPRNKENAAAVLVHLCAGDQQHLADAEELGV  604

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L+DLAQNGT+RG+RKAAQLL++++RF
Sbjct  605  MGHLVDLAQNGTDRGKRKAAQLLQRLSRF  633


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V +L+    R ++ A TAL NL I + NKG  + +G VP ++Q+L +             
Sbjct  403  VKILSTPDSRTQEHAVTALLNLSICEDNKGSIISSGAVPGIVQVLKK-------------  449

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V     G +
Sbjct  450  ----------------------------GSMEARENAAATLFSLSVVDENKVAIGASGAI  481

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  482  PPLVTLLSEGTQRGKKDAATAL  503



>ref|XP_006418891.1| hypothetical protein EUTSA_v10002430mg [Eutrema salsugineum]
 gb|ESQ37327.1| hypothetical protein EUTSA_v10002430mg [Eutrema salsugineum]
Length=661

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  482  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  GSPRN+ENAAAVLVHLCSG+ QH+VEAQ+LG+
Sbjct  542  AILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSGDPQHLVEAQKLGL  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I R 
Sbjct  602  MGPLIDLAGNGTDRGKRKAAQLLERIRRL  630


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ + TAL NL I + NKG  V AG +P ++Q+L +             
Sbjct  400  VGLLSTPDSRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKK-------------  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  447  ----------------------------GSMEARENAAATLFSLSVIDENKVTIGALGAI  478

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  479  PPLVVLLNEGTQRGKKDAATAL  500



>ref|XP_008357448.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
Length=671

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM+LLTEP G MVDEALAIL
Sbjct  491  VKLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAIL  550

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI  GSPRN+ENAAAVLVHLCSG+ QH++EAQ+LG+
Sbjct  551  AILSSHPEGKAAIGAAEAVPVLVEVIGTGSPRNRENAAAVLVHLCSGDQQHIIEAQKLGV  610

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  LL+LAQNGT+RG+RKAAQLLE++NRF
Sbjct  611  MSLLLELAQNGTDRGKRKAAQLLERVNRF  639



>ref|XP_004294506.1| PREDICTED: U-box domain-containing protein 13 [Fragaria vesca 
subsp. vesca]
Length=676

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM+LLTE  G MVDEALAIL
Sbjct  482  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMELLTETGGGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK AIG A+AV VLV VI  GSPRN+ENAAAVLVHLCSG+ Q++V+AQELG+
Sbjct  542  AILASHPEGKAAIGAAEAVPVLVEVIGTGSPRNRENAAAVLVHLCSGDPQYMVDAQELGV  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  LLDL+QNGT+RG+RKAAQLLE++NRF
Sbjct  602  MDSLLDLSQNGTDRGKRKAAQLLERMNRF  630



>ref|XP_010535503.1| PREDICTED: U-box domain-containing protein 13 [Tarenaya hassleriana]
Length=667

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLN G+ RGKKDAATALFNLCIYQGNKGKA+RAGV+PTLM+LLTEP   MVDEALAIL
Sbjct  487  VVLLNAGTHRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLMRLLTEPGSGMVDEALAIL  546

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG ++AV  LV  I  GSPRN+ENAAAVLVHLCSG+ QH+VEAQ+LG+
Sbjct  547  AILSSHPEGKSIIGSSEAVPFLVEFIRTGSPRNRENAAAVLVHLCSGDQQHLVEAQKLGL  606

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M PL+DLAQNGT+RG+RKAAQLLE+I+R 
Sbjct  607  MAPLIDLAQNGTDRGKRKAAQLLERISRL  635



>gb|KHG02811.1| U-box domain-containing 13 -like protein [Gossypium arboreum]
Length=676

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKGK VRAGV+PTLM LLTEP G MVDEALAIL
Sbjct  503  VTLLSEGTQRGKKDAATALFNLCIYQGNKGKTVRAGVIPTLMHLLTEPGGGMVDEALAIL  562

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPE K AIG AKA+ VLV  I NG PRN+ENAAAVLVHLC+G+ QH+ EA+ELG+
Sbjct  563  AILASHPEAKSAIGAAKAMPVLVDFIGNGLPRNRENAAAVLVHLCAGDQQHLAEAEELGV  622

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+DLAQNGT+RG+RKAAQLL++++RF
Sbjct  623  MSHLVDLAQNGTDRGKRKAAQLLQRLSRF  651



>ref|XP_010920613.1| PREDICTED: protein spotted leaf 11-like [Elaeis guineensis]
Length=682

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 138/151 (91%), Gaps = 4/151 (3%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+EGSQRGKKDAATALFNLCIYQGNKGKA+RAGVVPTLM LLTEP G MVDEALAIL
Sbjct  488  VSLLSEGSQRGKKDAATALFNLCIYQGNKGKAIRAGVVPTLMGLLTEP-GGMVDEALAIL  546

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK+AIG A+AV VLV VI +GSPRNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  547  AILSSHPEGKLAIGAAEAVPVLVDVIRSGSPRNKENAAAVLVHLCNGEQQQQHLAEAQEC  606

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            G+MGPL +LAQ+GT+RG+RKAAQLLE++NRF
Sbjct  607  GVMGPLEELAQSGTDRGKRKAAQLLERMNRF  637



>ref|XP_009150335.1| PREDICTED: U-box domain-containing protein 13 [Brassica rapa]
Length=658

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  479  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  538

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  GSPRN+ENAAAVLVHLCS + QH+VEAQ+LG+
Sbjct  539  AILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSVDPQHLVEAQKLGL  598

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  599  MGPLIDLAGNGTDRGKRKAAQLLERISRL  627



>emb|CDX68379.1| BnaC01g24570D [Brassica napus]
Length=658

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+QRGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  479  VVLLNEGTQRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  538

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGK  IG + AV  LV  I  GSPRN+ENAAAVLVHLCS + QH+VEAQ+LG+
Sbjct  539  AILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSVDPQHLVEAQKLGL  598

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  599  MGPLIDLAGNGTDRGKRKAAQLLERISRL  627



>ref|XP_010033135.1| PREDICTED: U-box domain-containing protein 13 isoform X2 [Eucalyptus 
grandis]
Length=563

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRA +VPTLM+LLTEP+  M+DEALAIL
Sbjct  386  VALLSEGTQRGKKDAATALFNLCIYQGNKGKAVRASIVPTLMRLLTEPEATMMDEALAIL  445

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASH EGK AIG A+AV VLV  I   SPRN+ENAAA+L HLCS +Q H+V+AQELG+
Sbjct  446  AILASHSEGKAAIGAAEAVPVLVEFIGRVSPRNRENAAAILAHLCSADQRHLVKAQELGV  505

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE+I+R+
Sbjct  506  MGPLMDLAQNGTDRGKRKAAQLLERISRY  534



>ref|XP_009343828.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
 ref|XP_009343833.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
Length=672

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVV TLM+LLTEP G MVDEALAIL
Sbjct  492  VKLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVSTLMKLLTEPGGGMVDEALAIL  551

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SH EGK AIG A+AV VLV VI  GSPRN+ENAAAVLVHLCSG+ QH++EAQ+LG+
Sbjct  552  AILSSHHEGKAAIGAAEAVPVLVEVIGTGSPRNRENAAAVLVHLCSGDQQHIIEAQKLGV  611

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +  LL+LAQNGT+RG+RKAAQLLE++NRF
Sbjct  612  VSLLLELAQNGTDRGKRKAAQLLERMNRF  640



>emb|CDX99112.1| BnaA06g18030D [Brassica napus]
Length=655

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+ RGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  476  VVLLNEGTHRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  535

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK  IG   AV  LV  I  GSPRN+ENAAAVLVHL S + QH+VEAQ+LG+
Sbjct  536  AILASHPEGKSIIGSLDAVPSLVEFIRTGSPRNRENAAAVLVHLSSNDPQHLVEAQKLGL  595

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  596  MGPLIDLAGNGTDRGKRKAAQLLERISRL  624



>ref|XP_010033134.1| PREDICTED: U-box domain-containing protein 13 isoform X1 [Eucalyptus 
grandis]
 gb|KCW52690.1| hypothetical protein EUGRSUZ_J02058 [Eucalyptus grandis]
Length=667

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRA +VPTLM+LLTEP+  M+DEALAIL
Sbjct  490  VALLSEGTQRGKKDAATALFNLCIYQGNKGKAVRASIVPTLMRLLTEPEATMMDEALAIL  549

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASH EGK AIG A+AV VLV  I   SPRN+ENAAA+L HLCS +Q H+V+AQELG+
Sbjct  550  AILASHSEGKAAIGAAEAVPVLVEFIGRVSPRNRENAAAILAHLCSADQRHLVKAQELGV  609

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLAQNGT+RG+RKAAQLLE+I+R+
Sbjct  610  MGPLMDLAQNGTDRGKRKAAQLLERISRY  638



>ref|XP_009149975.1| PREDICTED: U-box domain-containing protein 13-like [Brassica 
rapa]
Length=651

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+ RGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTEP   MVDEALAIL
Sbjct  472  VVLLNEGTHRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTEPGSGMVDEALAIL  531

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK  IG   AV  LV  I  GSPRN+ENAAAVLVHL S + QH+VEAQ+LG+
Sbjct  532  AILASHPEGKSIIGSLDAVPSLVEFIRTGSPRNRENAAAVLVHLSSNDPQHLVEAQKLGL  591

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  592  MGPLIDLAGNGTDRGKRKAAQLLERISRL  620



>ref|XP_010521829.1| PREDICTED: U-box domain-containing protein 12 isoform X2 [Tarenaya 
hassleriana]
Length=477

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LLTEP G MVDEALAIL
Sbjct  303  VTLLSEGTQRGKKDAATALFNLCIFQGNKGKAVRAGLVPELMRLLTEPDGGMVDEALAIL  362

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL+SHPEGKVAIG A AV VLV  I NG  RNKENAAAVLVHLCS +Q H+VE Q+LGI
Sbjct  363  AILSSHPEGKVAIGSANAVPVLVEFIRNGLARNKENAAAVLVHLCSWDQSHLVEVQKLGI  422

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+++A++ T+RG+RKA QLL++I+RF
Sbjct  423  MGPLIEMAESSTDRGKRKAGQLLDRISRF  451


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG+ V +G VP ++Q+L               
Sbjct  221  VKLLSTPDSRTQEHAVTALLNLSICEANKGRIVTSGAVPGIVQVL---------------  265

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  266  --------------------------RRGSMEARENAAATLFSLSVMDENKVTIGSLGAI  299

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  300  PPLVTLLSEGTQRGKKDAATAL  321



>emb|CDX86080.1| BnaC03g55950D [Brassica napus]
Length=656

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEG+ RGKKDAATALFNLCIYQGNKGKA+RAGV+PTL +LLTE    MVDEALAIL
Sbjct  477  VVLLNEGTHRGKKDAATALFNLCIYQGNKGKAIRAGVIPTLTRLLTETGSGMVDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK  IG   AV  LV  I +GSPRN+ENAAAVLVHL S + QH+VEAQ+LG+
Sbjct  537  AILASHPEGKSIIGSLDAVPSLVEFIRSGSPRNRENAAAVLVHLSSTDPQHLVEAQKLGL  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+DLA NGT+RG+RKAAQLLE+I+R 
Sbjct  597  MGPLIDLAGNGTDRGKRKAAQLLERISRL  625



>ref|XP_002881013.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57272.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=652

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGSQRGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LLTEP+  MVDEALAIL
Sbjct  485  VTLLSEGSQRGKKDAATALFNLCIFQGNKGKAVRAGLVPVLMRLLTEPESGMVDEALAIL  544

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AIL+SHP+GK  +  A  V V+V  I NGSPRNKENAAAVLVHLCS  +QH++EAQ+LGI
Sbjct  545  AILSSHPDGKSVVAAADPVPVMVDFIRNGSPRNKENAAAVLVHLCSWNQQHLIEAQKLGI  604

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+RG+RKAAQLL + + F
Sbjct  605  MSLLIEMAENGTDRGKRKAAQLLNRFSHF  633



>ref|XP_004150186.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
 gb|KGN65711.1| hypothetical protein Csa_1G505960 [Cucumis sativus]
Length=671

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKG+AVRAGVVPTLMQLLT P   MVDEALAIL
Sbjct  485  VTLLSEGTQRGKKDAATALFNLCIYQGNKGRAVRAGVVPTLMQLLT-PGTGMVDEALAIL  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSG-EQHVVEAQELGI  332
            AILASH EGK AI  AKAV VLV VI  GSPRN+ENAAAVLVHLCSG EQ +VEA+ELG+
Sbjct  544  AILASHSEGKGAIRSAKAVPVLVDVIGTGSPRNRENAAAVLVHLCSGDEQLLVEARELGV  603

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +  L+DLA+NGT+RG+RKAAQLLE+INR 
Sbjct  604  ISSLIDLARNGTDRGKRKAAQLLERINRL  632



>ref|XP_004167730.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
13-like [Cucumis sativus]
Length=671

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCIYQGNKG+AVRAGVVPTLMQLLT P   MVDEALAIL
Sbjct  485  VTLLSEGTQRGKKDAATALFNLCIYQGNKGRAVRAGVVPTLMQLLT-PGTGMVDEALAIL  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSG-EQHVVEAQELGI  332
            AILASH EGK AI  AKAV VLV VI  GSPRN+ENAAAVLVHLCSG EQ +VEA+ELG+
Sbjct  544  AILASHSEGKGAIRSAKAVPVLVDVIGTGSPRNRENAAAVLVHLCSGDEQLLVEARELGV  603

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +  L+DLA+NGT+RG+RKAAQLLE+INR 
Sbjct  604  ISSLIDLARNGTDRGKRKAAQLLERINRL  632



>ref|XP_010521828.1| PREDICTED: U-box domain-containing protein 12 isoform X1 [Tarenaya 
hassleriana]
Length=659

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+QRGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LLTEP G MVDEALAIL
Sbjct  485  VTLLSEGTQRGKKDAATALFNLCIFQGNKGKAVRAGLVPELMRLLTEPDGGMVDEALAIL  544

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL+SHPEGKVAIG A AV VLV  I NG  RNKENAAAVLVHLCS +Q H+VE Q+LGI
Sbjct  545  AILSSHPEGKVAIGSANAVPVLVEFIRNGLARNKENAAAVLVHLCSWDQSHLVEVQKLGI  604

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MGPL+++A++ T+RG+RKA QLL++I+RF
Sbjct  605  MGPLIEMAESSTDRGKRKAGQLLDRISRF  633


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG+ V +G VP ++Q+L               
Sbjct  403  VKLLSTPDSRTQEHAVTALLNLSICEANKGRIVTSGAVPGIVQVL---------------  447

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V    LG +
Sbjct  448  --------------------------RRGSMEARENAAATLFSLSVMDENKVTIGSLGAI  481

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   GT+RG++ AA  L
Sbjct  482  PPLVTLLSEGTQRGKKDAATAL  503



>emb|CDY31736.1| BnaA04g16720D [Brassica napus]
Length=642

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGS RGKKDA TALFNLCI+QGNKGKAVRAG+VP LM+LLTEP+G MVDEALAIL
Sbjct  476  VNLLSEGSHRGKKDAGTALFNLCIFQGNKGKAVRAGLVPVLMRLLTEPEGRMVDEALAIL  535

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGKV +G A AV  +V  I +GSPRNKENAAAVLV LCS + QH++EA++LG+
Sbjct  536  AILSSHPEGKVVVGAADAVPFMVDFIRSGSPRNKENAAAVLVQLCSWDPQHLIEAEKLGV  595

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L+D+A+NGT+RG+RKAAQLL + +RF
Sbjct  596  MGCLIDMAENGTDRGKRKAAQLLNRFSRF  624



>sp|Q9ZV31.1|PUB12_ARATH RecName: Full=U-box domain-containing protein 12; AltName: Full=Plant 
U-box protein 12 [Arabidopsis thaliana]
 gb|AAC79587.1| expressed protein [Arabidopsis thaliana]
 dbj|BAE98917.1| hypothetical protein [Arabidopsis thaliana]
Length=654

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGSQRGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LLTEP+  MVDE+L+IL
Sbjct  487  VTLLSEGSQRGKKDAATALFNLCIFQGNKGKAVRAGLVPVLMRLLTEPESGMVDESLSIL  546

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AIL+SHP+GK  +G A AV VLV  I +GSPRNKEN+AAVLVHLCS  +QH++EAQ+LGI
Sbjct  547  AILSSHPDGKSEVGAADAVPVLVDFIRSGSPRNKENSAAVLVHLCSWNQQHLIEAQKLGI  606

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+RG+RKAAQLL + +RF
Sbjct  607  MDLLIEMAENGTDRGKRKAAQLLNRFSRF  635



>gb|AAK59543.1| unknown protein [Arabidopsis thaliana]
Length=654

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGSQRGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LLTEP+  MVDE+L+IL
Sbjct  487  VTLLSEGSQRGKKDAATALFNLCIFQGNKGKAVRAGLVPVLMRLLTEPESGMVDESLSIL  546

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AIL+SHP+GK  +G A AV VLV  I +GSPRNKEN+AAVLVHLCS  +QH++EAQ+LGI
Sbjct  547  AILSSHPDGKSEVGAADAVPVLVDFIRSGSPRNKENSAAVLVHLCSWNQQHLIEAQKLGI  606

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+RG+RKAAQLL + +RF
Sbjct  607  MDLLIEMAENGTDRGKRKAAQLLNRFSRF  635



>ref|XP_008357382.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Malus domestica]
Length=307

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+Q GKKDAA ALFNLCIY GNKGKAVRAGVV TLM+LLTEP G MVDE LAIL
Sbjct  138  VTLLSEGTQGGKKDAAIALFNLCIYHGNKGKAVRAGVVSTLMKLLTEPGGGMVDEGLAIL  197

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQH-VVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI  GS RN+ENAAAVLV+LCSG+Q  +VEAQELG+
Sbjct  198  AILSSHPEGKAAIGAAEAVPVLVEVIGTGSLRNRENAAAVLVNLCSGDQQRIVEAQELGV  257

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               LL+LAQNGT+RG+RKAAQLLE +N F
Sbjct  258  TSSLLELAQNGTDRGKRKAAQLLELMNPF  286



>ref|XP_008357389.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Malus domestica]
Length=305

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+Q GKKDAA ALFNLCIY GNKGKAVRAGVV TLM+LLTEP G MVDE LAIL
Sbjct  136  VTLLSEGTQGGKKDAAIALFNLCIYHGNKGKAVRAGVVSTLMKLLTEPGGGMVDEGLAIL  195

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQH-VVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI  GS RN+ENAAAVLV+LCSG+Q  +VEAQELG+
Sbjct  196  AILSSHPEGKAAIGAAEAVPVLVEVIGTGSLRNRENAAAVLVNLCSGDQQRIVEAQELGV  255

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               LL+LAQNGT+RG+RKAAQLLE +N F
Sbjct  256  TSSLLELAQNGTDRGKRKAAQLLELMNPF  284



>ref|XP_009140947.1| PREDICTED: U-box domain-containing protein 12 [Brassica rapa]
Length=652

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDA TALFNLCI+QGNKGKAVRAG+VP LM+LLTEP+G MVDEALAIL
Sbjct  486  VNLLSEGSQRGKKDAGTALFNLCIFQGNKGKAVRAGLVPVLMRLLTEPEGRMVDEALAIL  545

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGKV +G A AV  +V  I +GSPRNKENAAAVLV LCS + QH++EA++LG+
Sbjct  546  AILSSHPEGKVVVGAADAVPFMVDFIRSGSPRNKENAAAVLVQLCSWDPQHLIEAEKLGV  605

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L+++A+NGT+RG+RKAAQLL + +RF
Sbjct  606  MGCLIEMAENGTDRGKRKAAQLLNRFSRF  634



>ref|XP_010685786.1| PREDICTED: U-box domain-containing protein 13 [Beta vulgaris 
subsp. vulgaris]
Length=664

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAG++PTLM+LLT+  G M+DEALAIL
Sbjct  485  VMLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGIIPTLMRLLTDTGGGMLDEALAIL  544

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AIG A A+ VLV VIANGSPRNKENAAAVLVHLCSG+  ++  AQELGI
Sbjct  545  AILASHTEGKAAIGSADALPVLVDVIANGSPRNKENAAAVLVHLCSGDPTYLASAQELGI  604

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  LL++ QNGT+RG+RKA QLL++INR 
Sbjct  605  MSHLLEMTQNGTDRGKRKAQQLLDRINRL  633



>gb|KFK26672.1| hypothetical protein AALP_AA8G277900 [Arabis alpina]
Length=607

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAATALFNLCI+QGNKGKAV AG+VP LMQ LTEP+  MVDE LAIL
Sbjct  441  VILLSEGSQRGKKDAATALFNLCIFQGNKGKAVAAGLVPVLMQSLTEPESRMVDEGLAIL  500

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AIL+SHPEGK+ IG A AV V+V  I +GSPRNKENAAAVLVHLCS  EQH++EA++LGI
Sbjct  501  AILSSHPEGKMVIGSADAVPVMVEFIRSGSPRNKENAAAVLVHLCSWNEQHLIEAEKLGI  560

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L+ +A+NGT+RG+RKAAQLL +  RF
Sbjct  561  MGLLIQMAENGTDRGKRKAAQLLNRFTRF  589



>ref|XP_008802759.1| PREDICTED: protein spotted leaf 11-like [Phoenix dactylifera]
Length=670

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVP LM LLTEP G MVDEALAIL
Sbjct  481  VSLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPLLMGLLTEPAGGMVDEALAIL  540

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ---HVVEAQEL  338
            AIL+SHPEGK A+G A+AV VLV VI +G+PRN+ENAAAVL+HLCSGEQ   ++  AQ+ 
Sbjct  541  AILSSHPEGKAALGAAEAVPVLVEVIRSGTPRNRENAAAVLLHLCSGEQQYHYLAMAQDC  600

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            G++GPL +LA NGT+RG+RKA QLLE+++RF
Sbjct  601  GVLGPLHELAMNGTDRGKRKAVQLLERMSRF  631



>ref|XP_009380658.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=673

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 131/151 (87%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAATALFNLCIYQGNKGKAVRAGV+ TLM LLT+P+ +M+DEALAI+
Sbjct  486  VLLLSEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVIQTLMGLLTDPEASMMDEALAIM  545

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK AI  A+A+ VL+ VI +GSPRNKENAAAVLVHLC+GE   QH+ E QE 
Sbjct  546  AILSSHPEGKAAITAAEALPVLIKVIRSGSPRNKENAAAVLVHLCNGEQQQQHLAELQEQ  605

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            G+M PL  + ++GT+RG+RKAAQLLE++NRF
Sbjct  606  GMMEPLFAMVESGTDRGKRKAAQLLERMNRF  636



>gb|KFK26673.1| hypothetical protein AALP_AA8G277900 [Arabis alpina]
Length=652

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAATALFNLCI+QGNKGKAV AG+VP LMQ LTEP+  MVDE LAIL
Sbjct  486  VILLSEGSQRGKKDAATALFNLCIFQGNKGKAVAAGLVPVLMQSLTEPESRMVDEGLAIL  545

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AIL+SHPEGK+ IG A AV V+V  I +GSPRNKENAAAVLVHLCS  EQH++EA++LGI
Sbjct  546  AILSSHPEGKMVIGSADAVPVMVEFIRSGSPRNKENAAAVLVHLCSWNEQHLIEAEKLGI  605

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L+ +A+NGT+RG+RKAAQLL +  RF
Sbjct  606  MGLLIQMAENGTDRGKRKAAQLLNRFTRF  634



>ref|NP_565676.4| U-box E3 ubiquitin ligase [Arabidopsis thaliana]
 gb|AEC08178.1| U-box E3 ubiquitin ligase [Arabidopsis thaliana]
Length=962

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGSQRGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LLTEP+  MVDE+L+IL
Sbjct  487  VTLLSEGSQRGKKDAATALFNLCIFQGNKGKAVRAGLVPVLMRLLTEPESGMVDESLSIL  546

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AIL+SHP+GK  +G A AV VLV  I +GSPRNKEN+AAVLVHLCS  +QH++EAQ+LGI
Sbjct  547  AILSSHPDGKSEVGAADAVPVLVDFIRSGSPRNKENSAAVLVHLCSWNQQHLIEAQKLGI  606

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+RG+RKAAQLL + +RF
Sbjct  607  MDLLIEMAENGTDRGKRKAAQLLNRFSRF  635



>ref|XP_006409917.1| hypothetical protein EUTSA_v10016364mg [Eutrema salsugineum]
 gb|ESQ51370.1| hypothetical protein EUTSA_v10016364mg [Eutrema salsugineum]
Length=551

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGS+RGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LL EP+  MVDEALA+L
Sbjct  385  VTLLSEGSRRGKKDAATALFNLCIFQGNKGKAVRAGLVPVLMRLLREPESGMVDEALAML  444

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AI++SHPEGK+ +G A AVAV+V  + +GSPRNKENAAAVLVHLCS  +QH++EA++LG+
Sbjct  445  AIVSSHPEGKIVVGTANAVAVMVDYVRSGSPRNKENAAAVLVHLCSWNQQHLIEAEKLGV  504

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+RG+RKAAQLL + +RF
Sbjct  505  MSLLIEMAENGTDRGKRKAAQLLNRFSRF  533



>ref|XP_010252136.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Nelumbo nucifera]
Length=534

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEGSQRGKKDAATALFNLCIYQGNKG+AVRAGVV TLM+LLTEP G MVDEALA+L
Sbjct  351  VALLNEGSQRGKKDAATALFNLCIYQGNKGRAVRAGVVSTLMRLLTEPGGGMVDEALAVL  410

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK+AIG A AV VLV VI +GSPRN+ENAAAVLVHLCSG+ +H+ EAQELG+
Sbjct  411  AILASHPEGKMAIGAAAAVPVLVEVIGSGSPRNRENAAAVLVHLCSGDPKHIAEAQELGL  470

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  LLDL QNGT+RG+RKAAQLL++I+RF
Sbjct  471  MDLLLDLVQNGTDRGKRKAAQLLDRISRF  499



>ref|XP_006409918.1| hypothetical protein EUTSA_v10016364mg [Eutrema salsugineum]
 gb|ESQ51371.1| hypothetical protein EUTSA_v10016364mg [Eutrema salsugineum]
Length=652

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGS+RGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LL EP+  MVDEALA+L
Sbjct  486  VTLLSEGSRRGKKDAATALFNLCIFQGNKGKAVRAGLVPVLMRLLREPESGMVDEALAML  545

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AI++SHPEGK+ +G A AVAV+V  + +GSPRNKENAAAVLVHLCS  +QH++EA++LG+
Sbjct  546  AIVSSHPEGKIVVGTANAVAVMVDYVRSGSPRNKENAAAVLVHLCSWNQQHLIEAEKLGV  605

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+RG+RKAAQLL + +RF
Sbjct  606  MSLLIEMAENGTDRGKRKAAQLLNRFSRF  634



>ref|XP_010470044.1| PREDICTED: U-box domain-containing protein 12-like [Camelina 
sativa]
Length=657

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP +M+LLTE    MVDEALAIL
Sbjct  491  VTLLSEGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPVIMRLLTETASGMVDEALAIL  550

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AI++SHP+GK+  G A AV V+V  I +GSPRNKENAAAVLVHLCS + QH++EAQ+LGI
Sbjct  551  AIISSHPDGKMVAGAADAVHVMVDFIRSGSPRNKENAAAVLVHLCSWDQQHLIEAQKLGI  610

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+R +RKAAQLL + +RF
Sbjct  611  MSLLIEMAENGTDREKRKAAQLLNRFSRF  639



>emb|CDX77213.1| BnaC04g40080D [Brassica napus]
Length=643

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDA TALFNLCI+QGNKGKAVRAG+VP LM+LLTEP+G MVDEALAIL
Sbjct  477  VNLLSEGSQRGKKDAGTALFNLCIFQGNKGKAVRAGLVPVLMRLLTEPEGRMVDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGKV +G A AVA +V  I +GSPRNKENAAAVLV LCS + Q+++EA++LG+
Sbjct  537  AILSSHPEGKVVVGAADAVAFMVDFIRSGSPRNKENAAAVLVQLCSWDPQYLIEAEKLGV  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            MG L+++A+NGT+RG+RKAAQLL   +RF
Sbjct  597  MGCLIEMAENGTDRGKRKAAQLLNCFSRF  625



>ref|XP_010252135.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Nelumbo nucifera]
Length=652

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEGSQRGKKDAATALFNLCIYQGNKG+AVRAGVV TLM+LLTEP G MVDEALA+L
Sbjct  469  VALLNEGSQRGKKDAATALFNLCIYQGNKGRAVRAGVVSTLMRLLTEPGGGMVDEALAVL  528

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK+AIG A AV VLV VI +GSPRN+ENAAAVLVHLCSG+ +H+ EAQELG+
Sbjct  529  AILASHPEGKMAIGAAAAVPVLVEVIGSGSPRNRENAAAVLVHLCSGDPKHIAEAQELGL  588

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  LLDL QNGT+RG+RKAAQLL++I+RF
Sbjct  589  MDLLLDLVQNGTDRGKRKAAQLLDRISRF  617



>ref|XP_010414478.1| PREDICTED: U-box domain-containing protein 12-like [Camelina 
sativa]
Length=929

 Score =   198 bits (504),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP +M+LLTE    MVDEALAIL
Sbjct  488  VTLLSEGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPVIMRLLTETASGMVDEALAIL  547

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AI++SHP+GK+  G A AV V+V  I +GSPRNKENAAAVLVHLCS + QH++EAQ+LGI
Sbjct  548  AIISSHPDGKMVAGAADAVHVMVDFIRSGSPRNKENAAAVLVHLCSWDQQHLIEAQKLGI  607

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+R +RKAAQLL + +RF
Sbjct  608  MSLLIEMAENGTDREKRKAAQLLNRFSRF  636



>gb|KCW85583.1| hypothetical protein EUGRSUZ_B02378 [Eucalyptus grandis]
Length=667

 Score =   196 bits (499),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG+QRGKKDAA ALFNLCIY+GNKGKAVRAG+VPTLMQLLTEP   M DEALA+L
Sbjct  484  VLLLDEGTQRGKKDAAAALFNLCIYRGNKGKAVRAGIVPTLMQLLTEPGVGMADEALAVL  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILASH +G+ AIG AKAV VLV +I  G P NKENAAA+LVHLC+GEQ H+ EA+ELGI
Sbjct  544  AILASHTKGRAAIGAAKAVPVLVEIIRVGFPWNKENAAAILVHLCAGEQHHLSEAKELGI  603

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL+DLAQNGT+RG+RKAAQLLE+++RF
Sbjct  604  VEPLVDLAQNGTDRGKRKAAQLLERLSRF  632



>ref|XP_009341425.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
Length=285

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+Q  KKDAA ALFNLCIY GNKGKAVRAGVV TLM++LTEP G MVDE LAIL
Sbjct  136  VTLLSEGTQGRKKDAAIALFNLCIYHGNKGKAVRAGVVSTLMKILTEPGGGMVDERLAIL  195

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI  GS RN+ENAAAVLV+LCS  +QH+VEAQELG+
Sbjct  196  AILSSHPEGKAAIGAAEAVPVLVEVIGTGSLRNRENAAAVLVNLCSEDQQHIVEAQELGV  255

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
            M  LL+LAQNGT+RG+RKAAQLLE
Sbjct  256  MSSLLELAQNGTDRGKRKAAQLLE  279



>ref|XP_009399873.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=673

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAATALFNLCIYQGNKGKAVRAGV+ TLM LLT+P+G M+DEALAI+
Sbjct  484  VLLLSEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVIHTLMGLLTDPEGAMMDEALAIM  543

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHP+GK AI   +A+ +LV VI +GSPRNKENAAAVLVHLC+GE   QH+ E QE 
Sbjct  544  AILSSHPDGKAAIRAVEALPMLVKVIRSGSPRNKENAAAVLVHLCNGEQQQQHLAELQEQ  603

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            G+M PL ++ ++GT RG+RKAAQLLE++ RF
Sbjct  604  GMMVPLQEMVESGTNRGKRKAAQLLEQMTRF  634


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL IY+ NKGK + +G VP ++ +L               
Sbjct  402  VNLLSMQDVRTQEHAVTALLNLSIYEENKGKIIVSGAVPGIVHVLK--------------  447

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ V   E G +
Sbjct  448  ---------------------------RGSMEARENAAATLFSLSVVDRNKVIIGESGAI  480

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
             PL+ L   G++RG++ AA  L
Sbjct  481  PPLVLLLSEGSQRGKKDAATAL  502



>ref|XP_010510574.1| PREDICTED: U-box domain-containing protein 12 [Camelina sativa]
Length=654

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EGS+RGKKDAATALFNLCI+QGNKGKAVRAG+VP +M+LLTE    MVDEALAIL
Sbjct  488  VTLLSEGSRRGKKDAATALFNLCIFQGNKGKAVRAGLVPVIMRLLTETTSGMVDEALAIL  547

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AI++SHP+GK+  G A AV V+V  I +GSPRNKENAAAVLVHLCS + QH++EAQ+LGI
Sbjct  548  AIISSHPDGKMVAGAADAVHVMVDFIRSGSPRNKENAAAVLVHLCSWDQQHLIEAQKLGI  607

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+R +RKAAQLL + +RF
Sbjct  608  MSLLIEMAENGTDREKRKAAQLLNRFSRF  636



>tpg|DAA44667.1| TPA: putative ARM repeat-containing protein containing family 
protein [Zea mays]
Length=726

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+ GSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP L++LL E +  MVDEALAIL
Sbjct  515  VQLLSNGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLMETESGMVDEALAIL  574

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+ HPEGK AIG A A+ VLVGVI NGSPRNKENAAAV+VHLCSGE   QH+ EAQE 
Sbjct  575  AILSGHPEGKTAIGAASAIPVLVGVIRNGSPRNKENAAAVMVHLCSGEQQQQHLAEAQEQ  634

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  635  GIVSLLEELAESGTDRGKRKAVQLLERMNRF  665



>ref|XP_006293619.1| hypothetical protein CARUB_v10022571mg [Capsella rubella]
 gb|EOA26517.1| hypothetical protein CARUB_v10022571mg [Capsella rubella]
Length=982

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAATALFNLCI+QGNKGKAVRAG+VP LM+LLTE    MVDEALAIL
Sbjct  485  VILLSEGSQRGKKDAATALFNLCIFQGNKGKAVRAGLVPVLMRLLTETSSGMVDEALAIL  544

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AI++SHP+GK  +G A AV V+V  I +GSPRNKENAAAVLVHLCS + QH+VEAQ+LGI
Sbjct  545  AIISSHPDGKTVVGAADAVHVMVEFIRSGSPRNKENAAAVLVHLCSWDQQHLVEAQKLGI  604

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            M  L+++A+NGT+RG+RKAAQLL + +R 
Sbjct  605  MSLLIEMAENGTDRGKRKAAQLLNRFSRL  633



>ref|XP_008647602.1| PREDICTED: uncharacterized protein LOC100502260 isoform X1 [Zea 
mays]
Length=794

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+ GSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP L++LL E +  MVDEALAIL
Sbjct  583  VQLLSNGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLMETESGMVDEALAIL  642

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+ HPEGK AIG A A+ VLVGVI NGSPRNKENAAAV+VHLCSGE   QH+ EAQE 
Sbjct  643  AILSGHPEGKTAIGAASAIPVLVGVIRNGSPRNKENAAAVMVHLCSGEQQQQHLAEAQEQ  702

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  703  GIVSLLEELAESGTDRGKRKAVQLLERMNRF  733



>ref|XP_009343842.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
Length=287

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL+EG+Q  KKDAA ALFNLCIY GNKGKAVRAGVV TLM++LTEP   MVDE LAIL
Sbjct  138  VTLLSEGTQGRKKDAAIALFNLCIYHGNKGKAVRAGVVSTLMKILTEPGDGMVDEGLAIL  197

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            AIL+SHPEGK AIG A+AV VLV VI  GS RN+ENAAAVLV+LCS  +QH+VEAQELG+
Sbjct  198  AILSSHPEGKAAIGAAEAVPVLVEVIGTGSFRNRENAAAVLVNLCSEDQQHIVEAQELGV  257

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
            M  LL+LAQNGT+RG+RKAAQLLE
Sbjct  258  MSSLLELAQNGTDRGKRKAAQLLE  281



>dbj|BAJ94942.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP L++LLTE +  MVDEALAIL
Sbjct  385  VLLLGNGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLTETESGMVDEALAIL  444

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK AI  A A+ +LVGVI NGS RNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  445  AILSSHPEGKAAISAAAAIPILVGVIRNGSSRNKENAAAVLVHLCNGEQQQQHLAEAQEQ  504

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  505  GIVTLLEELAESGTDRGKRKANQLLERMNRF  535



>ref|XP_004984736.1| PREDICTED: protein spotted leaf 11-like isoform X2 [Setaria italica]
Length=578

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+ GSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP L++LLTE +  MVDEALAIL
Sbjct  375  VQLLSNGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLTETESGMVDEALAIL  434

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+ HPEGK AIG A A+ VLVGVI NGS RNKENAAAV+VHLC+GE   QH+ EAQE 
Sbjct  435  AILSGHPEGKAAIGAASAIPVLVGVIRNGSARNKENAAAVMVHLCNGEQQQQHLAEAQEQ  494

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  495  GIVSLLEELAESGTDRGKRKAIQLLERMNRF  525



>gb|EMT15169.1| Protein spotted leaf 11 [Aegilops tauschii]
Length=611

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP L++LLTE +  MVDEALAIL
Sbjct  412  VLLLGNGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLTETESGMVDEALAIL  471

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK AI  A A+ +LVGVI NGS RNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  472  AILSSHPEGKAAISAAAAIPILVGVIRNGSSRNKENAAAVLVHLCNGEQQQQHLAEAQEQ  531

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  532  GIVTLLEELAESGTDRGKRKAIQLLERMNRF  562



>ref|XP_010922355.1| PREDICTED: protein spotted leaf 11-like [Elaeis guineensis]
Length=668

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 130/151 (86%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+EG+QRGKKDAATALFNLCIYQGNKGKAVRAGVVP LM L+ EP G MVDEALAIL
Sbjct  479  VSLLSEGTQRGKKDAATALFNLCIYQGNKGKAVRAGVVPLLMGLVIEPAGGMVDEALAIL  538

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ---HVVEAQEL  338
            AIL+SHPEGK+AIG A+AV VLV VI +GSPRN+EN AAVL+HLC GEQ   ++  AQ  
Sbjct  539  AILSSHPEGKLAIGAAEAVPVLVEVIRSGSPRNRENGAAVLLHLCGGEQQYHYLAMAQNC  598

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            G++GPL +LA NGT+RG+RKA QLLE+++RF
Sbjct  599  GVLGPLRELAINGTDRGKRKAVQLLERMSRF  629



>gb|EMS51624.1| E3 ubiquitin-protein ligase SPL11 [Triticum urartu]
Length=648

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP L++LLTE +  MVDEALAIL
Sbjct  449  VLLLGNGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLTETESGMVDEALAIL  508

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK AI  A A+ +LVGVI NGS RNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  509  AILSSHPEGKAAISAAAAIPILVGVIRNGSSRNKENAAAVLVHLCNGEQQQQHLAEAQEQ  568

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  569  GIVTLLEELAESGTDRGKRKAIQLLERMNRF  599



>ref|XP_004984735.1| PREDICTED: protein spotted leaf 11-like isoform X1 [Setaria italica]
Length=613

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+ GSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP L++LLTE +  MVDEALAIL
Sbjct  410  VQLLSNGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLTETESGMVDEALAIL  469

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+ HPEGK AIG A A+ VLVGVI NGS RNKENAAAV+VHLC+GE   QH+ EAQE 
Sbjct  470  AILSGHPEGKAAIGAASAIPVLVGVIRNGSARNKENAAAVMVHLCNGEQQQQHLAEAQEQ  529

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  530  GIVSLLEELAESGTDRGKRKAIQLLERMNRF  560



>ref|XP_008448400.1| PREDICTED: U-box domain-containing protein 13 [Cucumis melo]
Length=658

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LLNEG+QRGKKDAATALFNLC +QGNK KAVR GVV  LMQLLTE +  MVDEALAIL
Sbjct  480  IALLNEGTQRGKKDAATALFNLCFFQGNKIKAVRGGVVSILMQLLTESRIGMVDEALAIL  539

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILAS+ EG+ AIG A++V +LV +I  GSPRN+ENAAAVLVHLC G++ H+VEA+ELG+
Sbjct  540  AILASNSEGRAAIGAAESVPILVNLIGTGSPRNRENAAAVLVHLCMGDKRHLVEAKELGV  599

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +G L+D+A+NGT+RG+RKA QLL++INRF
Sbjct  600  IGLLMDMAENGTDRGKRKATQLLDQINRF  628



>ref|XP_006649845.1| PREDICTED: protein spotted leaf 11-like [Oryza brachyantha]
Length=725

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+ GSQRGK+DAATALFNLCIYQGNKGKAVRAG+VP L+ L+TE +  M+DEALAIL
Sbjct  519  VLLLSNGSQRGKRDAATALFNLCIYQGNKGKAVRAGLVPILLGLVTETESGMMDEALAIL  578

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK AI  A A+++LVGVI NGS RNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  579  AILSSHPEGKTAISSANAISMLVGVIRNGSARNKENAAAVLVHLCNGEQQQQHLAEAQEQ  638

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  639  GIVTLLEELAESGTDRGKRKAIQLLERMNRF  669



>ref|NP_001049711.1| Os03g0275900 [Oryza sativa Japonica Group]
 gb|ABF95255.1| Spotted leaf protein 11, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11625.1| Os03g0275900 [Oryza sativa Japonica Group]
 dbj|BAH00739.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58792.1| hypothetical protein OsJ_10327 [Oryza sativa Japonica Group]
Length=726

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+ GSQRGK+DAATALFNLCIYQGNKGKAVRAG++P L+ L+TE +  M+DEALAIL
Sbjct  518  VLLLSNGSQRGKRDAATALFNLCIYQGNKGKAVRAGLIPVLLGLVTETESGMMDEALAIL  577

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK AI  A A+ +LVGVI NGS RNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  578  AILSSHPEGKTAISSANAIPMLVGVIRNGSARNKENAAAVLVHLCNGEQQQQHLAEAQEQ  637

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  638  GIVTLLEELAKSGTDRGKRKAIQLLERMNRF  668



>gb|EEC74963.1| hypothetical protein OsI_10954 [Oryza sativa Indica Group]
Length=726

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+ GSQRGK+DAATALFNLCIYQGNKGKAVRAG++P L+ L+TE +  M+DEALAIL
Sbjct  518  VLLLSNGSQRGKRDAATALFNLCIYQGNKGKAVRAGLIPVLLGLVTETESGMMDEALAIL  577

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK AI  A A+ +LVGVI NGS RNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  578  AILSSHPEGKTAISSANAIPMLVGVIRNGSARNKENAAAVLVHLCNGEQQQQHLAEAQEQ  637

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GI+  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  638  GIVTLLEELAKSGTDRGKRKAIQLLERMNRF  668



>gb|ABG22055.1| Spotted leaf protein 11, putative, expressed [Oryza sativa Japonica 
Group]
Length=566

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  378  VVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  437

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQEL  338
            +IL+SHPEGK AIG A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE 
Sbjct  438  SILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQEC  497

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  498  GIMVPLRELALNGTDRGKRKAVQLLERMSRF  528



>gb|ABA99652.1| Spotted leaf protein 11, putative, expressed [Oryza sativa Japonica 
Group]
Length=575

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  378  VVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  437

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQEL  338
            +IL+SHPEGK AIG A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE 
Sbjct  438  SILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQEC  497

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  498  GIMVPLRELALNGTDRGKRKAVQLLERMSRF  528



>ref|XP_004163228.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
Length=657

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LLNEG+QRGKKDAATALFNLC +QGNK KAVR GVV  LMQLLTE +  MVDEALAIL
Sbjct  479  IALLNEGTQRGKKDAATALFNLCFFQGNKIKAVRGGVVSILMQLLTESRIGMVDEALAIL  538

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILA++ EG+ AIG A++V +LV +I  GSPRN+ENAAAVLVHLC G++ H+VEA+ELG+
Sbjct  539  AILANNSEGRAAIGAAESVPILVNLIGTGSPRNRENAAAVLVHLCMGDKRHLVEAKELGV  598

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +G L+D+A+NGT+RG+RKA QLL++INRF
Sbjct  599  IGLLVDMAENGTDRGKRKATQLLDQINRF  627



>ref|XP_004143106.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
 gb|KGN47162.1| hypothetical protein Csa_6G191020 [Cucumis sativus]
Length=657

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LLNEG+QRGKKDAATALFNLC +QGNK KAVR GVV  LMQLLTE +  MVDEALAIL
Sbjct  479  IALLNEGTQRGKKDAATALFNLCFFQGNKIKAVRGGVVSILMQLLTESRIGMVDEALAIL  538

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AILA++ EG+ AIG A++V +LV +I  GSPRN+ENAAAVLVHLC G++ H+VEA+ELG+
Sbjct  539  AILANNSEGRAAIGAAESVPILVNLIGTGSPRNRENAAAVLVHLCMGDKRHLVEAKELGV  598

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +G L+D+A+NGT+RG+RKA QLL++INRF
Sbjct  599  IGLLVDMAENGTDRGKRKATQLLDQINRF  627



>ref|XP_009421341.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=661

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL EGS RGKKDAATALFNLCIYQGNKGKAVRAGVVP L+ LL +P+  M++E LAIL
Sbjct  482  VSLLREGSPRGKKDAATALFNLCIYQGNKGKAVRAGVVPILVGLLMDPEAGMMEETLAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SH EGK AI  A+A+ VLV VI +GSPRNKENAAA L+HLCSGE   QH+ EA E 
Sbjct  542  AILSSHSEGKAAIAAAEALPVLVEVIKSGSPRNKENAAATLLHLCSGEQQQQHLAEAHEK  601

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            G+MG L ++A+NGT+RG+RKAAQL++++NRF
Sbjct  602  GLMGLLQEMAENGTDRGKRKAAQLIQRMNRF  632



>ref|XP_004962703.1| PREDICTED: protein spotted leaf 11-like [Setaria italica]
Length=679

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  483  VVLLSEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ---HVVEAQEL  338
            +IL+SHPEGK AIG A+ V VLV +I +GSPRN+ENAAAV++HLCSGEQ   H+  AQE 
Sbjct  543  SILSSHPEGKAAIGAAEPVPVLVEMIGSGSPRNRENAAAVMLHLCSGEQQLVHLARAQEC  602

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGTERG+RKA  LLE+++RF
Sbjct  603  GIMVPLRELALNGTERGKRKAVHLLERMSRF  633



>gb|EEC69528.1| hypothetical protein OsI_38799 [Oryza sativa Indica Group]
Length=629

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  441  VVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  500

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQEL  338
            +IL+SHPEGK AIG A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE 
Sbjct  501  SILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQEC  560

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  561  GIMVPLRELALNGTDRGKRKAVQLLERMSRF  591



>ref|NP_001067077.2| Os12g0570000 [Oryza sativa Japonica Group]
 dbj|BAF30096.2| Os12g0570000, partial [Oryza sativa Japonica Group]
Length=637

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  440  VVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  499

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVV---EAQEL  338
            +IL+SHPEGK AIG A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE 
Sbjct  500  SILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQEC  559

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  560  GIMVPLRELALNGTDRGKRKAVQLLERMSRF  590



>sp|A2ZLU6.2|SL11_ORYSI RecName: Full=Protein spotted leaf 11; AltName: Full=Cell death-related 
protein SPL11 [Oryza sativa Indica Group]
 sp|Q0IMG9.2|SL11_ORYSJ RecName: Full=E3 ubiquitin-protein ligase SPL11; AltName: Full=Cell 
death-related protein SPL11; AltName: Full=Protein spotted 
leaf 11 [Oryza sativa Japonica Group]
 gb|AAT94160.1| cell death-related protein SPL11 [Oryza sativa Japonica Group]
 gb|AAT94161.1| cell death-related protein SPL11 [Oryza sativa Japonica Group]
Length=694

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  497  VVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  556

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVV---EAQEL  338
            +IL+SHPEGK AIG A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE 
Sbjct  557  SILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQEC  616

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  617  GIMVPLRELALNGTDRGKRKAVQLLERMSRF  647



>gb|EAZ20925.1| hypothetical protein OsJ_36575 [Oryza sativa Japonica Group]
Length=732

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  535  VVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  594

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVV---EAQEL  338
            +IL+SHPEGK AIG A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE 
Sbjct  595  SILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQEC  654

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  655  GIMVPLRELALNGTDRGKRKAVQLLERMSRF  685



>ref|XP_006664118.1| PREDICTED: protein spotted leaf 11-like [Oryza brachyantha]
Length=567

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 126/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  378  VVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  437

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQEL  338
            +IL+SHPEGK AIG A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+     AQE 
Sbjct  438  SILSSHPEGKAAIGAAEPVPVLVQMIGSGTPRNRENAAAVMLHLCSGEHHLAHLARAQEC  497

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  498  GIMVPLRELALNGTDRGKRKAVQLLERMSRF  528



>tpg|DAA47121.1| TPA: putative ARM repeat-containing protein containing family 
protein [Zea mays]
Length=537

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  349  VVLLSEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALLDEAMAIL  408

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
            +IL+SHPEGK AIG A+ V VLV +I +GSPRN+ENAAAV++HL     H+  AQE GIM
Sbjct  409  SILSSHPEGKAAIGAAEPVPVLVEMIGSGSPRNRENAAAVMLHLSVQSVHLARAQECGIM  468

Query  328  GPLLDLAQNGTERGRRKAAQLLEKINRF  245
             PL DLA NGTERGRRKA QLLE+++RF
Sbjct  469  VPLRDLALNGTERGRRKAVQLLERMSRF  496



>gb|EMT11433.1| Protein spotted leaf 11 [Aegilops tauschii]
Length=589

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  390  VVLLSEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  449

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ---HVVEAQEL  338
            +IL+SH EGK AIG A+ V  LV ++ +GSPRN+ENAAAV++HLCSGEQ   H+  A E 
Sbjct  450  SILSSHQEGKAAIGAAEPVPALVELLGSGSPRNRENAAAVMLHLCSGEQQLVHLARAHEC  509

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGTERG+RKA QLLE+++RF
Sbjct  510  GIMVPLRELALNGTERGKRKAVQLLERMSRF  540



>dbj|BAJ85648.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=682

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  483  VVLLSEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ---HVVEAQEL  338
            +IL+SH EGK AIG A+ V  LV ++ +GSPRN+ENAAAV++HLCSGEQ   H+  A E 
Sbjct  543  SILSSHQEGKAAIGAAEPVPALVELLGSGSPRNRENAAAVMLHLCSGEQQLVHLARAHEC  602

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGTERG+RKA QLLE+++RF
Sbjct  603  GIMVPLRELALNGTERGKRKAVQLLERMSRF  633



>gb|EMS63526.1| E3 ubiquitin-protein ligase SPL11 [Triticum urartu]
Length=770

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  571  VVLLSEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  630

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ---HVVEAQEL  338
            +IL+SH EGK AIG A+ V  LV ++ +GSPRN+ENAAAV++HLCSGEQ   H+  A E 
Sbjct  631  SILSSHQEGKAAIGAAEPVPALVELLGSGSPRNRENAAAVMLHLCSGEQQLVHLARAHEC  690

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGTERG+RKA QLLE+++RF
Sbjct  691  GIMVPLRELALNGTERGKRKAVQLLERMSRF  721



>ref|NP_001130347.1| uncharacterized protein LOC100191442 [Zea mays]
 gb|ACF78536.1| unknown [Zea mays]
Length=226

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG QRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  34   VVLLSEGRQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLVMGLVTNPTGALLDEAMAIL  93

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSG---EQHVVEAQEL  338
            +IL+SHPEGK AIG A+ V VLV +IA GSPRN+ENAAAV++HL +      H+  AQE 
Sbjct  94   SILSSHPEGKAAIGAAEPVPVLVEMIAGGSPRNRENAAAVMLHLSASVRQSAHLARAQEC  153

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT RG+RKA QLLE+++RF
Sbjct  154  GIMAPLRELALNGTGRGKRKAVQLLERMSRF  184



>ref|XP_009407488.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407489.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=670

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL+EG+ RGKKDAATALFNLCIYQ NKGKAVRAGVVP +M LLTEP  +M+DE++AIL
Sbjct  481  VSLLSEGTHRGKKDAATALFNLCIYQVNKGKAVRAGVVPLVMGLLTEPAESMLDESMAIL  540

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQH---VVEAQEL  338
            A+L+SHPEGK AI  A+AV +L  + ANGSPRN+ENAAA L++L  GEQ    +  AQE 
Sbjct  541  ALLSSHPEGKSAIAAAQAVPLLAEMTANGSPRNRENAAATLLNLSDGEQQLGTMAAAQEC  600

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIMGPL +LA +GTERG+RKA QLLE++N F
Sbjct  601  GIMGPLQELAISGTERGKRKAVQLLERMNGF  631



>ref|XP_003578975.1| PREDICTED: protein spotted leaf 11-like [Brachypodium distachyon]
Length=695

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 124/151 (82%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  496  VVLLSEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAIL  555

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ---HVVEAQEL  338
            +IL+SH EGK AIG A+ V  LV +I +GSPRN+ENAAAV++HLC GEQ   H+  A E 
Sbjct  556  SILSSHQEGKAAIGAAEPVPALVDLIGSGSPRNRENAAAVMLHLCCGEQQLVHLARAHEC  615

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  616  GIMVPLRELALNGTDRGKRKAVQLLERMSRF  646



>gb|ADB85351.1| putative spotted leaf protein 11 [Phyllostachys edulis]
Length=989

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGSQRGKKDAA ALFNLCIYQGNK +A+RAG+VP +M L+T P G ++DE++AIL
Sbjct  793  VVLLSEGSQRGKKDAAAALFNLCIYQGNKARAIRAGLVPLIMGLVTNPTGALMDESMAIL  852

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ---HVVEAQEL  338
            +IL+SH EGK AIG A+ V VLV +I +G+ RN+ENAAAV++HLCSGEQ   H+  AQE 
Sbjct  853  SILSSHQEGKAAIGAAEPVPVLVEMIGSGTTRNRENAAAVMLHLCSGEQQHVHLARAQEC  912

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGTERG+RKA QLLE+++RF
Sbjct  913  GIMVPLRELALNGTERGKRKAVQLLERMSRF  943



>gb|AGQ04508.1| spotted leaf 11, partial [Oryza granulata]
Length=185

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 116/138 (84%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQELGIMGPLLDLAQNG  299
            G A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE GIM PL +LA NG
Sbjct  61   GAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            TERG+RKA QLLE+++RF
Sbjct  121  TERGKRKAVQLLERMSRF  138



>ref|XP_003561780.1| PREDICTED: protein spotted leaf 11-like [Brachypodium distachyon]
Length=712

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GSQRGKKDAATALFNLCIYQGNKGKAVRAG+VP L++LLTE +  M+DEALAIL
Sbjct  507  VLLLGNGSQRGKKDAATALFNLCIYQGNKGKAVRAGLVPILLELLTETETGMLDEALAIL  566

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SHPEGK AI  A A+ +LVGVI NGS RNKENAAAVLVHLC+GE   QH+ EAQE 
Sbjct  567  AILSSHPEGKAAISAAAAIPILVGVIRNGSSRNKENAAAVLVHLCNGEQQQQHLAEAQEQ  626

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            G++  L +LA++GT+RG+RKA QLLE++NRF
Sbjct  627  GVVTLLEELAESGTDRGKRKAIQLLERMNRF  657



>ref|XP_009402317.1| PREDICTED: protein spotted leaf 11-like [Musa acuminata subsp. 
malaccensis]
Length=654

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LLNEGSQRGK+DAA ALFNLCI+ GN+GK ++AGV+PTLM LL  PQG+MVDEALAIL
Sbjct  477  VLLLNEGSQRGKRDAAAALFNLCIFPGNRGKVLKAGVMPTLMGLLMHPQGDMVDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLC-SGEQHVVEAQELGI  332
            AIL+SHP+GKVAIG A+A+ +LV +I +GSP NKENAA +LVHLC S EQH+  AQ  G+
Sbjct  537  AILSSHPQGKVAIGAAEALPLLVELIRSGSPSNKENAATILVHLCNSEEQHLAAAQVQGV  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            +GPL ++ ++GT+RG+RKA QLL  +++F
Sbjct  597  IGPLYEMTESGTDRGKRKAVQLLGCMHKF  625



>gb|AGQ04498.1| spotted leaf 11, partial [Oryza glumipatula]
Length=185

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQELGIMGPLLDLAQNG  299
            G A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE GIM PL +LA NG
Sbjct  61   GAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            T+RG+RKA QLLE+++RF
Sbjct  121  TDRGKRKAVQLLERVSRF  138



>gb|AGQ04503.1| spotted leaf 11, partial [Oryza sativa Indica Group]
Length=176

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQELGIMGPLLDLAQNG  299
            G A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE GIM PL +LA NG
Sbjct  61   GAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            T+RG+RKA QLLE+++RF
Sbjct  121  TDRGKRKAVQLLERMSRF  138



>gb|AGQ04501.1| spotted leaf 11, partial [Oryza meridionalis]
Length=185

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQELGIMGPLLDLAQNG  299
            G A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE GIM PL +LA NG
Sbjct  61   GAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            T+RG+RKA QLLE+++RF
Sbjct  121  TDRGKRKAVQLLERMSRF  138



>gb|AGQ04499.1| spotted leaf 11, partial [Oryza longistaminata]
Length=185

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQELGIMGPLLDLAQNG  299
            G A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE GIM PL +LA NG
Sbjct  61   GAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            T+RG+RKA QLLE+++RF
Sbjct  121  TDRGKRKAVQLLERMSRF  138



>gb|AGQ04496.1| spotted leaf 11, partial [Oryza nivara]
 gb|AGQ04497.1| spotted leaf 11, partial [Oryza rufipogon]
 gb|AGQ04500.1| spotted leaf 11, partial [Oryza barthii]
 gb|AGQ04502.1| spotted leaf 11, partial [Oryza glaberrima]
 gb|AGQ04504.1| spotted leaf 11, partial [Oryza sativa Japonica Group]
Length=185

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQELGIMGPLLDLAQNG  299
            G A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE GIM PL +LA NG
Sbjct  61   GAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            T+RG+RKA QLLE+++RF
Sbjct  121  TDRGKRKAVQLLERMSRF  138



>gb|ADQ12763.1| ARM protein, partial [Picea jezoensis]
 gb|ADQ12764.1| ARM protein, partial [Picea jezoensis]
 gb|ADQ12765.1| ARM protein, partial [Picea jezoensis]
Length=174

 Score =   164 bits (415),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 112/141 (79%), Gaps = 1/141 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAATALFNL IYQGNK +AVRAGVV  LMQLL +P   MVDEALAIL
Sbjct  34   VGLLCEGSQRGKKDAATALFNLSIYQGNKARAVRAGVVSPLMQLLVDPSAGMVDEALAIL  93

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK+AIG A A+ +LV +I  GSPRN+ENAAAVL+ LC+ + QH+V A+ELG 
Sbjct  94   AILASHQEGKIAIGNADAIPILVQLIRTGSPRNRENAAAVLLALCTSDSQHLVAARELGA  153

Query  331  MGPLLDLAQNGTERGRRKAAQ  269
              PL DL QNGT R +RKAA 
Sbjct  154  YEPLSDLVQNGTARAKRKAAS  174



>ref|XP_002443392.1| hypothetical protein SORBIDRAFT_08g018765 [Sorghum bicolor]
 gb|EES17230.1| hypothetical protein SORBIDRAFT_08g018765 [Sorghum bicolor]
Length=521

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EGS RG KDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  332  VVLLSEGSPRGMKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALLDEAMAIL  391

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
            +IL+SHPEGK AIG A+ V VLV +I +GSPRN+ENAAAV++HL     H+  AQE GIM
Sbjct  392  SILSSHPEGKAAIGAAEPVPVLVEMIGSGSPRNRENAAAVMLHLSVHNGHLARAQECGIM  451

Query  328  GPLLDLAQNGTERGRRKAAQLLEKINRF  245
             PL +LA NGT+RG+RKA QLLE+++RF
Sbjct  452  VPLRELALNGTDRGKRKAVQLLERMSRF  479



>gb|ADQ12754.1| ARM protein, partial [Picea abies]
 gb|ADQ12755.1| ARM protein, partial [Picea abies]
 gb|ADQ12756.1| ARM protein, partial [Picea abies]
 gb|ADQ12757.1| ARM protein, partial [Picea mariana]
 gb|ADQ12758.1| ARM protein, partial [Picea mariana]
 gb|ADQ12759.1| ARM protein, partial [Picea mariana]
 gb|ADQ12760.1| ARM protein, partial [Picea omorika]
 gb|ADQ12761.1| ARM protein, partial [Picea omorika]
 gb|ADQ12762.1| ARM protein, partial [Picea omorika]
 gb|ADQ12766.1| ARM protein, partial [Picea glauca]
 gb|ADQ12767.1| ARM protein, partial [Picea glauca]
 gb|ADQ12768.1| ARM protein, partial [Picea glauca]
Length=174

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 112/141 (79%), Gaps = 1/141 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EGSQRGKKDAATALFNL IYQGNK +AVRAGVV  LMQLL +P   MVDEALAIL
Sbjct  34   VGLLCEGSQRGKKDAATALFNLSIYQGNKARAVRAGVVSPLMQLLVDPSAGMVDEALAIL  93

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK+AIG A A+ +LV +I  GSPRN+ENAAAVL+ LC+ + QH+V A+ELG 
Sbjct  94   AILASHQEGKIAIGNADAIPILVQLIRTGSPRNRENAAAVLLALCTSDPQHLVAARELGA  153

Query  331  MGPLLDLAQNGTERGRRKAAQ  269
              PL DL QNGT R +RKAA 
Sbjct  154  YEPLSDLVQNGTARAKRKAAS  174



>gb|AGQ04505.1| spotted leaf 11, partial [Oryza punctata]
Length=185

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVV---EAQELGIMGPLLDLAQNG  299
            G A+ + VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE GIM PL +LA NG
Sbjct  61   GAAEPIPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLAHAQECGIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            T RG+RKA QLLE+++RF
Sbjct  121  TNRGKRKAVQLLERMSRF  138



>gb|AGQ04506.1| spotted leaf 11, partial [Oryza officinalis]
Length=185

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVV---EAQELGIMGPLLDLAQNG  299
            G A+ + VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE GIM PL +LA NG
Sbjct  61   GAAEPIPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLAHAQECGIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            T RG+RKA QLLE+++RF
Sbjct  121  TNRGKRKAVQLLERMSRF  138



>ref|XP_008672017.1| PREDICTED: uncharacterized protein LOC100191442 isoform X1 [Zea 
mays]
 tpg|DAA55185.1| TPA: putative ARM repeat-containing protein containing family 
protein [Zea mays]
Length=672

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+EG QRGKKDAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL
Sbjct  480  VVLLSEGRQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLVMGLVTNPTGALLDEAMAIL  539

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSG---EQHVVEAQEL  338
            +IL+SHPEGK AIG A+ V VLV +IA GSPRN+ENAAAV++HL +      H+  AQE 
Sbjct  540  SILSSHPEGKAAIGAAEPVPVLVEMIAGGSPRNRENAAAVMLHLSASVRQSAHLARAQEC  599

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            GIM PL +LA NGT RG+RKA QLLE+++RF
Sbjct  600  GIMAPLRELALNGTGRGKRKAVQLLERMSRF  630



>gb|AGQ04507.1| spotted leaf 11, partial [Oryza australiensis]
Length=177

 Score =   162 bits (409),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = -2

Query  649  DAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkvai  470
            DAA ALFNLCIYQGNKG+A+RAG+VP +M L+T P G ++DEA+AIL+IL+SHPEGK AI
Sbjct  1    DAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAI  60

Query  469  ggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE---AQELGIMGPLLDLAQNG  299
            G A+ V VLV +I +G+PRN+ENAAAV++HLCSGE H+V    AQE  IM PL +LA NG
Sbjct  61   GAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECRIMVPLRELALNG  120

Query  298  TERGRRKAAQLLEKINRF  245
            T+RG+RKA QLLE+++RF
Sbjct  121  TDRGKRKAVQLLERMSRF  138



>ref|XP_008810592.1| PREDICTED: LOW QUALITY PROTEIN: protein spotted leaf 11 [Phoenix 
dactylifera]
Length=667

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 124/151 (82%), Gaps = 4/151 (3%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL++GSQRGKKDAATALFNL IYQ NKGK+V A VVPT M LLTEP G MV+EALA+L
Sbjct  481  VMLLSDGSQRGKKDAATALFNLVIYQDNKGKSVSARVVPTPMGLLTEP-GGMVNEALAML  539

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE---QHVVEAQEL  338
            AIL+SH EG +AIG  +AV VLV VI +GSPRNKENAAAVLVH C+GE   QH+ EA + 
Sbjct  540  AILSSHLEGNLAIGADEAVPVLVEVIRSGSPRNKENAAAVLVHHCNGEQQQQHLAEAWDC  599

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLEKINRF  245
             +MGPL +LAQ+GT+ G+RKAAQLL+ +NRF
Sbjct  600  RVMGPLEELAQSGTDGGKRKAAQLLQCMNRF  630



>ref|XP_004515619.1| PREDICTED: U-box domain-containing protein 13-like [Cicer arietinum]
Length=631

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTLL EGSQRGK DAA ALFNLC YQ NKG+A++AG+VP L+++LTEP G M DEAL I+
Sbjct  480  VTLLCEGSQRGKVDAAAALFNLCFYQANKGRAIKAGIVPKLIEMLTEPDGQMRDEALTIM  539

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            A+L +HP+GK AIG   A+   V +I NGS RNKENA +VLVH+C G+  H+     LG+
Sbjct  540  AMLVTHPDGKAAIGSMNAIPTFVEIIINGSSRNKENATSVLVHVCRGDPLHLSTVASLGV  599

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
            + PLL+LA+NG+ER  RKAA+LLE
Sbjct  600  INPLLELAENGSERANRKAAELLE  623



>ref|XP_007140288.1| hypothetical protein PHAVU_008G099500g [Phaseolus vulgaris]
 gb|ESW12282.1| hypothetical protein PHAVU_008G099500g [Phaseolus vulgaris]
Length=439

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTL  EGSQRGK DAA ALFNLC+ QGNKG+A+RAG+ P L+++L EP G M DEALAI+
Sbjct  282  VTLFCEGSQRGKLDAAKALFNLCLSQGNKGRAIRAGIGPKLIEMLIEPDGAMRDEALAIM  341

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            A++ASHP+GK AIG    V+ LV +I++GSPRNKENA +VLV LC G+  H+       +
Sbjct  342  AVVASHPDGKAAIGSLNVVSTLVELISDGSPRNKENATSVLVLLCHGDPLHLSIVSSPRV  401

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKI  254
            + PLLDLA+NG+ER RRKA QLLE I
Sbjct  402  IIPLLDLAENGSERARRKAGQLLELI  427



>ref|XP_002529604.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis]
 gb|EEF32796.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis]
Length=575

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 116/149 (78%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +AV+AG+VP+LMQLL +P G MVDEALAIL
Sbjct  418  IDLLREGTPRGKKDAATAIFNLSIYQGNKARAVKAGIVPSLMQLLKDPGGGMVDEALAIL  477

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGKVAIG AK + VLV VI  GSPRN+ENAAAVL  LC+G+ Q +  A+E G 
Sbjct  478  AILASHQEGKVAIGQAKPIPVLVEVIRTGSPRNRENAAAVLWSLCAGDLQQLKLAKESGA  537

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L+++GT+R +RKA  LLE I R 
Sbjct  538  EEALKELSESGTDRAKRKAGSLLELIQRV  566



>gb|KEH22840.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=634

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            VTL  EGSQRGK DAATALF LC+Y GNKG+ +RAG+VP L+++L    G M DEALAI+
Sbjct  489  VTLFCEGSQRGKVDAATALFKLCLYHGNKGRVIRAGIVPKLIEMLM--AGEMRDEALAIM  546

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
             I+ SHP+GK AI    A++ LV +I NGS +NKENA +VLVHLC G   H       G+
Sbjct  547  DIIVSHPDGKAAIVSTNAISTLVELIINGSSKNKENATSVLVHLCRGNSLHRSTVTSPGV  606

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKIN  251
            + PLL+LA+NG+ERG+RKAAQLLE ++
Sbjct  607  INPLLELAKNGSERGKRKAAQLLELLD  633



>ref|XP_001772291.1| predicted protein [Physcomitrella patens]
 gb|EDQ62944.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL +G+ RGKKDAATALFNL IYQGNK +AVRAGVVP LM LL +P   MVDEALAIL
Sbjct  488  VDLLKDGTARGKKDAATALFNLSIYQGNKARAVRAGVVPPLMDLLRDPSAGMVDEALAIL  547

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA+HP+G++AIG A A+ +LV +I +GSPRNKENA A+ V+L + +  H+V   +LG 
Sbjct  548  AILATHPDGRLAIGQASALPILVDLIKSGSPRNKENAVAITVNLATHDPVHLVTTYKLGA  607

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
              PL  L  +GT R +RKAAQLLE + +
Sbjct  608  QDPLRSLVNDGTPRAKRKAAQLLENMRK  635



>gb|KHN43042.1| U-box domain-containing protein 10 [Glycine soja]
Length=619

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+++LT+   +MVDEAL I+
Sbjct  468  VELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLKMLTDSSKSMVDEALTIM  527

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  +  ++     LG+
Sbjct  528  SVLASHQEAKVAIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDADNLACISRLGV  587

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+NGTER +RKA  LLE I + 
Sbjct  588  VIPLSELARNGTERAKRKATSLLEHIRKL  616


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 72/132 (55%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       + +A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  386  VNLLTSEDVLTQDNAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  445

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  446  FSLSLADENKIIIGASGAIPALVELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  505

Query  328  GPLLDLAQNGTE  293
              LL +  + ++
Sbjct  506  TALLKMLTDSSK  517



>ref|XP_009785565.1| PREDICTED: U-box domain-containing protein 11-like [Nicotiana 
sylvestris]
Length=645

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++P L+ +LT+    MVDEAL IL
Sbjct  494  VELLRTGSTRGKKDAATALFNLCIYQGNKGRAVRAGIIPALLTMLTDSSNCMVDEALTIL  553

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E K AI  A  +  L+ ++  G PRNKENAAA+L+ LC  + +++   + LG 
Sbjct  554  SVLASHQEAKAAIAKASTIPALIDLLRTGLPRNKENAAAILLSLCKRDPENLSCLRRLGA  613

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
            + PL +LA +GTER +RKAA LLE +++
Sbjct  614  LIPLSELANSGTERAKRKAATLLEHLSK  641



>ref|XP_011084290.1| PREDICTED: U-box domain-containing protein 14 [Sesamum indicum]
Length=632

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+LL +P G MVDEALAIL
Sbjct  479  IDLLCQGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIVPPLMRLLKDPGGGMVDEALAIL  538

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGKVAIG A+ +  LV VI  GSPRN+ENAAA+L  LC+G  Q++  A++LG 
Sbjct  539  AILASHQEGKVAIGQAEPIPTLVEVIRTGSPRNRENAAAILWSLCTGSAQYIKIARDLGA  598

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE + R 
Sbjct  599  EEALKELSENGTDRAKRKAGSVLELLQRV  627


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 57/139 (41%), Gaps = 41/139 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG +P ++ +L               
Sbjct  397  VELLSSPDLRTQEHAVTALLNLSINEANKGTIVNAGAIPDIVDVLK--------------  442

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                       NGS   +ENAAA L  L   +++ V     G +
Sbjct  443  ---------------------------NGSTEARENAAATLFSLSVVDENKVAIGAAGAI  475

Query  328  GPLLDLAQNGTERGRRKAA  272
             PL+DL   GT RG++ AA
Sbjct  476  PPLIDLLCQGTPRGKKDAA  494



>ref|XP_003528526.1| PREDICTED: U-box domain-containing protein 11-like [Glycine max]
Length=654

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+++LT+   +MVDEAL I+
Sbjct  503  VELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLKMLTDSSKSMVDEALTIM  562

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  +  ++     LG+
Sbjct  563  SVLASHQEAKVAIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDADNLACISRLGV  622

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+NGTER +RKA  LLE I + 
Sbjct  623  VIPLSELARNGTERAKRKATSLLEHIRKL  651


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 72/132 (55%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       + +A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  421  VNLLTSEDVLTQDNAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  480

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  481  FSLSLADENKIIIGASGAIPALVELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  540

Query  328  GPLLDLAQNGTE  293
              LL +  + ++
Sbjct  541  TALLKMLTDSSK  552



>ref|XP_003555889.1| PREDICTED: U-box domain-containing protein 10-like [Glycine max]
Length=651

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+++LT+   +MVDEAL I+
Sbjct  500  VELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLKMLTDSSKSMVDEALTIM  559

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  +  ++     LG 
Sbjct  560  SVLASHQEAKVAIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDADNLACISRLGA  619

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+NGTER +RKA  LLE I++ 
Sbjct  620  LIPLSELARNGTERAKRKATSLLEHIHKL  648


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 72/132 (55%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       + +A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  418  VNLLTSEDVLTQDNAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  477

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  478  FSLSLADENKIIIGASGAIPALVELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  537

Query  328  GPLLDLAQNGTE  293
              LL +  + ++
Sbjct  538  TALLKMLTDSSK  549



>ref|XP_009760654.1| PREDICTED: U-box domain-containing protein 14 [Nicotiana sylvestris]
Length=624

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 117/149 (79%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+LL +P G M+DEALAIL
Sbjct  471  IDLLCQGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIVPPLMRLLKDPGGGMMDEALAIL  530

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AIG A+ + +LV VI  GSPRN+ENAAA+L  LC+G+ Q++  A++LG+
Sbjct  531  AILASHQEGKAAIGQAEPIPILVEVIRTGSPRNRENAAAILWSLCTGDVQNLKVARDLGV  590

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE + R 
Sbjct  591  EEVLKELSENGTDRAKRKAGSVLELLQRV  619


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 71/129 (55%), Gaps = 0/129 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG +P ++ +L        + A A L
Sbjct  389  VELLSSSDSRTQEHAVTALLNLSINESNKGTIVNAGAIPDIVDVLRNGSMEARENAAATL  448

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++  G+PR K++AA  + +L   + + V A   GI+
Sbjct  449  FSLSVVDENKVAIGAAGAIPALIDLLCQGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIV  508

Query  328  GPLLDLAQN  302
             PL+ L ++
Sbjct  509  PPLMRLLKD  517



>gb|KHN32252.1| U-box domain-containing protein 10 [Glycine soja]
Length=651

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+++LT+   +MVDEAL I+
Sbjct  500  VELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLKMLTDSSKSMVDEALTIM  559

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  +  ++     LG 
Sbjct  560  SVLASHQEAKVAIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDADNLACISRLGA  619

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+NGTER +RKA  LLE I++ 
Sbjct  620  LIPLSELARNGTERAKRKATSLLEHIHKL  648


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 72/132 (55%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       + +A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  418  VNLLTSEDVLTQDNAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  477

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  478  FSLSLADENKIIIGASGAIPALVELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  537

Query  328  GPLLDLAQNGTE  293
              LL +  + ++
Sbjct  538  TALLKMLTDSSK  549



>ref|XP_008454770.1| PREDICTED: U-box domain-containing protein 11-like [Cucumis melo]
Length=662

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG+V  L+Q+LT+   +M+DEAL I+
Sbjct  511  VDLLENGSSRGKKDAATALFNLCIYQGNKGRAVRAGIVSALLQMLTDSVNSMIDEALTIM  570

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEA-QELGI  332
            ++LASH E KVA+  A  + VL+ ++  G PRNKENAAA+L+ LC  +   +     LG 
Sbjct  571  SVLASHQEAKVAMVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDTDNLSCISRLGA  630

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA++GTER +RKA  LLE + + 
Sbjct  631  VIPLTELAKSGTERAKRKATSLLEHLRKL  659


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       +++A T++ NL IY+ NKG  + AG VP+++Q+L        + A A L
Sbjct  429  VNLLTSDDVLIQENAVTSILNLSIYENNKGLIMLAGAVPSIVQVLRVGSMEARENAAATL  488

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E ++ IG + A+  LV ++ NGS R K++AA  L +LC  + +   A   GI+
Sbjct  489  FSLSLADENRIIIGASGAIPALVDLLENGSSRGKKDAATALFNLCIYQGNKGRAVRAGIV  548

Query  328  GPLLDL  311
              LL +
Sbjct  549  SALLQM  554



>ref|XP_010105768.1| U-box domain-containing protein 11 [Morus notabilis]
 gb|EXC06053.1| U-box domain-containing protein 11 [Morus notabilis]
Length=652

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAGV+  L+ +LT+   +MVDEAL I+
Sbjct  501  VDLLQNGSTRGKKDAATALFNLCIYQGNKGRAVRAGVITALLSILTDSGDSMVDEALTIM  560

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  561  SVLASHQEAKVAIVKAGTIPVLIDLLRTGLPRNKENAAAILLALCKRDGENLACISRLGA  620

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA++GTERG+RKA  LLE + + 
Sbjct  621  VIPLTELAKSGTERGKRKATSLLEHLRKL  649


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       +++A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  419  VNLLTSDDVLTQENAVTSILNLSIYEDNKGLIMLAGAIPSIVQVLRAGSMEARENAAATL  478

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGS R K++AA  L +LC  + +   A   G++
Sbjct  479  FSLSLADENKIIIGASGAIPALVDLLQNGSTRGKKDAATALFNLCIYQGNKGRAVRAGVI  538

Query  328  GPLLDL  311
              LL +
Sbjct  539  TALLSI  544



>ref|XP_010241804.1| PREDICTED: U-box domain-containing protein 14 [Nelumbo nucifera]
 ref|XP_010241805.1| PREDICTED: U-box domain-containing protein 14 [Nelumbo nucifera]
Length=623

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EGS RGKKDAATA+FNL IYQGNK +AVRAG+V  LM+L+ +  G MVDEALAIL
Sbjct  468  IGLLCEGSPRGKKDAATAIFNLSIYQGNKVRAVRAGIVAPLMKLMMDASGGMVDEALAIL  527

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGKVAIG A  + +LV V+  GSPRN+ENAAAVL  LC+ + QH+  A+E G 
Sbjct  528  AILASHQEGKVAIGQADPIPILVEVMKTGSPRNRENAAAVLWSLCTCDAQHIKNAKEHGA  587

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L +L +NGTER +RKA  +LE I+R
Sbjct  588  EEALKELTENGTERAKRKAGNILELIHR  615


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 73/131 (56%), Gaps = 0/131 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG+ V AG +  ++++L        + A A L
Sbjct  386  VNLLSSQDPRTQEHAVTALLNLSINEANKGRIVNAGAIHDIVEVLKNGSMEARENAAATL  445

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+G++  GSPR K++AA  + +L   + + V A   GI+
Sbjct  446  FSLSVVDENKVAIGAAGAIPALIGLLCEGSPRGKKDAATAIFNLSIYQGNKVRAVRAGIV  505

Query  328  GPLLDLAQNGT  296
             PL+ L  + +
Sbjct  506  APLMKLMMDAS  516



>ref|XP_002526006.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis]
 gb|EEF36346.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis]
Length=648

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++P L+++LT+ +  M DEAL IL
Sbjct  497  VELLENGSPRGKKDAATALFNLCIYQGNKGRAVRAGIIPALLKMLTDSRNCMADEALTIL  556

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+ + K AI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  557  SVLASNQDAKAAIVKASTIPVLIDLLRTGQPRNKENAAAILLSLCKRDPENLACISRLGA  616

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL++LA++GTERG+RKA  LLE + + 
Sbjct  617  VIPLMELAKSGTERGKRKATSLLEHLRKL  645


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 67/115 (58%), Gaps = 0/115 (0%)
 Frame = -2

Query  655  KKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAILASHPEgkv  476
            ++++ TA+ NL IY+ NKG  + AG VP+++Q+L        + A A L  L+   E K+
Sbjct  426  QENSVTAILNLSIYESNKGLIMLAGAVPSIVQILRAGSVEARENAAATLFSLSLGDENKI  485

Query  475  aiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIMGPLLDL  311
             IG + A+  LV ++ NGSPR K++AA  L +LC  + +   A   GI+  LL +
Sbjct  486  IIGASGAIPALVELLENGSPRGKKDAATALFNLCIYQGNKGRAVRAGIIPALLKM  540



>ref|XP_009630244.1| PREDICTED: U-box domain-containing protein 11-like [Nicotiana 
tomentosiformis]
Length=645

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++P L+ +LT+    MVDEAL IL
Sbjct  494  VELLRTGSTRGKKDAATALFNLCIYQGNKGRAVRAGIIPALLTMLTDSSNCMVDEALTIL  553

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E K AI     + VL+ ++  G PRNKENAAA+L+ LC  + +++   + LG 
Sbjct  554  SVLASHQEAKAAIAKVSTIPVLIDLLRTGLPRNKENAAAILLSLCKRDPENLSCLRRLGA  613

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
            + PL +LA +GTER +RKA  LLE + +
Sbjct  614  LIPLSELANSGTERAKRKATSLLEHLRK  641



>ref|XP_011038670.1| PREDICTED: U-box domain-containing protein 11-like isoform X2 
[Populus euphratica]
Length=571

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++  L+++LT+ +  MVDEAL IL
Sbjct  420  VELLENGSTRGKKDAATALFNLCIYQGNKGRAVRAGIITALLKMLTDSRNCMVDEALTIL  479

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+ E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  480  SVLASNQEAKVAIVKASTIPVLIDLLRTGLPRNKENAAAILLSLCKRDPENLACISRLGA  539

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+NGTER +RKA  +LE + R 
Sbjct  540  VIPLTELAKNGTERAKRKATSMLEHLRRL  568



>ref|XP_006833209.1| hypothetical protein AMTR_s00072p00171260 [Amborella trichopoda]
 gb|ERM98487.1| hypothetical protein AMTR_s00072p00171260 [Amborella trichopoda]
Length=630

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL +GS RGKKDAATALFNLCIYQGNK +AVRAGVV  LM+LL +P G MVDEALAIL
Sbjct  468  VDLLCKGSPRGKKDAATALFNLCIYQGNKVRAVRAGVVMPLMRLLMDPGGGMVDEALAIL  527

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL +HPEGK AIG A+ V +LV  +  GSPRN+ENAA++L+ LC+ + QH+  A+ELG 
Sbjct  528  AILVTHPEGKAAIGQAEPVPMLVEFLRTGSPRNRENAASILLGLCTVDAQHLSLARELGA  587

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               + +LA++GT R +RKA  LLE
Sbjct  588  EEAVRELAESGTVRAKRKAGSLLE  611


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I   NKG  V AG +P ++ +L        + A A L
Sbjct  386  VDLLSSPDPRTQEHAVTALLNLSINDSNKGSIVMAGAIPDIVDVLKSGCMEARENAAATL  445

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   + KVAIG A A+  LV ++  GSPR K++AA  L +LC  + + V A   G++
Sbjct  446  FSLSVVDDNKVAIGAAGAIPALVDLLCKGSPRGKKDAATALFNLCIYQGNKVRAVRAGVV  505

Query  328  GPLLDL  311
             PL+ L
Sbjct  506  MPLMRL  511



>ref|XP_004140474.1| PREDICTED: U-box domain-containing protein 10-like [Cucumis sativus]
Length=624

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG+V  L+++LT+   +M+DEAL I+
Sbjct  473  VDLLENGSSRGKKDAATALFNLCIYQGNKGRAVRAGIVSALLKMLTDSANSMIDEALTIM  532

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEA-QELGI  332
            ++LASH E KVA+  A  + VL+ ++  G PRNKENAAA+L+ LC  +   +     LG 
Sbjct  533  SVLASHQEAKVAMVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDTDNLSCISRLGA  592

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA++GTER +RKA  LLE + + 
Sbjct  593  VIPLTELAKSGTERAKRKATSLLEHLRKL  621


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       +++A T++ NL IY+ NKG  + AG VP+++Q+L        + A A L
Sbjct  391  VNLLTSEDVLVQENAVTSILNLSIYENNKGLIMLAGAVPSIVQVLRVGSMEARENAAATL  450

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E ++ IG + A+  LV ++ NGS R K++AA  L +LC  + +   A   GI+
Sbjct  451  FSLSLADENRIIIGASGAIPALVDLLENGSSRGKKDAATALFNLCIYQGNKGRAVRAGIV  510

Query  328  GPLLDL  311
              LL +
Sbjct  511  SALLKM  516



>ref|XP_011070638.1| PREDICTED: U-box domain-containing protein 11-like [Sesamum indicum]
Length=652

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIY GNKG+A+RAG++  L+++LT+    MVDEAL IL
Sbjct  501  VDLLQSGSSRGKKDAATALFNLCIYHGNKGRAIRAGIITALLKMLTDSSSCMVDEALTIL  560

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E KVAI  A  + VL+ ++  GSPRNKENA+A+L+ LC  + +++     LG 
Sbjct  561  SVLASHQEAKVAIVKASTIPVLMDLLRAGSPRNKENASAILLSLCKRDNENLACLSRLGA  620

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
            + PL +LA+NGTER +RKA  LLE + +
Sbjct  621  VIPLSELARNGTERAKRKATSLLEHLRK  648



>ref|XP_004161193.1| PREDICTED: U-box domain-containing protein 10-like [Cucumis sativus]
Length=661

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG+V  L+++LT+   +M+DEAL I+
Sbjct  510  VDLLENGSSRGKKDAATALFNLCIYQGNKGRAVRAGIVSALLKMLTDSANSMIDEALTIM  569

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEA-QELGI  332
            ++LASH E KVA+  A  + VL+ ++  G PRNKENAAA+L+ LC  +   +     LG 
Sbjct  570  SVLASHQEAKVAMVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDTDNLSCISRLGA  629

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA++GTER +RKA  LLE + + 
Sbjct  630  VIPLTELAKSGTERAKRKATSLLEHLRKL  658


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       +++A T++ NL IY+ NKG  + AG VP+++Q+L        + A A L
Sbjct  428  VNLLTSEDVLVQENAVTSILNLSIYENNKGLIMLAGAVPSIVQVLRVGSMEARENAAATL  487

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E ++ IG + A+  LV ++ NGS R K++AA  L +LC  + +   A   GI+
Sbjct  488  FSLSLADENRIIIGASGAIPALVDLLENGSSRGKKDAATALFNLCIYQGNKGRAVRAGIV  547

Query  328  GPLLDL  311
              LL +
Sbjct  548  SALLKM  553



>ref|XP_011038668.1| PREDICTED: U-box domain-containing protein 11-like isoform X1 
[Populus euphratica]
Length=640

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++  L+++LT+ +  MVDEAL IL
Sbjct  489  VELLENGSTRGKKDAATALFNLCIYQGNKGRAVRAGIITALLKMLTDSRNCMVDEALTIL  548

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+ E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  549  SVLASNQEAKVAIVKASTIPVLIDLLRTGLPRNKENAAAILLSLCKRDPENLACISRLGA  608

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+NGTER +RKA  +LE + R 
Sbjct  609  VIPLTELAKNGTERAKRKATSMLEHLRRL  637



>gb|KDP30475.1| hypothetical protein JCGZ_16154 [Jatropha curcas]
Length=630

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +AVRAG+V  LMQLL +  G MVDEALAIL
Sbjct  473  IDLLREGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVLPLMQLLKDAGGGMVDEALAIL  532

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGKVAIG A+ + VL+ VI  GSPRN+ENAAAVL  LC+G+ Q V  A+E G 
Sbjct  533  AILASHQEGKVAIGQAEPIPVLMEVIRTGSPRNRENAAAVLWSLCTGDSQQVKLAKEFGA  592

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L+++GT+R +RKA  LLE I + 
Sbjct  593  EEALKELSESGTDRAKRKAGSLLELIQQV  621



>ref|XP_002968976.1| hypothetical protein SELMODRAFT_231208 [Selaginella moellendorffii]
 gb|EFJ30092.1| hypothetical protein SELMODRAFT_231208 [Selaginella moellendorffii]
Length=613

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V L N GS RGKKDAATALFNL IYQGNK +AVRAG+VP LM+ L + +  MVDE+LAIL
Sbjct  455  VDLFNSGSLRGKKDAATALFNLSIYQGNKARAVRAGIVPALMRELLDTRAGMVDESLAIL  514

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL +H EG+VA+G    V VLV +I++GS R KENAAAVL+ LCS +  HVV A +LG 
Sbjct  515  AILVTHHEGRVAVGNESPVPVLVELISSGSARTKENAAAVLLALCSNDSAHVVAAHQLGA  574

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
              PL +LA NGT R RRKA  LLE + +
Sbjct  575  YLPLAELAVNGTMRARRKAGSLLEHLCK  602



>ref|XP_011075713.1| PREDICTED: U-box domain-containing protein 11-like [Sesamum indicum]
Length=651

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++  L+++LT+    MVDEAL IL
Sbjct  500  VDLLQNGSSRGKKDAATALFNLCIYQGNKGRAVRAGIITALLKMLTDSSSCMVDEALTIL  559

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E K+AI     + VLV ++  G PRNKENAAA L+ LC  + +++     LG 
Sbjct  560  SVLASHQEAKLAIMNGSTIPVLVDLLRTGLPRNKENAAATLLSLCRRDNENIARLTRLGA  619

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
              PL +LA+ GTER +RKA  LLE++ +
Sbjct  620  AIPLSELAKTGTERAKRKATSLLEQLRK  647



>ref|XP_002990024.1| hypothetical protein SELMODRAFT_184959 [Selaginella moellendorffii]
 gb|EFJ09037.1| hypothetical protein SELMODRAFT_184959 [Selaginella moellendorffii]
Length=641

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V L N GS RGKKDAATALFNL IYQGNK +AVRAG+VP LM+ L + +  MVDE+LAIL
Sbjct  483  VDLFNSGSLRGKKDAATALFNLSIYQGNKARAVRAGIVPALMRELLDTRAGMVDESLAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            AIL +H EG+VA+G    V VLV +I++GS R KENAAAVL+ LCS +  HVV A +LG 
Sbjct  543  AILVTHHEGRVAVGNESPVPVLVELISSGSARTKENAAAVLLALCSNDSAHVVAAHQLGA  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
              PL +LA NGT R RRKA  LLE + +
Sbjct  603  YLPLAELAVNGTMRARRKAGSLLEHLCK  630



>ref|XP_002315888.2| hypothetical protein POPTR_0010s12410g [Populus trichocarpa]
 gb|EEF02059.2| hypothetical protein POPTR_0010s12410g [Populus trichocarpa]
Length=640

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++  L+++LT+ +  MVDEAL IL
Sbjct  489  VELLENGSTRGKKDAATALFNLCIYQGNKGRAVRAGIITALLKMLTDSRNCMVDEALTIL  548

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+ E KVAI  A  + VL+ ++  G PRNKENA+A+L+ LC  + +++     LG 
Sbjct  549  SVLASNQEAKVAIVKASTIPVLIDLLRTGLPRNKENASAILLSLCKRDPENLACISRLGA  608

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+NGTER +RKA  +LE + R 
Sbjct  609  VIPLTELAKNGTERAKRKATSMLEHLRRL  637



>ref|XP_007009958.1| U-box domain-containing protein 14 [Theobroma cacao]
 gb|EOY18768.1| U-box domain-containing protein 14 [Theobroma cacao]
Length=637

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EGS RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+LL +  G MVDEALAIL
Sbjct  477  IKLLCEGSPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRLLKDAGGGMVDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AILASH EGKVAIG A  + VL+ VI  GSPRN+EN+AA+L  LC+G+   ++ A++ G 
Sbjct  537  AILASHQEGKVAIGQAGPIPVLMEVIRTGSPRNRENSAAILWSLCTGDSEQLKIAKDSGA  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L DL+++GT+R +RKA  +LE + R 
Sbjct  597  EEALKDLSESGTDRAKRKAGTILELLQRL  625


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 0/130 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I   NKG  V AG +P ++ +L        + A A L
Sbjct  395  VELLSSTDSRTQEHAVTALLNLSINDSNKGTIVNAGAIPDIVDVLKNGSMEARENAAATL  454

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++  GSPR K++AA  + +L   + +   A   GI+
Sbjct  455  FSLSVVDENKVAIGAAGAIPALIKLLCEGSPRGKKDAATAIFNLSIYQGNKARAVRAGIV  514

Query  328  GPLLDLAQNG  299
             PL+ L ++ 
Sbjct  515  PPLMRLLKDA  524



>ref|XP_010067333.1| PREDICTED: U-box domain-containing protein 14 [Eucalyptus grandis]
 gb|KCW65447.1| hypothetical protein EUGRSUZ_G02864 [Eucalyptus grandis]
Length=633

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +A++AG+V  LM+LL +  G MVDEALAIL
Sbjct  479  IRLLCEGTPRGKKDAATAIFNLSIYQGNKARAIKAGIVGPLMRLLKDAGGGMVDEALAIL  538

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGKVAI  A+ + VLV VI  GSPRN+ENAAAVL  LCSG+ + +  A++LG 
Sbjct  539  AILASHPEGKVAISQAEPIPVLVEVIRTGSPRNRENAAAVLWSLCSGDVEQLKFAKDLGA  598

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L +L ++GT+R +RKA  LLE I R
Sbjct  599  EEVLKELTESGTDRAKRKAVTLLELIQR  626


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 71/130 (55%), Gaps = 0/130 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I   NKG  V AG +P ++ +L        + A A L
Sbjct  397  VDLLSSTDSRTQEHAVTALLNLSINDSNKGTIVNAGAIPDIVDVLKNGSMEARENAAATL  456

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++  G+PR K++AA  + +L   + +   A + GI+
Sbjct  457  FSLSVIDENKVAIGAAGAIPALIRLLCEGTPRGKKDAATAIFNLSIYQGNKARAIKAGIV  516

Query  328  GPLLDLAQNG  299
            GPL+ L ++ 
Sbjct  517  GPLMRLLKDA  526



>ref|XP_010253985.1| PREDICTED: U-box domain-containing protein 14-like [Nelumbo nucifera]
Length=626

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EGS RGKKDAATA+FNL IYQGNK +AVRAG+V  LM+LLT+  G MVDEALAIL
Sbjct  469  IDLLCEGSPRGKKDAATAIFNLSIYQGNKVRAVRAGIVVPLMKLLTDAGGGMVDEALAIL  528

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA H EGKVAIG A A+ VLV V+ +GSPRN+ENAAAVL  LC+ + QH+  A++ G 
Sbjct  529  AILACHQEGKVAIGQANAIPVLVEVMRSGSPRNRENAAAVLWSLCTCDMQHLQIARDHGA  588

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L +L++NGT+R +RKA  LLE I R
Sbjct  589  EEALKELSENGTDRAKRKAGNLLELIRR  616


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG +P ++ +L +      + A A L
Sbjct  387  VELLSSPDPRTQEHAVTALLNLSINETNKGIIVNAGAIPDIVDVLRKGSMEARENAAATL  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++  GSPR K++AA  + +L   + + V A   GI+
Sbjct  447  FSLSVIDENKVAIGAAGAIPALIDLLCEGSPRGKKDAATAIFNLSIYQGNKVRAVRAGIV  506

Query  328  GPLLDL  311
             PL+ L
Sbjct  507  VPLMKL  512



>ref|XP_009594953.1| PREDICTED: U-box domain-containing protein 14 [Nicotiana tomentosiformis]
Length=624

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+LL +P G M+DEALAIL
Sbjct  471  IDLLCQGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIVPPLMRLLKDPGGGMMDEALAIL  530

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AIG A+ + +LV VI  GS RN+ENAAA+L  LC+G+ Q++  A++LG+
Sbjct  531  AILASHQEGKAAIGQAEPIPILVEVIRTGSSRNRENAAAILWSLCTGDVQNLKVARDLGV  590

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L +L++NGT+R +RKA  +LE + R
Sbjct  591  EEVLKELSENGTDRAKRKAGSVLELLQR  618


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 71/129 (55%), Gaps = 0/129 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG +P ++ +L        + A A L
Sbjct  389  VELLSSSDSRTQEHAVTALLNLSINESNKGTIVNAGAIPDIVDVLRNGSMEARENAAATL  448

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++  G+PR K++AA  + +L   + + V A   GI+
Sbjct  449  FSLSVVDENKVAIGAAGAIPALIDLLCQGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIV  508

Query  328  GPLLDLAQN  302
             PL+ L ++
Sbjct  509  PPLMRLLKD  517



>ref|XP_010681970.1| PREDICTED: U-box domain-containing protein 11 [Beta vulgaris 
subsp. vulgaris]
Length=659

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++  LM++LTE  G MVDEAL IL
Sbjct  508  VELLQSGSPRGKKDAATALFNLCIYQGNKGRAVRAGIIAALMKMLTESNGTMVDEALTIL  567

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LA H E K+AI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  568  SVLAGHQEAKIAIVQACTIPVLIDLLRTGLPRNKENAAAILLALCKRDSENLACLSRLGA  627

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
              PL ++ ++GTER +RKA  LLE + + 
Sbjct  628  AIPLTEITKSGTERAKRKATSLLELLRKL  656



>ref|XP_002270524.1| PREDICTED: U-box domain-containing protein 14 [Vitis vinifera]
Length=628

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVRAG+V  LM+ L +  G MVDEALAIL
Sbjct  474  IDLLCQGTPRGKKDAATAIFNLAIYQGNKVRAVRAGIVVPLMRFLKDAGGGMVDEALAIL  533

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK+AIG A+   VLV VI  GSPRN+ENAAAVL  LC+G+ QH+  A+ELG 
Sbjct  534  AILASHQEGKLAIGQAEPFPVLVEVIKTGSPRNRENAAAVLWSLCTGDAQHLKIARELGA  593

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE + R 
Sbjct  594  EEALKELSENGTDRAKRKAGNILELLQRV  622



>gb|EYU30050.1| hypothetical protein MIMGU_mgv1a002663mg [Erythranthe guttata]
Length=649

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIY GNKG+AVRAG++  L+++LTE    MVDEAL IL
Sbjct  498  VDLLKNGSSRGKKDAATALFNLCIYHGNKGRAVRAGIITALLKMLTESSSVMVDEALTIL  557

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCS-GEQHVVEAQELGI  332
            ++L++H E K AI  A  + VLV ++  G PRNKENA A+L+ LC   ++++     LG 
Sbjct  558  SVLSTHQEAKAAIVKASTIPVLVDLVRTGLPRNKENACAILLSLCKRDKENLACLSRLGG  617

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+NGTER +RKA+ LLE + + 
Sbjct  618  VIPLTELAKNGTERAKRKASSLLENLRKL  646



>ref|XP_004236974.1| PREDICTED: U-box domain-containing protein 11-like [Solanum lycopersicum]
Length=647

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++P L+ +L +    MVDEAL IL
Sbjct  496  VELLQTGSTRGKKDAATALFNLCIYQGNKGRAVRAGIIPVLLMMLKDSSSCMVDEALTIL  555

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            ++LASH E K AI  A  + VL+ ++  G PRNKENAAA+L+ LC  +  ++   + LG 
Sbjct  556  SVLASHQEAKAAIAKASTIPVLIDLLRTGLPRNKENAAAILLSLCKRDTVNLSCLRRLGA  615

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
            + PL +LA  GTER +RKA  LLE + +
Sbjct  616  LIPLTELANTGTERAKRKATSLLEHLQK  643



>gb|KEH30893.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=484

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+ +LT+   +MVDEAL I+
Sbjct  333  VDLLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLNMLTDSSKSMVDEALTIM  392

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEA-QELGI  332
            ++LASH E KV+I  A  + VL+ ++  G PRNKENAAA+L+ LC  +   +     LG 
Sbjct  393  SVLASHQEAKVSIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDTDNLSCISRLGA  452

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+ GTER +RKA  LLE + + 
Sbjct  453  VIPLSELARTGTERAKRKATSLLEHLRKL  481


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 76/132 (58%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL       +++A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  251  VSLLTSEDVMTQENAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  310

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A++ LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  311  FSLSLADENKIIIGASGAISALVDLLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  370

Query  328  GPLLDLAQNGTE  293
              LL++  + ++
Sbjct  371  TALLNMLTDSSK  382



>gb|KDO64708.1| hypothetical protein CISIN_1g006669mg [Citrus sinensis]
Length=515

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RG+KDAATALFNLCIY GNKG+AVRAG++  L+++LT+ +  MVDEAL IL
Sbjct  361  VDLLQNGSTRGRKDAATALFNLCIYMGNKGRAVRAGIISALLKMLTDSRNCMVDEALTIL  420

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+PE K+AI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  421  SVLASNPEAKIAIVKASTIPVLIVLLRTGLPRNKENAAAILLSLCKRDTENLACISRLGA  480

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +L ++GTER +RKA  LLE + + 
Sbjct  481  VIPLTELTKSGTERAKRKATSLLEHLRKL  509


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       ++ A TA+ NL IY+ NKG  + AG +P+++Q+L               
Sbjct  279  VNLLTTDDVMTQEHAVTAILNLSIYENNKGLIMLAGAIPSIVQILRA-------------  325

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ +     G +
Sbjct  326  ----------------------------GSMEARENAAATLFSLSLLDENKIIIGASGAI  357

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
              L+DL QNG+ RGR+ AA  L
Sbjct  358  PALVDLLQNGSTRGRKDAATAL  379



>ref|XP_006361678.1| PREDICTED: U-box domain-containing protein 14-like [Solanum tuberosum]
Length=624

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL  G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP L++LL +P G M+DEALAIL
Sbjct  471  IDLLCHGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIVPPLVRLLKDPGGGMMDEALAIL  530

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AI  ++ + VLV VI  GSPRN+ENAAA+L  LC+G+ Q +   +ELG+
Sbjct  531  AILASHQEGKAAIAQSEPLPVLVEVIRTGSPRNRENAAAILWSLCTGDVQSLKIVRELGV  590

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE + R 
Sbjct  591  EEVLKELSENGTDRAKRKAGSVLELLQRV  619


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (57%), Gaps = 0/129 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I +GNKG  V AG +P ++ +L        + A A L
Sbjct  389  VELLSSSDSRTQEHAVTALLNLSINEGNKGTIVNAGAIPDIVDVLRNGSMEARENAAATL  448

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++ +G+PR K++AA  + +L   + + V A   GI+
Sbjct  449  FSLSVVDENKVAIGAAGAIPALIDLLCHGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIV  508

Query  328  GPLLDLAQN  302
             PL+ L ++
Sbjct  509  PPLVRLLKD  517



>ref|XP_010666679.1| PREDICTED: U-box domain-containing protein 14 [Beta vulgaris 
subsp. vulgaris]
Length=632

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVR G+V  LM+ L E  G MVDEALAIL
Sbjct  479  INLLIQGTPRGKKDAATAIFNLSIYQGNKVRAVREGIVGPLMRFLKEVDGGMVDEALAIL  538

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASHPEGK++IG A+ +++LV  I  GSPRN+ENAAAVL  LC G+ +H+  A+EL  
Sbjct  539  AILASHPEGKISIGQAEPISLLVEFIRTGSPRNRENAAAVLWSLCMGDVKHLKLAKELNA  598

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L +L++NGT+R +RKA+ LLE + R
Sbjct  599  EQVLKELSENGTDRAKRKASSLLEFLER  626



>ref|XP_008233282.1| PREDICTED: U-box domain-containing protein 14 [Prunus mume]
Length=628

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +A+RAG+V  LM+LL +    MVDEALAIL
Sbjct  474  IKLLCEGTPRGKKDAATAIFNLSIYQGNKARAIRAGIVAPLMRLLKDAGSGMVDEALAIL  533

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK+AI  A+ ++VLV VI  G PRN+ENAAAVL  LC+G+ Q +  A+ELG 
Sbjct  534  AILASHQEGKMAIAQAEPISVLVEVIRTGFPRNRENAAAVLWSLCTGDIQQLKLARELGA  593

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE++ R 
Sbjct  594  EEALKELSENGTDRAKRKAGNVLEQLQRV  622


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 71/130 (55%), Gaps = 0/130 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG +P ++ +L +      + A A L
Sbjct  392  VELLSSSDPRTQEHAVTALLNLSINESNKGAIVNAGAIPDIVDVLKKGSMEARENAAATL  451

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++  G+PR K++AA  + +L   + +   A   GI+
Sbjct  452  FSLSVVDENKVAIGAAGAIPSLIKLLCEGTPRGKKDAATAIFNLSIYQGNKARAIRAGIV  511

Query  328  GPLLDLAQNG  299
             PL+ L ++ 
Sbjct  512  APLMRLLKDA  521



>ref|XP_007157719.1| hypothetical protein PHAVU_002G092600g [Phaseolus vulgaris]
 gb|ESW29713.1| hypothetical protein PHAVU_002G092600g [Phaseolus vulgaris]
Length=656

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+++LT+   +MVDEAL I+
Sbjct  505  VELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLKMLTDSSKSMVDEALTIM  564

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LASH E K+AI  A  + VL+ ++  G PRNKENAAA+L+ LC  +  ++     LG 
Sbjct  565  SVLASHQEAKIAIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDADNLACISRLGA  624

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+ GTER +RKA  LLE + + 
Sbjct  625  VIPLSELARTGTERAKRKATSLLEHLRKL  653


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 72/132 (55%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       + +A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  423  VNLLTSEDVLTQDNAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  482

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  483  FSLSLADENKIIIGASGAIPALVELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  542

Query  328  GPLLDLAQNGTE  293
              LL +  + ++
Sbjct  543  TALLKMLTDSSK  554



>ref|XP_008364702.1| PREDICTED: U-box domain-containing protein 14 [Malus domestica]
Length=622

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+LL +    M DEALAIL
Sbjct  465  IKLLCEGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRLLKDAGSGMADEALAIL  524

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AI  A+ + VLV VI  G PRN+ENAAAVL  LC+G+ Q +  A+ELG 
Sbjct  525  AILASHQEGKAAIAQAEPIPVLVEVIRTGFPRNRENAAAVLWSLCTGDLQQLKLARELGA  584

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               + +L++NGTER +RKA  +LE + R
Sbjct  585  EEAMKELSENGTERAKRKAVSVLEFLQR  612



>emb|CDO99779.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 116/149 (78%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVR+G+VP L+ LL +P G MVDEALAIL
Sbjct  473  IDLLCQGTPRGKKDAATAIFNLSIYQGNKVRAVRSGIVPPLIGLLKDPSGGMVDEALAIL  532

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+SHPEGKVAIG A  + VLV VI   SPRN+ENAAA+L  LC+G+ Q++  A++LG 
Sbjct  533  AILSSHPEGKVAIGQADPIPVLVEVIRTSSPRNRENAAAILWSLCTGDGQYLKLAKDLGA  592

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L+++GT+R +RKA+ +LE + R 
Sbjct  593  EEVLRELSESGTDRAKRKASSVLELLQRV  621


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = -2

Query  682  LLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAILAI  503
            LL     R ++ A TAL NL I + NKG  V AG +P ++ +L        + A A L  
Sbjct  393  LLGSPDSRTQEHAVTALLNLSINEANKGTIVNAGAIPDIVDVLKVGSMEARENAAATLFS  452

Query  502  LASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIMGP  323
            L+   E KVAIG A A+  L+ ++  G+PR K++AA  + +L   + + V A   GI+ P
Sbjct  453  LSVVDENKVAIGAAGAIPALIDLLCQGTPRGKKDAATAIFNLSIYQGNKVRAVRSGIVPP  512

Query  322  LLDLAQN  302
            L+ L ++
Sbjct  513  LIGLLKD  519



>ref|XP_006495051.1| PREDICTED: U-box domain-containing protein 10-like, partial [Citrus 
sinensis]
Length=621

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RG+KDAATALFNLCIY GNKG+AVRAG++  L+++LT+ +  MVDEAL IL
Sbjct  467  VDLLQNGSTRGRKDAATALFNLCIYMGNKGRAVRAGIISALLKMLTDSRNCMVDEALTIL  526

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+PE K+AI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  527  SVLASNPEAKIAIVKASTIPVLIDLLRTGLPRNKENAAAILLSLCKRDTENLACISRLGA  586

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +L ++GTER +RKA  LLE + + 
Sbjct  587  VIPLTELTKSGTERAKRKATSLLEHLRKL  615


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       ++ A TA+ NL IY+ NKG  + AG +P+++Q+L               
Sbjct  385  VNLLTTDDVMTQEHAVTAILNLSIYENNKGLIMLAGAIPSIVQILRA-------------  431

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ +     G +
Sbjct  432  ----------------------------GSMEARENAAATLFSLSLLDENKIIIGASGAI  463

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
              L+DL QNG+ RGR+ AA  L
Sbjct  464  PALVDLLQNGSTRGRKDAATAL  485



>gb|KDO64707.1| hypothetical protein CISIN_1g006669mg [Citrus sinensis]
Length=636

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RG+KDAATALFNLCIY GNKG+AVRAG++  L+++LT+ +  MVDEAL IL
Sbjct  482  VDLLQNGSTRGRKDAATALFNLCIYMGNKGRAVRAGIISALLKMLTDSRNCMVDEALTIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+PE K+AI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  542  SVLASNPEAKIAIVKASTIPVLIVLLRTGLPRNKENAAAILLSLCKRDTENLACISRLGA  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +L ++GTER +RKA  LLE + + 
Sbjct  602  VIPLTELTKSGTERAKRKATSLLEHLRKL  630


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 59/142 (42%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       ++ A TA+ NL IY+ NKG  + AG +P+++Q+L               
Sbjct  400  VNLLTTDDVMTQEHAVTAILNLSIYENNKGLIMLAGAIPSIVQILRA-------------  446

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ +     G +
Sbjct  447  ----------------------------GSMEARENAAATLFSLSLLDENKIIIGASGAI  478

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
              L+DL QNG+ RGR+ AA  L
Sbjct  479  PALVDLLQNGSTRGRKDAATAL  500



>ref|XP_010552723.1| PREDICTED: U-box domain-containing protein 11 [Tarenaya hassleriana]
Length=616

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++  L+++LT     MVDEAL IL
Sbjct  465  VDLLQSGSARGKKDAATALFNLCIYQGNKGRAVRAGIITALVKMLTNSSHRMVDEALTIL  524

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+P+ K AI  AK +  L+ ++    PR++ENAAA+L+ LC  + ++V+    LG 
Sbjct  525  SVLASNPDAKAAIVKAKTIPALIHLLQTDQPRDRENAAAILLSLCKRDPENVIVIGRLGA  584

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
            + PL+DL++NGT R +RKA  LLE
Sbjct  585  VLPLMDLSRNGTARAKRKATSLLE  608



>ref|XP_011023140.1| PREDICTED: U-box domain-containing protein 11-like isoform X2 
[Populus euphratica]
Length=628

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++  L+ +LT+ +  M+DEAL IL
Sbjct  477  VELLENGSTRGKKDAATALFNLCIYQGNKGRAVRAGIITALLNMLTDSRNRMIDEALTIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+ E KVAI  A  + VL+ ++  G PRNKE+AAA+L+ LC  + +++     LG 
Sbjct  537  SVLASNQEAKVAIVKASTLPVLIDLLRTGGPRNKESAAAILLSLCKRDSENLACVSRLGA  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+ GTER +RKA  +LE + R 
Sbjct  597  VIPLTELAKGGTERAKRKATSMLEHLRRL  625


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 0/133 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL       +++  T++ NL IY+ NKG  + AG VP+++Q+L        + A A L
Sbjct  395  VSLLISEDTSIQENTVTSILNLSIYEDNKGLIMLAGAVPSIVQVLRTGSVEARENAAATL  454

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGS R K++AA  L +LC  + +   A   GI+
Sbjct  455  FSLSLADENKIIIGASGAIPALVELLENGSTRGKKDAATALFNLCIYQGNKGRAVRAGII  514

Query  328  GPLLDLAQNGTER  290
              LL++  +   R
Sbjct  515  TALLNMLTDSRNR  527



>ref|XP_010935715.1| PREDICTED: U-box domain-containing protein 12-like isoform X4 
[Elaeis guineensis]
Length=563

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +GS RGKKDAATALFNLCIYQGNK KAV+AG+V  LM+LL +P G M+DEALAIL
Sbjct  412  INLLCQGSLRGKKDAATALFNLCIYQGNKVKAVKAGIVEHLMRLLADPSGGMMDEALAIL  471

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA + +GK+AI  ++ + VLV V+ +GSPRN+ENAAAVL  LC+G+ Q +  A+E G 
Sbjct  472  AILAGNSDGKIAIALSEPIPVLVEVMRSGSPRNRENAAAVLWSLCTGDVQQLRAAREFGA  531

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +L + GT+R +RKA  LLE
Sbjct  532  EEALKELTETGTDRAKRKAGSLLE  555



>emb|CDY15272.1| BnaC06g07580D [Brassica napus]
Length=213

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 106/143 (74%), Gaps = 2/143 (1%)
 Frame = -2

Query  682  LLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGN-MVDEALAILA  506
            LL  G+ RGKKDAATAL NLCIYQGNKG+AVRAG+VP L+++LT+   + MVDE+L IL+
Sbjct  64   LLENGTPRGKKDAATALSNLCIYQGNKGRAVRAGIVPALVKMLTDSSSHRMVDESLTILS  123

Query  505  ILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGIM  329
            +LAS+ + K AI  A  +  L+G++  G  RN+ENAAA+L+ LC  + + +V    LG +
Sbjct  124  VLASNLDAKAAIVKANTLPALIGILQTGQARNRENAAAILLSLCKRDNEKLVAIGRLGAV  183

Query  328  GPLLDLAQNGTERGRRKAAQLLE  260
             PL+DL +NGTERG+RKA  LLE
Sbjct  184  VPLMDLTKNGTERGKRKATSLLE  206



>gb|KEH30892.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=652

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+ +LT+   +MVDEAL I+
Sbjct  501  VDLLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLNMLTDSSKSMVDEALTIM  560

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEA-QELGI  332
            ++LASH E KV+I  A  + VL+ ++  G PRNKENAAA+L+ LC  +   +     LG 
Sbjct  561  SVLASHQEAKVSIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDTDNLSCISRLGA  620

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+ GTER +RKA  LLE + + 
Sbjct  621  VIPLSELARTGTERAKRKATSLLEHLRKL  649


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 76/132 (58%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL       +++A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  419  VSLLTSEDVMTQENAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  478

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A++ LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  479  FSLSLADENKIIIGASGAISALVDLLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  538

Query  328  GPLLDLAQNGTE  293
              LL++  + ++
Sbjct  539  TALLNMLTDSSK  550



>ref|XP_006850733.1| hypothetical protein AMTR_s00025p00052670 [Amborella trichopoda]
 gb|ERN12314.1| hypothetical protein AMTR_s00025p00052670 [Amborella trichopoda]
Length=677

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EGS RGKKDAATALFNLCIYQGNK +AVRAG++  LM+LL +P   MVDEALAIL
Sbjct  514  IQLLCEGSTRGKKDAATALFNLCIYQGNKARAVRAGIMDPLMKLLADPNSGMVDEALAIL  573

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            A+LASH +GKVAIG + A+ VL+ ++  G   NKENAAA+L+ LC    +H+   Q LG 
Sbjct  574  AVLASHHDGKVAIGRSNAIPVLIDLLRTGLAHNKENAAAILLALCKKNPEHLKTLQRLGG  633

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
              PL +L +NGTER +RKA  LLE ++R 
Sbjct  634  FIPLSELVKNGTERAKRKAGYLLEHMSRL  662



>ref|XP_003607915.1| U-box domain-containing protein, partial [Medicago truncatula]
Length=605

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+ +LT+   +MVDEAL I+
Sbjct  454  VDLLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLNMLTDSSKSMVDEALTIM  513

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEA-QELGI  332
            ++LASH E KV+I  A  + VL+ ++  G PRNKENAAA+L+ LC  +   +     LG 
Sbjct  514  SVLASHQEAKVSIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDTDNLSCISRLGA  573

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+ GTER +RKA  LLE + + 
Sbjct  574  VIPLSELARTGTERAKRKATSLLEHLRKL  602


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 76/132 (58%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL       +++A T++ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  372  VSLLTSEDVMTQENAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  431

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A++ LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  432  FSLSLADENKIIIGASGAISALVDLLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  491

Query  328  GPLLDLAQNGTE  293
              LL++  + ++
Sbjct  492  TALLNMLTDSSK  503



>ref|XP_008789545.1| PREDICTED: U-box domain-containing protein 12 isoform X2 [Phoenix 
dactylifera]
Length=595

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL +GS RGKKDAATA+FNLCIYQGNK KAVRAG+V  LM+LL +P G MVDEALAI 
Sbjct  444  VDLLCQGSPRGKKDAATAIFNLCIYQGNKVKAVRAGLVEHLMRLLVDPGGGMVDEALAIS  503

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            A+LA HP+GK+AI  +  + VLV V+  G+PRN+ENAAAVL  LC+G+ Q +  A+E G 
Sbjct  504  AVLAGHPDGKLAIARSNPIPVLVEVMKTGTPRNRENAAAVLWSLCTGDAQQLRAARESGA  563

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +LA  GT R +RKA  LLE
Sbjct  564  EEALKELAGTGTSRAKRKAGSLLE  587



>ref|XP_011023132.1| PREDICTED: U-box domain-containing protein 11-like isoform X1 
[Populus euphratica]
Length=640

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++  L+ +LT+ +  M+DEAL IL
Sbjct  489  VELLENGSTRGKKDAATALFNLCIYQGNKGRAVRAGIITALLNMLTDSRNRMIDEALTIL  548

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+ E KVAI  A  + VL+ ++  G PRNKE+AAA+L+ LC  + +++     LG 
Sbjct  549  SVLASNQEAKVAIVKASTLPVLIDLLRTGGPRNKESAAAILLSLCKRDSENLACVSRLGA  608

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+ GTER +RKA  +LE + R 
Sbjct  609  VIPLTELAKGGTERAKRKATSMLEHLRRL  637


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 0/133 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL       +++  T++ NL IY+ NKG  + AG VP+++Q+L        + A A L
Sbjct  407  VSLLISEDTSIQENTVTSILNLSIYEDNKGLIMLAGAVPSIVQVLRTGSVEARENAAATL  466

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGS R K++AA  L +LC  + +   A   GI+
Sbjct  467  FSLSLADENKIIIGASGAIPALVELLENGSTRGKKDAATALFNLCIYQGNKGRAVRAGII  526

Query  328  GPLLDLAQNGTER  290
              LL++  +   R
Sbjct  527  TALLNMLTDSRNR  539



>ref|XP_008789544.1| PREDICTED: U-box domain-containing protein 12 isoform X1 [Phoenix 
dactylifera]
Length=634

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL +GS RGKKDAATA+FNLCIYQGNK KAVRAG+V  LM+LL +P G MVDEALAI 
Sbjct  483  VDLLCQGSPRGKKDAATAIFNLCIYQGNKVKAVRAGLVEHLMRLLVDPGGGMVDEALAIS  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            A+LA HP+GK+AI  +  + VLV V+  G+PRN+ENAAAVL  LC+G+ Q +  A+E G 
Sbjct  543  AVLAGHPDGKLAIARSNPIPVLVEVMKTGTPRNRENAAAVLWSLCTGDAQQLRAARESGA  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +LA  GT R +RKA  LLE
Sbjct  603  EEALKELAGTGTSRAKRKAGSLLE  626



>ref|XP_002986139.1| ubiquitin-protein ligase, PUB13 [Selaginella moellendorffii]
 gb|EFJ12670.1| ubiquitin-protein ligase, PUB13 [Selaginella moellendorffii]
Length=639

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EG+ RGKKDAATALFNL IYQGNK KAVRAGVVP LM+LL +P   MVDEALAIL
Sbjct  483  VNLLREGTPRGKKDAATALFNLSIYQGNKAKAVRAGVVPPLMELL-DPNAGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA+H EG+VAIG    + +LV +I +GS RNKENAAAVL+ L   +  H+V AQ+   
Sbjct  542  AILATHQEGRVAIGQESTIPLLVELIRSGSARNKENAAAVLLALGQNDAAHLVTAQQYDA  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
              PL +L QNGT R RRKA+ +LE +++
Sbjct  602  GVPLAELVQNGTSRARRKASLILELMHK  629



>ref|XP_006841267.1| hypothetical protein AMTR_s00135p00108920 [Amborella trichopoda]
 gb|ERN02942.1| hypothetical protein AMTR_s00135p00108920 [Amborella trichopoda]
Length=636

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNK +AVRAG++  LM +LT+    MVDEAL IL
Sbjct  485  VGLLCSGSPRGKKDAATALFNLCIYQGNKARAVRAGILNPLMTMLTDTGNGMVDEALTIL  544

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            A++ASHPEGKVAI  A A+ VLV +   G PRNKENA A+L+ LC  + +++   + LG 
Sbjct  545  AVIASHPEGKVAIAKANAIPVLVDLTRTGLPRNKENAVAILLTLCKKDGENLACVKRLGA  604

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
              PL +L ++GTER +RKAA LLE + R 
Sbjct  605  YIPLTELVKSGTERAKRKAASLLEHMGRL  633



>ref|XP_002984952.1| ubiquitin-protein ligase, PUB13 [Selaginella moellendorffii]
 gb|EFJ13827.1| ubiquitin-protein ligase, PUB13 [Selaginella moellendorffii]
Length=639

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL EG+ RGKKDAATALFNL IYQGNK KAVRAGVVP LM+LL +P   MVDEALAIL
Sbjct  483  VNLLREGTPRGKKDAATALFNLSIYQGNKAKAVRAGVVPPLMELL-DPNAGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA+H EG+VAIG    + +LV +I +GS RNKENAAAVL+ L   +  H+V AQ+   
Sbjct  542  AILATHQEGRVAIGQESTIPLLVELIRSGSARNKENAAAVLLALGQNDAAHLVTAQQYDA  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
              PL +L QNGT R RRKA+ +LE +++
Sbjct  602  GVPLAELVQNGTSRARRKASLILELMHK  629



>ref|XP_010274639.1| PREDICTED: U-box domain-containing protein 11-like [Nelumbo nucifera]
Length=644

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 112/152 (74%), Gaps = 4/152 (3%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIY+GNKG+AVRAG++  LM++LT+    M+DEAL IL
Sbjct  493  VELLLNGSSRGKKDAATALFNLCIYRGNKGRAVRAGILVPLMKMLTDSSSCMIDEALTIL  552

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLC-SGEQHVVEAQELGI  332
            ++L SHPEGKVAIG A  + VL+ ++  G PRNKENAAA+L+ LC    +++V    LG 
Sbjct  553  SVLVSHPEGKVAIGKANTITVLLDILTTGMPRNKENAAAILLALCKKNAENLVHVGRLGA  612

Query  331  MGPLLDLAQNGTERGRRKAAQLLE---KINRF  245
              PL  LA++GTER +RKA+ LLE   KI +F
Sbjct  613  DVPLTVLAKSGTERAKRKASSLLELLHKIRQF  644



>ref|XP_004505257.1| PREDICTED: U-box domain-containing protein 11-like [Cicer arietinum]
Length=652

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+ +LT+   +MVDEAL I+
Sbjct  501  VELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGIITALLNMLTDSSKSMVDEALTIM  560

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEA-QELGI  332
            ++LASH E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  +   +     LG 
Sbjct  561  SVLASHLEAKVAIVKASTIPVLIDLLRTGLPRNKENAAAILLALCKRDTDNLSCISRLGA  620

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+ GTER +RKA  LLE + + 
Sbjct  621  VIPLSELARTGTERAKRKATSLLEHLRKL  649


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 74/132 (56%), Gaps = 0/132 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       +++A TA+ NL IY+ NKG  + AG +P+++Q+L        + A A L
Sbjct  419  VNLLTSEDVMTQENAVTAILNLSIYENNKGLIMLAGAIPSIVQVLRAGTMEARENAAATL  478

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGSPR K++AA  L +LC  + +   A   GI+
Sbjct  479  FSLSLADENKIIIGASGAIPALVELLQNGSPRGKKDAATALFNLCIYQGNKGRAIRAGII  538

Query  328  GPLLDLAQNGTE  293
              LL++  + ++
Sbjct  539  TALLNMLTDSSK  550



>ref|XP_004250056.1| PREDICTED: U-box domain-containing protein 14 isoform X1 [Solanum 
lycopersicum]
Length=624

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 112/149 (75%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL  G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP L++LL +P G M+DEALAIL
Sbjct  471  IDLLCHGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIVPPLVRLLKDPGGGMMDEALAIL  530

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AI  ++ + VLV VI  GSPRN+ENAAA+L  LC+G+ Q +   +ELG 
Sbjct  531  AILASHQEGKAAIAQSEPLPVLVQVIRTGSPRNRENAAAILWSLCTGDVQSLKIVRELGA  590

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE + R 
Sbjct  591  EEVLKELSENGTDRAKRKAGSVLELLQRV  619


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 72/129 (56%), Gaps = 0/129 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG +P ++ +L        + A A L
Sbjct  389  VELLSSSDSRTQEHAVTALLNLSINESNKGTIVNAGAIPDIVDVLRNGSMEARENAAATL  448

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++ +G+PR K++AA  + +L   + + V A   GI+
Sbjct  449  FSLSVVDENKVAIGAAGAIPALIDLLCHGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIV  508

Query  328  GPLLDLAQN  302
             PL+ L ++
Sbjct  509  PPLVRLLKD  517



>ref|XP_010935713.1| PREDICTED: U-box domain-containing protein 12-like isoform X2 
[Elaeis guineensis]
Length=605

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +GS RGKKDAATALFNLCIYQGNK KAV+AG+V  LM+LL +P G M+DEALAIL
Sbjct  454  INLLCQGSLRGKKDAATALFNLCIYQGNKVKAVKAGIVEHLMRLLADPSGGMMDEALAIL  513

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA + +GK+AI  ++ + VLV V+ +GSPRN+ENAAAVL  LC+G+ Q +  A+E G 
Sbjct  514  AILAGNSDGKIAIALSEPIPVLVEVMRSGSPRNRENAAAVLWSLCTGDVQQLRAAREFGA  573

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +L + GT+R +RKA  LLE
Sbjct  574  EEALKELTETGTDRAKRKAGSLLE  597



>emb|CDY04746.1| BnaC05g18430D [Brassica napus]
Length=609

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGN-MVDEALAI  512
            V LL  G+ RGKKDAATALFNLCIYQGNKG+AVRAG+VP L+++L++   + MVDEAL I
Sbjct  457  VDLLENGTPRGKKDAATALFNLCIYQGNKGRAVRAGIVPALVKMLSDSSSHRMVDEALTI  516

Query  511  LAILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELG  335
            L++LAS+ + K AI  A  +  L+G++  G  RN+ENAAA+L+ LC  + + +V    LG
Sbjct  517  LSVLASNLDAKAAIVKANTLPALIGILQTGQARNRENAAAILLSLCKRDTEKLVSIGRLG  576

Query  334  IMGPLLDLAQNGTERGRRKAAQLLE  260
             + PL+DL+ NGTERG+RKA  LLE
Sbjct  577  AVVPLMDLSNNGTERGKRKATSLLE  601



>ref|XP_009115567.1| PREDICTED: U-box domain-containing protein 11 [Brassica rapa]
Length=609

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGN-MVDEALAI  512
            V LL  G+ RGKKDAATALFNLCIYQGNKG+AVRAG+VP L+++L++   + MVDEAL I
Sbjct  458  VDLLENGTPRGKKDAATALFNLCIYQGNKGRAVRAGIVPALVKMLSDSSSHRMVDEALTI  517

Query  511  LAILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELG  335
            L++LAS+ + K AI  A  +  L+G++  G  RN+ENAAA+L+ LC  + + +V    LG
Sbjct  518  LSVLASNLDAKAAIVKANTLPALIGILQTGQARNRENAAAILLSLCKRDTEKLVSIGRLG  577

Query  334  IMGPLLDLAQNGTERGRRKAAQLLE  260
             + PL+DL+ NGTERG+RKA  LLE
Sbjct  578  AVVPLMDLSNNGTERGKRKATSLLE  602



>ref|XP_010935712.1| PREDICTED: U-box domain-containing protein 12-like isoform X1 
[Elaeis guineensis]
Length=642

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +GS RGKKDAATALFNLCIYQGNK KAV+AG+V  LM+LL +P G M+DEALAIL
Sbjct  491  INLLCQGSLRGKKDAATALFNLCIYQGNKVKAVKAGIVEHLMRLLADPSGGMMDEALAIL  550

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA + +GK+AI  ++ + VLV V+ +GSPRN+ENAAAVL  LC+G+ Q +  A+E G 
Sbjct  551  AILAGNSDGKIAIALSEPIPVLVEVMRSGSPRNRENAAAVLWSLCTGDVQQLRAAREFGA  610

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +L + GT+R +RKA  LLE
Sbjct  611  EEALKELTETGTDRAKRKAGSLLE  634



>emb|CDY21412.1| BnaA09g30150D [Brassica napus]
Length=608

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGN-MVDEALAI  512
            V LL  G+ RGKKDAATALFNLCIYQGNKG+AVRAG+VP L+++L++   + MVDEAL I
Sbjct  457  VDLLENGTPRGKKDAATALFNLCIYQGNKGRAVRAGIVPALVKMLSDSSSHRMVDEALTI  516

Query  511  LAILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELG  335
            L++LAS+ + K AI  A  +  L+G++  G  RN+ENAAA+L+ LC  + + +V    LG
Sbjct  517  LSVLASNLDAKAAIVKANTLPALIGILQTGQARNRENAAAILLSLCKRDTEKLVSIGRLG  576

Query  334  IMGPLLDLAQNGTERGRRKAAQLLE  260
             + PL+DL+ NGTERG+RKA  LLE
Sbjct  577  AVVPLMDLSNNGTERGKRKATSLLE  601



>ref|XP_010935714.1| PREDICTED: U-box domain-containing protein 12-like isoform X3 
[Elaeis guineensis]
Length=603

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +GS RGKKDAATALFNLCIYQGNK KAV+AG+V  LM+LL +P G M+DEALAIL
Sbjct  452  INLLCQGSLRGKKDAATALFNLCIYQGNKVKAVKAGIVEHLMRLLADPSGGMMDEALAIL  511

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA + +GK+AI  ++ + VLV V+ +GSPRN+ENAAAVL  LC+G+ Q +  A+E G 
Sbjct  512  AILAGNSDGKIAIALSEPIPVLVEVMRSGSPRNRENAAAVLWSLCTGDVQQLRAAREFGA  571

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +L + GT+R +RKA  LLE
Sbjct  572  EEALKELTETGTDRAKRKAGSLLE  595



>ref|XP_006360416.1| PREDICTED: U-box domain-containing protein 10-like [Solanum tuberosum]
Length=647

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG++P L+ +L +    MVDEAL IL
Sbjct  496  VELLQTGSTRGKKDAATALFNLCIYQGNKGRAVRAGIIPALLMMLKDSSNCMVDEALTIL  555

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQ-HVVEAQELGI  332
            ++LASH E K AI  A  + VL+ ++  G PRNKENAAA+L+ LC  +  ++     LG 
Sbjct  556  SVLASHQEAKAAIAKASTIPVLIDLLRTGLPRNKENAAAILLSLCKRDTVNLSCLCRLGA  615

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
            + PL +LA  GTER +RKA  LLE + +
Sbjct  616  LIPLTELANTGTERAKRKATSLLEHLRK  643



>ref|XP_006448286.1| hypothetical protein CICLE_v10014584mg [Citrus clementina]
 gb|ESR61526.1| hypothetical protein CICLE_v10014584mg [Citrus clementina]
Length=636

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RG+KDAATALFNLCIY GNKG+AVRAG++  L+++LT+ +  MVDEAL IL
Sbjct  482  VDLLQIGSTRGRKDAATALFNLCIYMGNKGRAVRAGIISALLKMLTDSRNCMVDEALTIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+PE K+AI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  542  SVLASNPEAKIAIVKASTIPVLIDLLRTGLPRNKENAAAILLSLCKRDTENLACISRLGA  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +L ++GTER +RKA  LLE + + 
Sbjct  602  VIPLTELTKSGTERAKRKATSLLEHLRKL  630



>ref|XP_006436479.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 ref|XP_006436480.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 ref|XP_006436482.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|ESR49719.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|ESR49720.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|ESR49722.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|KDO48790.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
 gb|KDO48791.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
 gb|KDO48792.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
Length=389

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 112/149 (75%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+ L +  G MVDEALAIL
Sbjct  234  IRLLCDGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAIL  293

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AILASH EGK AIG A+ + VL+ VI  GSPRN+ENAAAVL  +C+G+   ++ A+EL  
Sbjct  294  AILASHQEGKTAIGQAEPIPVLMEVIRTGSPRNRENAAAVLWAICTGDAEQLKIARELDA  353

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L+++GT+R +RKA  +LE + R 
Sbjct  354  EEALKELSESGTDRAKRKAGSILELLQRI  382



>emb|CDX87794.1| BnaC02g31550D [Brassica napus]
Length=205

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -2

Query  682  LLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGN-MVDEALAILA  506
            LL  G+ RGKKDAATAL NLCIYQGNKG+AVRAG+VP L+++L++   + MVDEAL IL+
Sbjct  56   LLENGTPRGKKDAATALSNLCIYQGNKGRAVRAGIVPALVKMLSDSSSHRMVDEALTILS  115

Query  505  ILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGIM  329
            +LAS+ + K  I  A  +  L+G++  G  RN+ENAAA+L+ LC  + + +V    LG +
Sbjct  116  VLASNLDAKAVIVKANTLPALIGILQTGQARNRENAAAILLSLCKRDNEKLVAIGRLGAV  175

Query  328  GPLLDLAQNGTERGRRKAAQLLE  260
             PL+DL +NGTERG+RK   LLE
Sbjct  176  VPLMDLTKNGTERGKRKTTSLLE  198



>ref|XP_004307361.1| PREDICTED: U-box domain-containing protein 14 [Fragaria vesca 
subsp. vesca]
Length=627

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +AVRAG+V  LM LL +    MVDEALAIL
Sbjct  473  IKLLCEGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVTPLMSLLKDAGSGMVDEALAIL  532

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGKVAI  A A+ +LV VI  G PRN+ENAAAVL  LC+G+ Q +  A+ELG 
Sbjct  533  AILASHQEGKVAIAQADAIPILVEVIRTGFPRNRENAAAVLWSLCTGDLQQLKLARELGA  592

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L +NGT+R +RKA  +LE + R 
Sbjct  593  EEALQELTENGTDRAKRKAGNVLELLQRI  621



>ref|XP_009103205.1| PREDICTED: U-box domain-containing protein 11-like [Brassica 
rapa]
Length=588

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTE--PQGNMVDEALA  515
            V LL  G+ RGKKDAATALFNLCIYQGNKG+AVRAG+VP L+++L+E   Q  MVDEAL 
Sbjct  436  VDLLENGTTRGKKDAATALFNLCIYQGNKGRAVRAGIVPALVKMLSETSSQRMMVDEALT  495

Query  514  ILAILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQEL  338
            IL++LAS+ + K A+  A  +  L+G++  G  RN+ENAAA+L+ LC  + + +V    L
Sbjct  496  ILSVLASNLDAKSAMVKANTLPALIGILQTGQGRNRENAAAILLSLCKRDNERLVLIGRL  555

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLE  260
            G + PL++L++NGTERG+RKA  LLE
Sbjct  556  GAVVPLMELSKNGTERGQRKAVSLLE  581



>ref|XP_004298462.1| PREDICTED: U-box domain-containing protein 11 [Fragaria vesca 
subsp. vesca]
Length=622

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+A+RAG++  L+++LT+    MVDEAL I+
Sbjct  471  VELLQNGSTRGKKDAATALFNLCIYQGNKGRALRAGIITALLKMLTDSSNCMVDEALTIM  530

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LA+H E KV I  A  + VL+ ++  G PRNKENA+A+L+ LC  E +++     LG 
Sbjct  531  SVLANHQEAKVTIVKAGTIPVLIDLLRTGLPRNKENASAILLALCKRETENLACLSRLGA  590

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +L ++GTER +RKA+ LLE + + 
Sbjct  591  VIPLTELTKSGTERAKRKASSLLEHLRKL  619


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 71/131 (54%), Gaps = 0/131 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       +++A T++ NL IY+ NKG  + AG VP+++Q+L        + A A +
Sbjct  389  VNLLTVDDGLTQENAVTSILNLSIYENNKGLIMLAGAVPSIVQVLRSGSMEARENAAATI  448

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGS R K++AA  L +LC  + +   A   GI+
Sbjct  449  FSLSLADENKIIIGASGAIQALVELLQNGSTRGKKDAATALFNLCIYQGNKGRALRAGII  508

Query  328  GPLLDLAQNGT  296
              LL +  + +
Sbjct  509  TALLKMLTDSS  519



>gb|EYU39871.1| hypothetical protein MIMGU_mgv1a002720mg [Erythranthe guttata]
Length=644

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 112/149 (75%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL  G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP L+ LL +  G MVDE+LAIL
Sbjct  490  IDLLCHGTPRGKKDAATAIFNLSIYQGNKVRAVRAGIVPPLIGLLKDQGGGMVDESLAIL  549

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AILASH EGKVA+G A+ + +LV VI  GSPRN+ENAAA+L  LC+G    ++ A+ELG 
Sbjct  550  AILASHQEGKVALGQAEPIPILVEVIRTGSPRNRENAAAILWSLCTGNSQCLKLARELGA  609

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE I R 
Sbjct  610  EEALKELSENGTDRAKRKAGSVLELIQRV  638


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 58/139 (42%), Gaps = 41/139 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I++ NKG  V AG +  ++ +L               
Sbjct  408  VELLSSQDLRTQEHAVTALLNLSIHESNKGIIVNAGAISDIVDVLK--------------  453

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                       NGS   +ENAAA L  L   +++ V     G +
Sbjct  454  ---------------------------NGSTEARENAAATLFSLSVVDENKVAIGAAGAI  486

Query  328  GPLLDLAQNGTERGRRKAA  272
             PL+DL  +GT RG++ AA
Sbjct  487  APLIDLLCHGTPRGKKDAA  505



>emb|CDP00753.1| unnamed protein product [Coffea canephora]
Length=656

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RG+KDAATALFNLCIYQGNKG+AVRAG++  L+++L++    MVDEAL IL
Sbjct  505  VDLLQNGSTRGRKDAATALFNLCIYQGNKGRAVRAGIITALLKMLSDTSSGMVDEALTIL  564

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEA-QELGI  332
            ++LA + E K AI  A  + VL+ ++  G PRNKENAAA+L+ LC  +Q  +     LG 
Sbjct  565  SVLAGNQEAKAAIVKASTIPVLIDLMRTGLPRNKENAAAILLCLCKRDQDNLACLSRLGA  624

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
            + PL +L +NGTER +RKA  LLE + R
Sbjct  625  VIPLTELTKNGTERAKRKANSLLEHLRR  652


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 61/142 (43%), Gaps = 41/142 (29%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V+LL     + ++ A T++ NL I++ NKG  + AG VP+++Q+L               
Sbjct  423  VSLLACEDNQTQEHAVTSILNLSIFENNKGLIMLAGAVPSIVQILRA-------------  469

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
                                        GS   +ENAAA L  L   +++ +     G +
Sbjct  470  ----------------------------GSMEARENAAATLFSLSLADENKIIIGASGAI  501

Query  328  GPLLDLAQNGTERGRRKAAQLL  263
              L+DL QNG+ RGR+ AA  L
Sbjct  502  PALVDLLQNGSTRGRKDAATAL  523



>ref|XP_010504312.1| PREDICTED: U-box domain-containing protein 14 [Camelina sativa]
Length=631

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATA+FNLCIYQGNK +AV+ G+V  L +LL +  G MVDEALAIL
Sbjct  474  ISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRLLKDAGGGMVDEALAIL  533

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AIL+++ EGK AI  A ++ VLV +I  GSPRN+ENAAA+L +LC G    +  A+E+G 
Sbjct  534  AILSTNQEGKTAIAEADSIPVLVDIIRTGSPRNRENAAAILWYLCIGNMERLNVAREVGA  593

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L +NGT+R +RKAA LLE I + 
Sbjct  594  DIALKELTENGTDRAKRKAASLLELIQQI  622



>gb|KJB73521.1| hypothetical protein B456_011G237300 [Gossypium raimondii]
Length=637

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EGS RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+LL +  G MVDEALAIL
Sbjct  477  IKLLCEGSPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRLLKDAGGGMVDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EG+ AIG A  + VL+ VI  GSPRN+ENAAAVL  LC+   + +  A++ G 
Sbjct  537  AILASHHEGRAAIGQADPIPVLLEVIRTGSPRNRENAAAVLWSLCTSNLEQLKIAKDFGA  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L DL++ GT+R +RKA  +LE + + 
Sbjct  597  EEALKDLSETGTDRAKRKAGSILELLQQL  625



>ref|XP_010940632.1| PREDICTED: U-box domain-containing protein 12 [Elaeis guineensis]
Length=634

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATA+FNLCIYQGNK KAV+AG+V  LM+LL +P G MVDEALAI+
Sbjct  483  VDLLRRGSPRGKKDAATAIFNLCIYQGNKVKAVKAGIVEHLMRLLVDPGGGMVDEALAIV  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA HP+GK+AI  +  + VLV ++ +GS RN+ENAAAVL  LC+G+ Q +  A+E G 
Sbjct  543  AILAGHPDGKLAIAQSNPIPVLVEMVKSGSSRNRENAAAVLWSLCTGDAQQLRAARESGA  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +L   GT R +RKA  LLE
Sbjct  603  EEALKELTGTGTSRAKRKAGSLLE  626



>ref|XP_010427209.1| PREDICTED: U-box domain-containing protein 14-like [Camelina 
sativa]
Length=632

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATA+FNLCIYQGNK +AV+ G+V  L +LL +  G MVDEALAIL
Sbjct  475  ISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRLLKDAGGGMVDEALAIL  534

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AIL+++ EGK AI  A ++ VLV +I  GSPRN+ENAAA+L +LC G    +  A+E+G 
Sbjct  535  AILSTNQEGKTAIAEADSIPVLVDIIRTGSPRNRENAAAILWYLCIGNMERLNVAREVGA  594

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L +NGT+R +RKAA LLE I + 
Sbjct  595  NIALKELTENGTDRAKRKAASLLELIQQI  623



>ref|XP_007045104.1| U-box domain-containing protein 10 [Theobroma cacao]
 gb|EOY00936.1| U-box domain-containing protein 10 [Theobroma cacao]
Length=634

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNKG+AVRAG+V  L+++LT+ +  MVDEAL IL
Sbjct  483  VDLLQHGSARGKKDAATALFNLCIYQGNKGRAVRAGIVTALLKMLTDSRNCMVDEALTIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+ + K AI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  543  SVLASNHDAKAAIVKASTIPVLIDLLRTGLPRNKENAAAILLSLCKRDSENLACISRLGA  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
              PL +L ++GTER +RKA  LLE +++ 
Sbjct  603  AIPLTELTKSGTERAKRKATSLLEHLHKL  631



>ref|XP_010516027.1| PREDICTED: U-box domain-containing protein 14-like [Camelina 
sativa]
Length=631

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATA+FNLCIYQGNK +AV+ G+V  L +LL +  G MVDEALAIL
Sbjct  474  ISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRLLKDAGGGMVDEALAIL  533

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AIL+++ EGK AI  A ++ VLV +I  GSPRN+ENAAA+L +LC G    +  A+E+G 
Sbjct  534  AILSTNQEGKAAIAEADSIPVLVDIIRTGSPRNRENAAAILWYLCIGNMERLNVAREVGA  593

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L +NGT+R +RKAA LLE I + 
Sbjct  594  DIALKELTENGTDRAKRKAASLLELIQQI  622



>emb|CAB41099.1| putative protein [Arabidopsis thaliana]
Length=639

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATA+FNLCIYQGNK +AV+ G+V  L +LL +  G MVDEALAIL
Sbjct  482  ISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRLLKDAGGGMVDEALAIL  541

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+++ EGK AI  A+++ VLV +I  GSPRN+ENAAA+L +LC G  + +  A+E+G 
Sbjct  542  AILSTNQEGKTAIAEAESIPVLVEIIRTGSPRNRENAAAILWYLCIGNIERLNVAREVGA  601

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L +L +NGT+R +RKAA LLE I +
Sbjct  602  DVALKELTENGTDRAKRKAASLLELIQQ  629



>ref|NP_191045.2| U-box domain-containing protein 14 [Arabidopsis thaliana]
 sp|Q8VZ40.1|PUB14_ARATH RecName: Full=U-box domain-containing protein 14; AltName: Full=E3 
ubiquitin-protein ligase PUB14; AltName: Full=Plant U-box 
protein 14; AltName: Full=Prototypical U-box domain protein 
14 [Arabidopsis thaliana]
 gb|AAL38755.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20180.1| unknown protein [Arabidopsis thaliana]
 gb|AEE79300.1| U-box domain-containing protein 14 [Arabidopsis thaliana]
Length=632

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATA+FNLCIYQGNK +AV+ G+V  L +LL +  G MVDEALAIL
Sbjct  475  ISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRLLKDAGGGMVDEALAIL  534

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL+++ EGK AI  A+++ VLV +I  GSPRN+ENAAA+L +LC G  + +  A+E+G 
Sbjct  535  AILSTNQEGKTAIAEAESIPVLVEIIRTGSPRNRENAAAILWYLCIGNIERLNVAREVGA  594

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L +L +NGT+R +RKAA LLE I +
Sbjct  595  DVALKELTENGTDRAKRKAASLLELIQQ  622



>ref|XP_010112203.1| U-box domain-containing protein 14 [Morus notabilis]
 gb|EXC32912.1| U-box domain-containing protein 14 [Morus notabilis]
Length=623

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +AVRAG+V  LM+LL +  G MVDEALAIL
Sbjct  471  IKLLCEGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVDPLMRLLKDAGGGMVDEALAIL  530

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AI  A+ + VLV V+  GSPRN+ENAAAVL  L  G+ Q +  A+ELG 
Sbjct  531  AILASHQEGKTAISQAEPIHVLVEVVRTGSPRNRENAAAVLWSLFIGDPQQLKLARELGA  590

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE + R 
Sbjct  591  EEVLKELSENGTDRAKRKAGSILELLQRI  619



>ref|XP_010557715.1| PREDICTED: U-box domain-containing protein 14 [Tarenaya hassleriana]
Length=628

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATALFNLCIYQGNK +AV+ G+V  LM+LL +  G MVDEALAIL
Sbjct  473  ISLLEEGTRRGKKDAATALFNLCIYQGNKARAVKGGIVEPLMRLLKDAGGGMVDEALAIL  532

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL++H EGK  I  A+ + VLV ++  GSPRN+EN  AVL +LC G  + +  A+ +G 
Sbjct  533  AILSTHQEGKNMIAQAEPIPVLVEIVRTGSPRNRENGVAVLWYLCVGNVERLKIARGVGA  592

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +L++NGT+R +RKAA LLE
Sbjct  593  DAALKELSENGTDRAKRKAASLLE  616


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 73/129 (57%), Gaps = 0/129 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I +GNKG  V AG +P ++++L        + A A L
Sbjct  391  VELLSSPDPRTQEHAVTALLNLSINEGNKGAIVNAGAIPDIVEVLKNGSMEARENAAATL  450

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   + KVAIG A A+  L+ ++  G+ R K++AA  L +LC  + +   A + GI+
Sbjct  451  FSLSVIDDNKVAIGAAGAIQSLISLLEEGTRRGKKDAATALFNLCIYQGNKARAVKGGIV  510

Query  328  GPLLDLAQN  302
             PL+ L ++
Sbjct  511  EPLMRLLKD  519



>ref|XP_004142402.1| PREDICTED: U-box domain-containing protein 14-like [Cucumis sativus]
 gb|KGN52247.1| hypothetical protein Csa_5G622620 [Cucumis sativus]
Length=627

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            +TLL EG+ RGKKDAATA+FNL IYQGNK +A+RAG+V  LM  L +  G MVDEALAIL
Sbjct  472  ITLLREGTPRGKKDAATAIFNLSIYQGNKARAIRAGIVNPLMGFLKDAGGGMVDEALAIL  531

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA+H EGK AIG A+ +A+L+  I  GSPRN+ENAAAVL  LCS + + +  A+E G 
Sbjct  532  AILATHHEGKTAIGEAEPMAILLEFIRTGSPRNRENAAAVLWSLCSTDFEQLKLAREHGA  591

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L ++++NGTER +RKA  +LE   RF
Sbjct  592  EEALKEVSENGTERAKRKAGSILELFQRF  620



>ref|XP_002876275.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52534.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=631

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATA+FNLCIYQGNK +AV+ G+V  L +LL +  G MVDEALAIL
Sbjct  474  ISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRLLKDAGGGMVDEALAIL  533

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AIL+++ EGK AI  A+++ VLV +I  GSPRN+ENAAA+L +LC G    +  A+E+G 
Sbjct  534  AILSTNQEGKAAIAEAESIPVLVEIIRTGSPRNRENAAAILWYLCIGNMERLNVAREVGA  593

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L +L +NGT+R +RKAA LLE I +
Sbjct  594  DVALKELTENGTDRAKRKAASLLELIQQ  621



>ref|XP_004157535.1| PREDICTED: U-box domain-containing protein 14-like [Cucumis sativus]
Length=627

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            +TLL EG+ RGKKDAATA+FNL IYQGNK +A+RAG+V  LM  L +  G MVDEALAIL
Sbjct  472  ITLLREGTPRGKKDAATAIFNLSIYQGNKARAIRAGIVNPLMGFLKDAGGGMVDEALAIL  531

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILA+H EGK AIG A+ +A+L+  I  GSPRN+ENAAAVL  LCS + + +  A+E G 
Sbjct  532  AILATHHEGKTAIGEAEPMAILLEFIRTGSPRNRENAAAVLWSLCSTDFEQLKLAREHGA  591

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L ++++NGTER +RKA  +LE   RF
Sbjct  592  EEALKEVSENGTERAKRKAGSILELFQRF  620



>gb|ACN40705.1| unknown [Picea sitchensis]
Length=497

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL +G+ RGKKDAATA+FNL IYQGNK +AVRAGVVP L+ LL +    MVDEALAIL
Sbjct  345  VDLLRDGTVRGKKDAATAIFNLSIYQGNKFRAVRAGVVPPLIALLVDQSIGMVDEALAIL  404

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHL-CSGEQHVVEAQELGI  332
            AILA+H EG++AIG   A+ +LV +I +GS RNKENAAAVL+ L  +   H++ A +LG+
Sbjct  405  AILATHQEGRIAIGQQSAIDILVELIHSGSARNKENAAAVLLALGMNDSSHLLAAMQLGV  464

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               L++LAQNGT R RRKA  LL+ I++
Sbjct  465  FEYLIELAQNGTARARRKARGLLDLISK  492



>ref|XP_006436478.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
 gb|ESR49718.1| hypothetical protein CICLE_v10030962mg [Citrus clementina]
Length=551

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 112/149 (75%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+ L +  G MVDEALAIL
Sbjct  396  IRLLCDGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAIL  455

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AILASH EGK AIG A+ + VL+ VI  GSPRN+ENAAAVL  +C+G+   ++ A+EL  
Sbjct  456  AILASHQEGKTAIGQAEPIPVLMEVIRTGSPRNRENAAAVLWAICTGDAEQLKIARELDA  515

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L+++GT+R +RKA  +LE + R 
Sbjct  516  EEALKELSESGTDRAKRKAGSILELLQRI  544


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 0/124 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I   NKG  V AG +P ++ +L        + A A L
Sbjct  314  VELLSSTDPRTQEHAVTALLNLSINDSNKGTIVNAGAIPDIVDVLKNGSMEARENAAATL  373

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++ +G+PR K++AA  + +L   + +   A   GI+
Sbjct  374  FSLSVIDENKVAIGAAGAIPALIRLLCDGTPRGKKDAATAIFNLSIYQGNKARAVRAGIV  433

Query  328  GPLL  317
             PL+
Sbjct  434  PPLM  437



>ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max]
Length=632

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +AV+AG+V  L+Q LT+  G MVDEALAI+
Sbjct  475  IKLLCEGTPRGKKDAATAIFNLSIYQGNKARAVKAGIVAPLIQFLTDAGGGMVDEALAIM  534

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AILASH EG+VAIG A+ + +LV VI  GSPRN+ENAAAVL  LC+G+   ++ A+E G 
Sbjct  535  AILASHHEGRVAIGQAEPIHILVEVIRTGSPRNRENAAAVLWSLCTGDPLQLKLAKEHGA  594

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L++NGT+R +RKA  +LE + R 
Sbjct  595  EAALQELSENGTDRAKRKAGSILELLQRM  623


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 67/124 (54%), Gaps = 0/124 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG +P ++ +L        + A A L
Sbjct  393  VDLLSSSDPRTQEHAVTALLNLSINESNKGTIVNAGAIPDIVDVLKNGSMEARENAAATL  452

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KV IG A A+  L+ ++  G+PR K++AA  + +L   + +   A + GI+
Sbjct  453  FSLSVLDENKVQIGAAGAIPALIKLLCEGTPRGKKDAATAIFNLSIYQGNKARAVKAGIV  512

Query  328  GPLL  317
             PL+
Sbjct  513  APLI  516



>emb|CBI26916.3| unnamed protein product [Vitis vinifera]
Length=621

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNK +AV+AG++  L ++LT+    MVDEAL IL
Sbjct  470  VELLQNGSTRGKKDAATALFNLCIYQGNKSRAVKAGIITALSKMLTDLNNCMVDEALTIL  529

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++L+SH E K++I  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  530  SVLSSHQEAKISIVKASIIPVLIDLLRTGLPRNKENAAAILLSLCKRDNENLACISRLGA  589

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA++GTER +RKA  LLE + R 
Sbjct  590  VIPLAELAKSGTERAKRKATSLLEHLQRL  618



>ref|XP_008362668.1| PREDICTED: U-box domain-containing protein 14-like [Malus domestica]
Length=631

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL EG+ RGKKDAATA+FNL IYQGNK +AVRAG+V  LM+LL +    M+DEALAIL
Sbjct  474  IKLLCEGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVAPLMRLLKDAGSGMMDEALAIL  533

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AILASH EGK AI  A+ + VLV VI  G PRN+ENAAAVL  LC+G+ Q +  A+ELG 
Sbjct  534  AILASHQEGKAAIAQAEPIPVLVEVIRTGFPRNRENAAAVLWSLCTGDLQQLKLARELGA  593

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINR  248
               + +L++NGTER +RKA  +LE + R
Sbjct  594  EEAMKELSENGTERAKRKAVSVLELLQR  621


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 70/130 (54%), Gaps = 0/130 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I + NKG  V AG +P ++ +L        + A A L
Sbjct  392  VELLSSADSRTQEHAVTALLNLSINESNKGGIVNAGAIPDIVDVLKNGSMEARENAAATL  451

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++  G+PR K++AA  + +L   + +   A   GI+
Sbjct  452  FSLSVVDENKVAIGAAGAIPALIKLLCEGTPRGKKDAATAIFNLSIYQGNKARAVRAGIV  511

Query  328  GPLLDLAQNG  299
             PL+ L ++ 
Sbjct  512  APLMRLLKDA  521



>gb|KDO48789.1| hypothetical protein CISIN_1g006877mg [Citrus sinensis]
Length=551

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 112/149 (75%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +G+ RGKKDAATA+FNL IYQGNK +AVRAG+VP LM+ L +  G MVDEALAIL
Sbjct  396  IRLLCDGTPRGKKDAATAIFNLSIYQGNKARAVRAGIVPPLMRFLKDAGGGMVDEALAIL  455

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AILASH EGK AIG A+ + VL+ VI  GSPRN+ENAAAVL  +C+G+   ++ A+EL  
Sbjct  456  AILASHQEGKTAIGQAEPIPVLMEVIRTGSPRNRENAAAVLWAICTGDAEQLKIARELDA  515

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L+++GT+R +RKA  +LE + R 
Sbjct  516  EEALKELSESGTDRAKRKAGSILELLQRI  544


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 67/124 (54%), Gaps = 0/124 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL+    R ++ A TAL NL I   NKG  V AG +P ++ +L        + A A L
Sbjct  314  VELLSSTDPRTQEHAVTALLNLSINDSNKGTIVNAGAIPDIVDVLKNGSMEARENAAATL  373

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E KVAIG A A+  L+ ++ +G+PR K++AA  + +L   + +   A   GI+
Sbjct  374  FSLSVIDENKVAIGAAGAIPALIRLLCDGTPRGKKDAATAIFNLSIYQGNKARAVRAGIV  433

Query  328  GPLL  317
             PL+
Sbjct  434  PPLM  437



>ref|XP_002311496.2| hypothetical protein POPTR_0008s12760g [Populus trichocarpa]
 gb|EEE88863.2| hypothetical protein POPTR_0008s12760g [Populus trichocarpa]
Length=640

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIY GNKG+AVRAG++  L+++LT+ +  M+DE L IL
Sbjct  489  VELLENGSTRGKKDAATALFNLCIYLGNKGRAVRAGIITALLKMLTDSRNRMIDEGLTIL  548

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++LAS+ E KVAI  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  549  SVLASNQEAKVAIVKASTIPVLIDLLRTGMPRNKENAAAILLSLCKRDPENLACVSRLGA  608

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA+ GTER +RKA  +LE + R 
Sbjct  609  VIPLTELAKGGTERAKRKATSMLEHLRRL  637


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 70/133 (53%), Gaps = 0/133 (0%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL       +++A T++ NL IY+ NKG  + AG VP+++Q+L        + A A L
Sbjct  407  VNLLTSEDTSIQENAVTSILNLSIYEDNKGLIMLAGAVPSIVQVLRAGSVEARENAAATL  466

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVEAQELGIM  329
              L+   E K+ IG + A+  LV ++ NGS R K++AA  L +LC    +   A   GI+
Sbjct  467  FSLSLADENKIIIGASGAIPALVELLENGSTRGKKDAATALFNLCIYLGNKGRAVRAGII  526

Query  328  GPLLDLAQNGTER  290
              LL +  +   R
Sbjct  527  TALLKMLTDSRNR  539



>emb|CDY25764.1| BnaA07g10180D [Brassica napus]
Length=588

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTE--PQGNMVDEALA  515
            V LL  G+ RGKKDAATALFNLCIYQGNKG+AVRAG+VP L+++L+E   Q  MVDEAL 
Sbjct  436  VDLLENGTPRGKKDAATALFNLCIYQGNKGRAVRAGIVPALVKMLSETSSQRMMVDEALT  495

Query  514  ILAILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQEL  338
            IL++LAS+ + K A+  A  +  L+G++  G  RN+ENAAA+L+ LC  + + +V    L
Sbjct  496  ILSVLASNLDAKSAMVKANTLPALIGILQTGQGRNRENAAAILLSLCKRDNERLVLIGRL  555

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLE  260
            G + PL++L++NGTERG+RKA  LLE
Sbjct  556  GAVVPLMELSKNGTERGQRKAVSLLE  581



>ref|XP_008800544.1| PREDICTED: U-box domain-containing protein 12-like [Phoenix dactylifera]
Length=634

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            + LL +GS RGKKDAATALFNLCIYQGNK KA++AG+V  LM+LL +P G M+DEALAIL
Sbjct  483  IDLLCQGSLRGKKDAATALFNLCIYQGNKVKAIKAGIVEHLMRLLVDPSGGMMDEALAIL  542

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            AIL  + +GK AI  +  + VLVGV+  GSPRN+ENAAAVL  LC+G+ Q +  A+ELG 
Sbjct  543  AILVGNADGKPAIALSNPIPVLVGVMRTGSPRNRENAAAVLWSLCTGDVQQLSAARELGA  602

Query  331  MGPLLDLAQNGTERGRRKAAQLLE  260
               L +L + GT+R +RKA  LLE
Sbjct  603  EEALKELMETGTDRAKRKAGSLLE  626



>emb|CDY12497.1| BnaC07g13370D [Brassica napus]
Length=597

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGN--MVDEALA  515
            V LL  G+ RGKKDAATALFNLCIYQGNKG+AVRAG+VP L+++L+E   +  MVDEAL 
Sbjct  445  VDLLENGTPRGKKDAATALFNLCIYQGNKGRAVRAGIVPALVKMLSETSSHRMMVDEALT  504

Query  514  ILAILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQEL  338
            IL++LAS+ + K A+  A  +  L+G++  G  RN+ENAAA+L+ LC  + + +V    L
Sbjct  505  ILSVLASNLDAKSAMVKANTLPALIGILQTGQGRNRENAAAILLSLCKRDNERLVLIGRL  564

Query  337  GIMGPLLDLAQNGTERGRRKAAQLLE  260
            G + PL++L++NGTERG+RKA  LLE
Sbjct  565  GAVVPLMELSKNGTERGQRKAVSLLE  590



>ref|XP_002280520.1| PREDICTED: U-box domain-containing protein 11 [Vitis vinifera]
Length=639

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            V LL  GS RGKKDAATALFNLCIYQGNK +AV+AG++  L ++LT+    MVDEAL IL
Sbjct  488  VELLQNGSTRGKKDAATALFNLCIYQGNKSRAVKAGIITALSKMLTDLNNCMVDEALTIL  547

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGI  332
            ++L+SH E K++I  A  + VL+ ++  G PRNKENAAA+L+ LC  + +++     LG 
Sbjct  548  SVLSSHQEAKISIVKASIIPVLIDLLRTGLPRNKENAAAILLSLCKRDNENLACISRLGA  607

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
            + PL +LA++GTER +RKA  LLE + R 
Sbjct  608  VIPLAELAKSGTERAKRKATSLLEHLQRL  636



>emb|CDY12733.1| BnaC04g29080D [Brassica napus]
Length=209

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -2

Query  682  LLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQG-NMVDEALAILA  506
            LL   + RGKKDAATAL NLCIYQGNKG+AVRAG+VP L+++L++     MVDEAL IL+
Sbjct  60   LLENETPRGKKDAATALSNLCIYQGNKGRAVRAGIVPALVKMLSDSSSLRMVDEALTILS  119

Query  505  ILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGE-QHVVEAQELGIM  329
            +LAS+ + K AI  A  +  L+G++  G  RN+ENA A+L+ LC  + + +V    LG++
Sbjct  120  VLASNLDAKAAIVKANTLPALIGILQTGQARNRENATAILLSLCKRDNEKLVAIGRLGVV  179

Query  328  GPLLDLAQNGTERGRRKAAQLLE  260
             PL+DL +NGTERG+RKA  LLE
Sbjct  180  MPLMDLTKNGTERGKRKATSLLE  202



>emb|CDX78273.1| BnaA09g34680D [Brassica napus]
Length=634

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATA+FNLCIYQGNK +A++ G+V  L +LL +  G MVDEALAIL
Sbjct  477  ISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAIKGGIVDPLTRLLKDAGGGMVDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AIL+++ EGK AIG A  + VLV +I  GSPRN+ENAAA+L +LC G    +  A+E+G 
Sbjct  537  AILSTNQEGKAAIGEADTIPVLVEIIRTGSPRNRENAAAILWYLCIGNMERLNVAREVGA  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L +NGT+R +RKAA LLE I + 
Sbjct  597  DVALKELTENGTDRAKRKAASLLEIIQQL  625



>ref|XP_009116165.1| PREDICTED: U-box domain-containing protein 14 [Brassica rapa]
Length=634

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 1/149 (1%)
 Frame = -2

Query  688  VTLLNEGSQRGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMQLLTEPQGNMVDEALAIL  509
            ++LL EG++RGKKDAATA+FNLCIYQGNK +A++ G+V  L +LL +  G MVDEALAIL
Sbjct  477  ISLLEEGTRRGKKDAATAIFNLCIYQGNKSRAIKGGIVDPLTRLLKDAGGGMVDEALAIL  536

Query  508  AILASHPEgkvaiggakavavlvgviANGSPRNKENAAAVLVHLCSGEQHVVE-AQELGI  332
            AIL+++ EGK AIG A  + VLV +I  GSPRN+ENAAA+L +LC G    +  A+E+G 
Sbjct  537  AILSTNQEGKAAIGEADTIPVLVEIIRTGSPRNRENAAAILWYLCIGNMERLNVAREVGA  596

Query  331  MGPLLDLAQNGTERGRRKAAQLLEKINRF  245
               L +L +NGT+R +RKAA LLE I + 
Sbjct  597  DVALKELTENGTDRAKRKAASLLEIIQQL  625



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700