BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002J08

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB63505.1|  hypothetical protein B456_010G0030001                   247   7e-76   Gossypium raimondii
gb|AAF64453.1|AF239931_1  putative heat-shock protein 90                241   1e-75   Euphorbia esula [wolf's milk]
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    251   1e-75   
gb|KHG15193.1|  Endoplasmin                                             251   2e-75   Gossypium arboreum [tree cotton]
gb|KJB63503.1|  hypothetical protein B456_010G0030001                   247   3e-75   Gossypium raimondii
dbj|BAL42332.1|  Heat shock protein 90                                  251   7e-75   Nicotiana tabacum [American tobacco]
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     251   7e-75   Nicotiana sylvestris
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    251   1e-74   
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    250   2e-74   
dbj|BAL42333.1|  Heat shock protein 90                                  250   2e-74   Nicotiana tabacum [American tobacco]
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     250   2e-74   Nicotiana tomentosiformis
gb|AAB63606.1|  HSP90 isolog                                            238   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     249   3e-74   Prunus mume [ume]
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     249   6e-74   Fragaria vesca subsp. vesca
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   248   1e-73   Gossypium raimondii
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     248   1e-73   Nicotiana sylvestris
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             248   2e-73   Prunus persica
ref|XP_010109992.1|  Endoplasmin-like protein                           249   3e-73   
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   247   3e-73   Gossypium raimondii
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     246   9e-73   Pyrus x bretschneideri [bai li]
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    245   1e-72   
gb|ABK92622.1|  unknown                                                 229   2e-72   Populus trichocarpa [western balsam poplar]
emb|CDP07384.1|  unnamed protein product                                244   3e-72   Coffea canephora [robusta coffee]
gb|KDO84885.1|  hypothetical protein CISIN_1g003458mg                   242   3e-72   Citrus sinensis [apfelsine]
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     244   3e-72   
ref|XP_002510550.1|  endoplasmin, putative                              243   8e-72   Ricinus communis
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         243   1e-71   Jatropha curcas
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     242   1e-71   Citrus sinensis [apfelsine]
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     242   2e-71   Nelumbo nucifera [Indian lotus]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   242   2e-71   Citrus sinensis [apfelsine]
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             242   2e-71   Citrus clementina [clementine]
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     242   2e-71   Vitis vinifera
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    241   3e-71   Catharanthus roseus [chatas]
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                241   6e-71   Erythranthe guttata [common monkey flower]
emb|CAN79404.1|  hypothetical protein VITISV_028074                     241   1e-70   Vitis vinifera
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                239   2e-70   Erythranthe guttata [common monkey flower]
ref|NP_974606.1|  HSP90-like protein GRP94                              239   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194150.1|  HSP90-like protein GRP94                              239   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     238   5e-70   Tarenaya hassleriana [spider flower]
gb|KJB14397.1|  hypothetical protein B456_002G122800                    238   6e-70   Gossypium raimondii
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     238   6e-70   Nelumbo nucifera [Indian lotus]
ref|XP_003589505.1|  Endoplasmin-like protein                           238   7e-70   Medicago truncatula
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     237   2e-69   Cucumis sativus [cucumbers]
gb|KHG17445.1|  Endoplasmin                                             236   2e-69   Gossypium arboreum [tree cotton]
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     236   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     236   2e-69   Solanum lycopersicum
dbj|BAB86368.1|  SHEPHERD                                               236   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          236   3e-69   Glycine max [soybeans]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     236   3e-69   Cucumis melo [Oriental melon]
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          236   3e-69   Glycine max [soybeans]
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     236   3e-69   Eucalyptus grandis [rose gum]
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     236   3e-69   Solanum tuberosum [potatoes]
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             236   3e-69   Capsella rubella
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             236   4e-69   Phaseolus vulgaris [French bean]
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          235   4e-69   Glycine max [soybeans]
emb|CDX92620.1|  BnaC07g38780D                                          235   4e-69   
emb|CDY03477.1|  BnaC01g16050D                                          236   4e-69   
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          235   5e-69   
emb|CDY34264.1|  BnaA01g13670D                                          235   5e-69   Brassica napus [oilseed rape]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     235   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     235   5e-69   Brassica rapa
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          235   6e-69   Cicer arietinum [garbanzo]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          235   6e-69   Cicer arietinum [garbanzo]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     235   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     234   1e-68   Sesamum indicum [beniseed]
emb|CDY10992.1|  BnaA03g46510D                                          234   3e-68   Brassica napus [oilseed rape]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     233   4e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS69355.1|  hypothetical protein M569_05408                         233   5e-68   Genlisea aurea
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             231   1e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             231   1e-67   Eutrema salsugineum [saltwater cress]
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     231   2e-67   Phoenix dactylifera
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     231   2e-67   Elaeis guineensis
gb|AFW75769.1|  hypothetical protein ZEAMMB73_790349                    223   3e-67   
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     230   5e-67   Populus euphratica
gb|AIZ68158.1|  heat shock protein 90                                   229   6e-67   Ornithogalum longebracteatum [sea-onion]
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             229   7e-67   Populus trichocarpa [western balsam poplar]
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     228   2e-66   Oryza brachyantha
gb|AAN34791.1|  Grp94                                                   228   2e-66   Xerophyta viscosa
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     228   3e-66   Elaeis guineensis
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          228   4e-66   Amborella trichopoda
ref|NP_001058590.1|  Os06g0716700                                       227   6e-66   
gb|AAL79732.1|AC091774_23  heat shock protein 90                        227   6e-66   Oryza sativa Japonica Group [Japonica rice]
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    226   8e-66   Arabis alpina [alpine rockcress]
gb|EAZ02369.1|  hypothetical protein OsI_24473                          226   9e-66   Oryza sativa Indica Group [Indian rice]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          226   9e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     226   2e-65   Phoenix dactylifera
emb|CDY24830.1|  BnaA08g14800D                                          225   3e-65   Brassica napus [oilseed rape]
dbj|BAA90487.1|  heat shock protein 90                                  224   4e-65   Oryza sativa [red rice]
gb|AFW75768.1|  hypothetical protein ZEAMMB73_790349                    223   4e-65   
emb|CDY08910.1|  BnaC08g11400D                                          224   6e-65   Brassica napus [oilseed rape]
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     224   6e-65   Setaria italica
gb|AFW75767.1|  endoplasmin                                             223   2e-64   
dbj|BAJ89816.1|  predicted protein                                      218   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24228.1|  unknown                                                 216   5e-64   Picea sitchensis
ref|NP_001151475.1|  endoplasmin precursor                              221   6e-64   Zea mays [maize]
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     221   8e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          220   1e-63   
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     219   3e-63   Brachypodium distachyon [annual false brome]
gb|ABV82432.1|  Hsp90-like protein                                      219   3e-63   Dactylis glomerata [cocksfoot]
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     219   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146348.1|  shepherd-like1                                     218   4e-63   
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    219   5e-63   Hordeum vulgare [barley]
gb|EMS56078.1|  Endoplasmin-like protein                                219   7e-63   Triticum urartu
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               218   8e-63   
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     217   2e-62   
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    218   2e-62   
gb|EMT19498.1|  Endoplasmin-like protein                                218   9e-62   
gb|ABV21762.1|  GRP94                                                   213   8e-61   Pinus taeda
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             198   2e-55   Selaginella moellendorffii
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             197   2e-55   Selaginella moellendorffii
ref|XP_001770511.1|  predicted protein                                  195   1e-54   
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   179   5e-49   Citrus sinensis [apfelsine]
ref|XP_003063917.1|  predicted protein                                  174   6e-47   Micromonas pusilla CCMP1545
gb|KJB14398.1|  hypothetical protein B456_002G122800                    169   3e-45   Gossypium raimondii
ref|XP_002508627.1|  predicted protein                                  167   8e-45   Micromonas commoda
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       158   3e-41   Ostreococcus lucimarinus CCE9901
gb|ACN26939.1|  unknown                                                 144   3e-40   Zea mays [maize]
gb|AFK40768.1|  unknown                                                 142   6e-40   Lotus japonicus
ref|XP_005842771.1|  hypothetical protein CHLNCDRAFT_59468              148   1e-39   Chlorella variabilis
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain       152   3e-39   Ostreococcus tauri
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        152   4e-39   
ref|XP_007512535.1|  predicted protein                                  151   2e-38   Bathycoccus prasinos
ref|XP_005651682.1|  heat shock protein Hsp90                           139   2e-34   Coccomyxa subellipsoidea C-169
ref|XP_001753222.1|  predicted protein                                  137   5e-34   
ref|XP_001701885.1|  heat shock protein 90B                             135   5e-33   Chlamydomonas reinhardtii
ref|XP_006678605.1|  hypothetical protein BATDEDRAFT_36900              133   8e-33   Batrachochytrium dendrobatidis JAM81
ref|XP_007515443.1|  predicted protein                                  134   1e-32   Bathycoccus prasinos
ref|XP_005538149.1|  heat shock protein of Hsp90 family                 133   2e-32   Cyanidioschyzon merolae strain 10D
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696              133   2e-32   Volvox carteri f. nagariensis
ref|XP_308799.3|  AGAP006959-PA                                         129   6e-32   Anopheles gambiae str. PEST
gb|KDE07091.1|  heat shock protein 90-1                                 131   8e-32   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_006220022.1|  PREDICTED: heat shock protein 90-like              124   1e-31   Vicugna pacos
gb|EWM29604.1|  heat shock protein 90                                   131   1e-31   Nannochloropsis gaditana
emb|CAG01829.1|  unnamed protein product                                124   1e-31   Tetraodon nigroviridis
gb|ABF61871.1|  chaperone                                               122   2e-31   Agave tequilana
ref|XP_005855339.1|  molecular chaperone HtpG                           129   4e-31   Nannochloropsis gaditana CCMP526
gb|KHJ75602.1|  Hsp90 protein                                           122   6e-31   Oesophagostomum dentatum [nodule worm]
ref|XP_010902983.1|  PREDICTED: heat shock protein HSP 90-alpha 1       129   7e-31   
ref|XP_009616710.1|  PREDICTED: endoplasmin homolog                     121   7e-31   Nicotiana tomentosiformis
gb|ACU45247.1|  HSP90                                                   125   7e-31   Karlodinium veneficum
ref|XP_001445076.1|  hypothetical protein                               124   1e-30   Paramecium tetraurelia strain d4-2
ref|XP_011398501.1|  Heat shock protein 90-2                            125   1e-30   Auxenochlorella protothecoides
gb|AEG19531.1|  heat shock protein 90                                   128   1e-30   Glaciozyma antarctica
ref|XP_308800.3|  AGAP006958-PA                                         128   1e-30   Anopheles gambiae str. PEST
gb|ACO58580.1|  heat shock protein 90                                   125   1e-30   Apis mellifera [bee]
ref|XP_005843734.1|  hypothetical protein CHLNCDRAFT_140066             126   1e-30   Chlorella variabilis
ref|XP_001740319.1|  heat shock protein                                 121   1e-30   Entamoeba dispar SAW760
emb|CAK22426.1|  heat shock protein 83                                  124   2e-30   Beta vulgaris [beet]
ref|NP_999808.1|  heat shock protein gp96 precursor                     127   2e-30   Strongylocentrotus purpuratus [purple urchin]
gb|AAB05638.1|  heat shock protein 82                                   127   2e-30   Anopheles albimanus
emb|CDP96098.1|  Protein BM-DAF-21, isoform a                           127   3e-30   
gb|EJW88125.1|  heat shock protein 90                                   127   3e-30   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_001901767.1|  heat shock protein 90                              127   3e-30   Brugia malayi [agent of lymphatic filariasis]
sp|O61998.2|HSP90_BRUPA  RecName: Full=Heat shock protein 90            127   3e-30   Brugia pahangi
emb|CAA06694.1|  heat shock protein 90                                  127   3e-30   Brugia pahangi
gb|ETN67039.1|  heat shock protein                                      127   3e-30   Anopheles darlingi [American malaria mosquito]
gb|EMS22510.1|  molecular chaperone HtpG                                127   3e-30   Rhodotorula toruloides NP11
gb|KFB48797.1|  hypothetical protein ZHAS_00016808                      125   3e-30   Anopheles sinensis
gb|KDQ60746.1|  hypothetical protein JAAARDRAFT_172907                  127   3e-30   Jaapia argillacea MUCL 33604
gb|ACO55133.1|  heat shock protein 90                                   127   3e-30   Litomosoides sigmodontis
ref|XP_001649751.1|  AAEL014845-PA                                      125   3e-30   
ref|XP_007863437.1|  HSP90-domain-containing protein                    126   3e-30   Gloeophyllum trabeum ATCC 11539
ref|XP_007385736.1|  HSP90-domain-containing protein                    126   3e-30   Punctularia strigosozonata HHB-11173 SS5
gb|EXX78198.1|  Hsp90 family chaperone HSC82                            123   4e-30   Rhizophagus irregularis DAOM 197198w
gb|EJT49886.1|  chaperone                                               126   4e-30   Trichosporon asahii var. asahii CBS 2479
ref|XP_002021279.1|  GL24896                                            123   5e-30   
gb|ADV03069.1|  heat shock protein 90                                   126   5e-30   Amphidinium carterae
gb|AAQ63041.1|  heat shock protein HSP 90 alpha                         120   5e-30   Platichthys flesus
gb|ACF95812.1|  heat shock protein 90                                   126   5e-30   Amphidinium carterae
gb|ABA28987.1|  heat shock protein 90 3                                 124   5e-30   Symbiodinium sp. C3
gb|EPT06188.1|  hypothetical protein FOMPIDRAFT_1109676                 126   5e-30   Fomitopsis pinicola FP-58527 SS1
dbj|BAF92789.1|  cytosolic heat shock protein 90 alpha                  126   6e-30   Solea senegalensis
ref|XP_010736427.1|  PREDICTED: heat shock protein HSP 90-alpha i...    126   6e-30   Larimichthys crocea [croceine croaker]
ref|XP_008297037.1|  PREDICTED: heat shock protein HSP 90-alpha 1       126   6e-30   Stegastes partitus
gb|EYD92886.1|  hsp90 family protein                                    122   7e-30   Escherichia coli 1-176-05_S1_C1
gb|KFB48798.1|  heat shock protein 82                                   126   7e-30   Anopheles sinensis
ref|XP_008551765.1|  PREDICTED: heat shock protein 83                   126   7e-30   Microplitis demolitor
ref|XP_308797.3|  AGAP006961-PA                                         123   7e-30   Anopheles gambiae str. PEST
ref|XP_006793113.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    125   7e-30   Neolamprologus brichardi [lyretail cichlid]
gb|EPY32689.1|  heat shock protein 83-1                                 121   9e-30   Strigomonas culicis
gb|AEH27540.1|  cytosolic heat shock protein 90-alpha                   125   9e-30   Lates calcarifer [Asian seabass]
gb|EMD38391.1|  hypothetical protein CERSUDRAFT_153213                  125   9e-30   Gelatoporia subvermispora B
gb|ABI14419.1|  heat shock protein 90                                   125   9e-30   Karlodinium veneficum
emb|CDQ81678.1|  unnamed protein product                                125   9e-30   Oncorhynchus mykiss
emb|CDO69548.1|  hypothetical protein BN946_scf184785.g53               125   9e-30   Trametes cinnabarina
gb|KIL68560.1|  hypothetical protein M378DRAFT_184990                   125   9e-30   Amanita muscaria Koide BX008
ref|XP_005805662.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    125   1e-29   Xiphophorus maculatus
gb|AGT57167.1|  heat shock protein 90-alpha 3                           125   1e-29   Salmo salar
ref|XP_005805663.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    125   1e-29   
ref|XP_007577310.1|  PREDICTED: heat shock protein HSP 90-alpha 1       125   1e-29   Poecilia formosa
gb|AAG22091.1|AF306643_1  90 kDa heat-shock protein                     117   1e-29   Scyliorhinus torazame
gb|AGW82181.1|  heat shcok protein 90                                   119   1e-29   Corbicula fluminea [asian clam]
ref|XP_001649752.1|  AAEL014843-PA                                      125   1e-29   Aedes aegypti
ref|XP_001655641.1|  AAEL011708-PA                                      125   1e-29   
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         125   1e-29   Jatropha curcas
gb|KIP08934.1|  hypothetical protein PHLGIDRAFT_103566                  125   1e-29   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              125   1e-29   Setaria italica
ref|XP_008045254.1|  heat shock protein 90                              125   1e-29   Trametes versicolor FP-101664 SS1
ref|XP_010788727.1|  PREDICTED: heat shock protein HSP 90-alpha 1       125   1e-29   Notothenia coriiceps [yellowbelly rockcod]
gb|ACO57617.1|  heat shock protein 90                                   125   1e-29   Pteromalus puparum
ref|NP_001278186.1|  heat shock protein HSP 90-alpha 1-like             125   2e-29   Astyanax mexicanus [blind cave fish]
ref|XP_007361188.1|  HSP90-domain-containing protein                    125   2e-29   Dichomitus squalens LYAD-421 SS1
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          125   2e-29   Sorghum bicolor [broomcorn]
gb|EKF32566.1|  heat shock protein 85, putative                         121   2e-29   Trypanosoma cruzi marinkellei
emb|CBK20696.2|  unnamed protein product                                125   2e-29   Blastocystis hominis
ref|XP_001023330.1|  Hsp90 protein                                      125   2e-29   Tetrahymena thermophila SB210
emb|CBK22622.2|  unnamed protein product                                125   2e-29   Blastocystis hominis
emb|CBK24402.2|  unnamed protein product                                125   2e-29   Blastocystis hominis
emb|CAU15484.1|  heat shock protein 90                                  124   2e-29   Meloidogyne artiellia
gb|ESA08764.1|  hypothetical protein GLOINDRAFT_348967                  124   2e-29   
gb|AAM02974.1|AF421541_1  Hsp90                                         124   2e-29   Crypthecodinium cohnii
ref|XP_011345590.1|  PREDICTED: heat shock protein 83                   124   2e-29   Ooceraea biroi
gb|ADO30471.1|  heat shock protein 90                                   122   2e-29   Bactrocera dorsalis [papaya fruit fly]
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 124   2e-29   Tarenaya hassleriana [spider flower]
gb|ABV55506.1|  heat shock protein 90                                   124   2e-29   Microplitis mediator
ref|XP_005176932.1|  PREDICTED: heat shock protein 83                   124   2e-29   Musca domestica
gb|KIP09595.1|  hypothetical protein PHLGIDRAFT_126182                  124   2e-29   Phlebiopsis gigantea 11061_1 CR5-6
gb|ADM83426.1|  heat shock protein 90                                   124   2e-29   Panonychus citri [citrus fruit mite]
ref|XP_004023992.1|  hypothetical protein IMG5_201300                   125   2e-29   Ichthyophthirius multifiliis
emb|CCA68353.1|  related to HSP80 heat shock protein 80                 124   2e-29   Serendipita indica DSM 11827
ref|XP_008311364.1|  PREDICTED: heat shock protein HSP 90-alpha 1       124   2e-29   Cynoglossus semilaevis [half-smooth tongue sole]
gb|EKG06682.1|  heat shock protein 85, putative                         121   2e-29   Trypanosoma cruzi
ref|XP_003424204.1|  PREDICTED: heat shock protein 83                   124   2e-29   Nasonia vitripennis
ref|NP_001153536.1|  heat shock protein 90                              124   2e-29   Apis mellifera [bee]
ref|XP_003396897.1|  PREDICTED: heat shock protein 83-like              124   3e-29   Bombus terrestris [large earth bumblebee]
ref|XP_006619000.1|  PREDICTED: heat shock protein HSP 90-alpha-like    124   3e-29   Apis dorsata [rock honeybee]
ref|XP_005911315.1|  PREDICTED: heat shock protein HSP 90-alpha-like    117   3e-29   
gb|ACO55134.1|  heat shock protein 90                                   124   3e-29   Ascaris suum
ref|XP_001433808.1|  hypothetical protein                               124   3e-29   Paramecium tetraurelia strain d4-2
ref|XP_001439907.1|  hypothetical protein                               124   3e-29   Paramecium tetraurelia strain d4-2
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   124   3e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|ETK95017.1|  heat shock protein 90-2                                 124   3e-29   Phytophthora parasitica
ref|XP_008915791.1|  heat shock protein 90-2                            124   3e-29   Phytophthora parasitica INRA-310
emb|CAY56585.1|  putative heat shock protein 83                         124   3e-29   Bactrocera oleae [olive fly]
gb|AER28025.1|  heat shock protein 83S2                                 124   3e-29   Stratiomys singularior
gb|EAY92778.1|  hypothetical protein OsI_14582                          124   3e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_001458509.1|  hypothetical protein                               124   3e-29   Paramecium tetraurelia strain d4-2
gb|EJU00792.1|  heat shock protein 90                                   124   3e-29   Dacryopinax primogenitus
ref|XP_002998541.1|  heat shock protein 90                              124   3e-29   Phytophthora infestans T30-4
gb|AFD34191.2|  HSP90                                                   124   3e-29   Prorocentrum minimum
emb|CDQ59969.1|  unnamed protein product                                124   3e-29   Oncorhynchus mykiss
ref|XP_009534751.1|  hypothetical protein PHYSODRAFT_355817             124   3e-29   Phytophthora sojae
ref|XP_002165028.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    124   3e-29   Hydra vulgaris
emb|CAE02770.2|  OSJNBb0085F13.17                                       124   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001432500.1|  hypothetical protein                               124   3e-29   Paramecium tetraurelia strain d4-2
ref|XP_009542788.1|  hypothetical protein HETIRDRAFT_311260             124   3e-29   Heterobasidion irregulare TC 32-1
gb|AAB49983.1|  heat shock protein hsp90                                124   3e-29   Oncorhynchus tshawytscha [king salmon]
gb|KIO34802.1|  hypothetical protein M407DRAFT_90187                    124   4e-29   Tulasnella calospora MUT 4182
gb|AAW49252.2|  heat shock protein 90                                   124   4e-29   Liriomyza huidobrensis
gb|AAH75757.1|  Hsp90a.1 protein                                        124   4e-29   Danio rerio [leopard danio]
sp|Q90474.3|H90A1_DANRE  RecName: Full=Heat shock protein HSP 90-...    124   4e-29   Danio rerio [leopard danio]
gb|AGT57168.1|  heat shock protein 90-alpha 4                           124   4e-29   Salmo salar
ref|XP_007300418.1|  HSP90-domain-containing protein                    123   4e-29   Stereum hirsutum FP-91666 SS1
dbj|BAF75058.1|  heat shock protein                                     116   4e-29   Prymnesium parvum
gb|AAM93928.1|  heat-shock protein 90                                   118   4e-29   Griffithsia japonica
ref|XP_952473.1|  heat shock protein 90                                 124   4e-29   Theileria annulata
ref|XP_008216018.1|  PREDICTED: heat shock protein 83-like              123   4e-29   
ref|NP_001274755.1|  heat shock protein 83-like                         124   4e-29   Ceratitis capitata [medfly]
gb|AFM73650.1|  heat shock protein 90                                   119   4e-29   Bicyclus anynana
gb|AER28022.1|  heat shock protein 83P1                                 124   4e-29   Oxycera pardalina
gb|ADD10372.1|  heat shock protein 90                                   123   4e-29   Meloidogyne incognita
dbj|BAH71458.1|  ACYPI002010                                            119   4e-29   Acyrthosiphon pisum
ref|XP_007399693.1|  hypothetical protein PHACADRAFT_127903             123   5e-29   Phanerochaete carnosa HHB-10118-sp
ref|XP_001439512.1|  hypothetical protein                               123   5e-29   Paramecium tetraurelia strain d4-2
ref|XP_011203601.1|  PREDICTED: heat shock protein 83                   123   5e-29   Bactrocera dorsalis [papaya fruit fly]
gb|KIJ44391.1|  hypothetical protein M422DRAFT_228502                   123   5e-29   Sphaerobolus stellatus SS14
gb|AER28024.1|  heat shock protein 83S1                                 123   5e-29   Stratiomys singularior
gb|KIH68348.1|  Hsp90 protein                                           123   5e-29   Ancylostoma duodenale
ref|XP_011182023.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    123   5e-29   Zeugodacus cucurbitae [melon fruit fly]
gb|AGU42458.1|  heat shock protein 90                                   123   5e-29   Bactrocera correcta
gb|EYC13285.1|  hypothetical protein Y032_0044g1081                     123   5e-29   Ancylostoma ceylanicum
gb|ETN83529.1|  putative heat shock protein 90                          123   5e-29   Necator americanus
gb|AEF33377.1|  heat shock protein 90                                   116   5e-29   Crassostrea ariakensis
gb|KFD54842.1|  hypothetical protein M513_04276                         123   5e-29   Trichuris suis
ref|XP_003074078.1|  heat shock protein 90C (ISS)                       123   6e-29   
ref|XP_011154034.1|  PREDICTED: heat shock protein 83                   123   6e-29   Harpegnathos saltator
gb|ACU00668.1|  heat shock protein 90                                   123   6e-29   Haemonchus contortus [red stomach worm]
ref|XP_764810.1|  heat shock protein 90                                 123   6e-29   Theileria parva strain Muguga
gb|AAA30132.1|  heat shock protein 90                                   123   6e-29   Theileria parva
gb|AFK31312.1|  heat shock protein 90                                   123   6e-29   
emb|CEF96474.1|  Histidine kinase-like ATPase, ATP-binding domain       123   6e-29   
ref|XP_003102316.1|  CRE-DAF-21 protein                                 123   6e-29   
gb|EGT39214.1|  CBN-DAF-21 protein                                      123   6e-29   
gb|AAD52684.1|AF179480_1  90kDa heat-shock protein                      115   6e-29   
gb|AAB23704.1|  HSP90                                                   117   7e-29   
gb|AIA62362.1|  hsp90                                                   120   7e-29   
emb|CAC29071.1|  heat shock protein 90                                  118   7e-29   
emb|CAI64494.1|  Hsp90 protein                                          123   7e-29   
gb|ABK34943.1|  heat shock protein 83                                   123   7e-29   
ref|XP_002008178.1|  GI13350                                            123   7e-29   
dbj|BAA13431.1|  heat shock protein 90                                  115   8e-29   
ref|XP_001353471.1|  Hsp83                                              123   8e-29   
ref|XP_002046978.1|  heat shock protein 83                              123   8e-29   
gb|AAN39696.1|  heat shock protein                                      116   8e-29   
gb|EPQ17302.1|  Heat shock protein HSP 90-beta                          116   8e-29   
gb|KIK94310.1|  hypothetical protein PAXRUDRAFT_143168                  122   8e-29   
ref|XP_003135662.1|  heat shock protein 90                              122   9e-29   
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              122   9e-29   
gb|ADZ13510.1|  HSP90-1                                                 122   9e-29   
ref|XP_004035743.1|  hypothetical protein IMG5_091060                   122   9e-29   
gb|KIJ16896.1|  hypothetical protein PAXINDRAFT_162512                  122   9e-29   
ref|XP_001984000.1|  GH16203                                            122   1e-28   
gb|AAH49951.1|  Hsp90ab1 protein                                        120   1e-28   
ref|WP_032222675.1|  hypothetical protein                               117   1e-28   
dbj|BAB15121.1|  unnamed protein product                                119   1e-28   
dbj|BAF83423.1|  unnamed protein product                                119   1e-28   
ref|XP_006632301.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    122   1e-28   
emb|CDW54307.1|  heat shock protein 90                                  122   1e-28   
dbj|BAE87688.1|  unnamed protein product                                119   1e-28   
gb|KHN76289.1|  Heat shock protein HSP 90-alpha                         122   1e-28   
ref|XP_003971591.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    122   1e-28   
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              122   1e-28   
dbj|BAD83620.1|  cytosolic-type hsp90                                   122   1e-28   
gb|AAN76524.1|AF384807_1  heat-shock protein 90                         122   1e-28   
ref|XP_653132.1|  heat shock protein 90                                 122   1e-28   
ref|XP_004542148.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    122   1e-28   
gb|KJE05047.1|  hsp90-like protein                                      122   1e-28   
gb|KIR45891.1|  hsp90-like protein                                      122   1e-28   
gb|KIR84754.1|  hsp90-like protein                                      122   1e-28   
gb|KGB79019.1|  hsp90-like protein                                      122   1e-28   
ref|XP_653162.1|  heat shock protein 90                                 122   1e-28   
gb|AAH44888.1|  Hsp90ab1 protein                                        119   1e-28   
ref|XP_008855466.1|  heat shock protein 90, putative                    122   1e-28   
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              122   1e-28   
ref|XP_003197339.1|  cytoplasmic chaperone (Hsp90 family); Hsp82p       122   1e-28   
gb|ACO55135.1|  heat shock protein 90                                   122   1e-28   
gb|EMS66149.1|  Heat shock protein 83                                   122   1e-28   
ref|XP_006632299.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    122   1e-28   
ref|XP_001735351.1|  heat shock protein 81-1                            122   1e-28   
ref|XP_006632300.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    122   1e-28   
gb|AAO14563.2|AF461150_1  Hsp90                                         122   1e-28   
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              122   1e-28   
gb|EKG00457.1|  heat shock protein 85, putative                         120   1e-28   
ref|NP_571403.1|  heat shock protein HSP 90-alpha 1                     122   1e-28   
gb|ABH04243.1|  heat shock protein 90 kDa                               122   2e-28   
gb|AAN76525.1|AF384808_1  heat-shock protein 90                         122   2e-28   
ref|XP_001713499.1|  heat shock protein 82                              122   2e-28   
gb|ADF31778.1|  heat shock protein 90                                   122   2e-28   
gb|AIU38242.1|  heat shock protein 90                                   122   2e-28   
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              122   2e-28   
gb|AFR98377.1|  hsp90-like protein                                      122   2e-28   
ref|XP_001956817.1|  GF20110                                            122   2e-28   
ref|XP_002062325.1|  Hsp83                                              122   2e-28   
gb|AIU38243.1|  heat shock protein 90                                   122   2e-28   
gb|AGI19327.1|  heat shock protein 90                                   122   2e-28   
emb|CBJ23502.1|  heat shock protein 90                                  117   2e-28   
gb|ADF31772.1|  heat shock protein 90                                   122   2e-28   
gb|AIU38246.1|  heat shock protein 90                                   122   2e-28   
gb|ACE77780.1|  HSP90                                                   122   2e-28   
gb|AIU38245.1|  heat shock protein 90                                   122   2e-28   
gb|AAW49253.2|  heat shock protein 90                                   122   2e-28   
ref|NP_523899.1|  heat shock protein 83, isoform A                      122   2e-28   
ref|XP_002093517.1|  GE21339                                            122   2e-28   
gb|AIU38244.1|  heat shock protein 90                                   122   2e-28   
ref|XP_001971711.1|  GG15112                                            122   2e-28   
gb|ESL09761.1|  heat shock protein 85                                   119   2e-28   
gb|EPY40503.1|  heat shock protein 83-1                                 117   2e-28   
gb|ADF31754.1|  heat shock protein 90                                   122   2e-28   
gb|KHN09298.1|  Heat shock protein 83                                   122   2e-28   
ref|XP_002035159.1|  Hsp83                                              122   2e-28   
ref|XP_006599549.1|  PREDICTED: heat shock protein 83-like              121   2e-28   
gb|KFG42944.1|  heat shock protein HSP90                                117   2e-28   
gb|ADF31775.1|  heat shock protein 90                                   122   2e-28   
gb|EMT27103.1|  Heat shock protein 83                                   121   2e-28   
ref|XP_011171324.1|  PREDICTED: heat shock protein 83                   122   2e-28   
gb|ADF31756.1|  heat shock protein 90                                   122   2e-28   
ref|XP_007764667.1|  heat-shock protein 90                              122   2e-28   
ref|XP_009791186.1|  PREDICTED: heat shock protein 83-like              121   2e-28   
gb|KHJ75025.1|  Hsp90 protein                                           117   2e-28   
dbj|BAE48212.1|  heat shock protein 90 beta                             118   2e-28   
ref|XP_001865484.1|  heat shock protein 83                              121   2e-28   
ref|XP_002637777.1|  C. briggsae CBR-DAF-21 protein                     121   2e-28   
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            121   2e-28   
gb|EGW01344.1|  Heat shock protein HSP 90-beta                          119   2e-28   
ref|XP_814893.1|  heat shock protein 85                                 120   2e-28   
gb|ACM50884.1|  heat shock protein 90A                                  121   2e-28   
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg             121   2e-28   
gb|KDO70244.1|  hypothetical protein CISIN_1g0038272mg                  119   2e-28   
dbj|BAJ34368.1|  unnamed protein product                                121   2e-28   
ref|XP_001861928.1|  heat shock protein 83                              121   2e-28   
ref|XP_009690258.1|  heat shock protein 90                              121   3e-28   
gb|ADF31755.1|  heat shock protein 90                                   121   3e-28   
ref|XP_001861926.1|  heat shock protein 83                              121   3e-28   
gb|ERG82208.1|  heat shock protein hsp 90-alpha                         121   3e-28   
ref|NP_506626.1|  Protein DAF-21                                        121   3e-28   
gb|ADF31779.1|  heat shock protein 90                                   121   3e-28   
ref|XP_011310275.1|  PREDICTED: heat shock protein 83                   121   3e-28   
gb|AAO46141.1|  heat shock protein 90                                   115   3e-28   
emb|CAN70887.1|  hypothetical protein VITISV_005592                     121   3e-28   
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                   121   3e-28   
ref|XP_001415715.1|  Heat Shock Protein 90                              121   3e-28   
emb|CCJ29160.1|  unnamed protein product                                120   3e-28   
ref|XP_006874806.1|  PREDICTED: putative heat shock protein HSP 9...    118   3e-28   
ref|XP_003704636.1|  PREDICTED: heat shock protein 83-like              121   3e-28   
ref|XP_011250812.1|  PREDICTED: heat shock protein 83                   121   3e-28   
ref|XP_008396616.1|  PREDICTED: heat shock protein HSP 90-alpha 1       121   3e-28   
ref|XP_009628903.1|  PREDICTED: heat shock protein 83-like              121   3e-28   
ref|XP_008549803.1|  PREDICTED: heat shock protein 83-like              121   3e-28   
ref|XP_011060405.1|  PREDICTED: heat shock protein 83                   121   3e-28   
sp|O02192.1|HSP83_DROAV  RecName: Full=Heat shock protein 83; Alt...    121   3e-28   
ref|XP_002509852.1|  heat shock protein, putative                       121   3e-28   
gb|AGU42456.1|  heat shock protein 90                                   119   3e-28   
ref|XP_002063871.1|  GK15907                                            121   4e-28   
ref|NP_001167173.1|  Heat shock protein HSP 90-alpha                    121   4e-28   
ref|XP_003881046.1|  hsp90, related                                     121   4e-28   
emb|CAG01828.1|  unnamed protein product                                119   4e-28   
ref|NP_001126444.1|  heat shock protein HSP 90-beta                     121   4e-28   
gb|EMD43140.1|  Heat shock family 85 kDa protein                        120   4e-28   
gb|AFZ62631.1|  HSP90-1                                                 121   4e-28   
emb|CCJ29541.1|  unnamed protein product                                120   4e-28   
emb|CDQ59970.1|  unnamed protein product                                121   4e-28   
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              120   4e-28   
gb|AEF38377.1|  HSP83                                                   120   4e-28   
ref|XP_002613212.1|  hypothetical protein BRAFLDRAFT_278055             120   4e-28   
dbj|BAJ85535.1|  predicted protein                                      120   4e-28   
ref|XP_005100278.1|  PREDICTED: mesocentin-like                         122   4e-28   
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   120   4e-28   
ref|NP_200076.1|  heat shock protein 90.1                               120   5e-28   
ref|XP_007040338.1|  Heat shock protein 90.1                            120   5e-28   
emb|CAA34748.1|  heat shock-like protein                                116   5e-28   
ref|XP_004083818.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   5e-28   
sp|P06660.1|HSP85_TRYCR  RecName: Full=Heat shock-like 85 kDa pro...    120   5e-28   
prf||1908431A  heat shock protein HSP81-1                               120   5e-28
gb|AAA32822.1|  heat shock protein 83                                   120   5e-28   
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...    120   5e-28   
emb|CDQ81679.1|  unnamed protein product                                120   5e-28   
ref|XP_811791.1|  heat shock protein 85                                 120   5e-28   
emb|CCM02389.1|  predicted protein                                      120   5e-28   
gb|KDQ33187.1|  hypothetical protein PLEOSDRAFT_1052040                 120   5e-28   
ref|XP_804480.1|  heat shock protein 85                                 120   5e-28   
gb|EKF32565.1|  heat shock protein 85, putative                         120   5e-28   
dbj|BAA00615.1|  81kDa heat-shock protein                               120   5e-28   
gb|ACD63052.1|  heat shock protein 90                                   120   5e-28   
emb|CDS03201.1|  Putative Heat shock protein 90-1                       120   5e-28   
ref|XP_007321864.1|  hypothetical protein SERLADRAFT_397816             120   5e-28   
emb|CCO26395.1|  Heat shock protein 81-2 Short=HSP81-2                  115   6e-28   
ref|XP_005900147.1|  PREDICTED: heat shock protein HSP 90-beta is...    120   6e-28   
gb|KIM27867.1|  hypothetical protein M408DRAFT_70506                    120   6e-28   
ref|XP_003440693.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   6e-28   
gb|ABP93404.1|  heat shock protein 90                                   120   6e-28   
gb|AFK26091.1|  heat shock protein 90                                   120   6e-28   
ref|XP_005900148.1|  PREDICTED: heat shock protein HSP 90-beta is...    120   6e-28   
ref|XP_005900146.1|  PREDICTED: heat shock protein HSP 90-beta is...    120   6e-28   
gb|EPY23438.1|  molecular chaperone HtpG                                120   6e-28   
ref|XP_011495774.1|  PREDICTED: heat shock protein 83                   120   7e-28   
ref|XP_009313908.1|  cytosolic HSP90-like protein                       120   7e-28   
gb|ESS64949.1|  heat shock protein 85                                   120   7e-28   
dbj|BAE87589.1|  unnamed protein product                                120   7e-28   
gb|AIU47031.1|  heat shock protein                                      120   7e-28   
dbj|BAK03331.1|  predicted protein                                      120   7e-28   
gb|AAY67995.1|  HSP 90                                                  118   7e-28   
gb|ACR57215.1|  Hsp90                                                   120   7e-28   
ref|XP_008396615.1|  PREDICTED: heat shock protein HSP 90-alpha         120   7e-28   
gb|ACZ13352.1|  HSP90 protein                                           118   7e-28   
ref|XP_007071733.1|  PREDICTED: heat shock protein HSP 90-beta is...    120   7e-28   
ref|XP_007071732.1|  PREDICTED: heat shock protein HSP 90-beta is...    120   8e-28   
ref|XP_007577309.1|  PREDICTED: heat shock protein HSP 90-alpha         120   8e-28   
ref|XP_004083819.1|  PREDICTED: heat shock protein HSP 90-alpha         120   8e-28   
ref|XP_004140753.1|  PREDICTED: heat shock protein 83-like              120   8e-28   
gb|ETO33398.1|  hypothetical protein RFI_03710                          118   8e-28   
ref|XP_005296381.1|  PREDICTED: heat shock protein HSP 90-beta          120   8e-28   
gb|AEM65180.1|  heat shock protein 90 alpha                             120   8e-28   
gb|ABG77328.1|  Hsp90                                                   119   8e-28   
ref|XP_007071731.1|  PREDICTED: heat shock protein HSP 90-beta is...    120   8e-28   
ref|XP_003580663.1|  PREDICTED: heat shock protein 82                   120   8e-28   
ref|XP_010055687.1|  PREDICTED: heat shock protein 90-1-like            120   9e-28   
gb|ACU00686.1|  heat shock protein 90                                   117   9e-28   
ref|XP_005805661.1|  PREDICTED: heat shock protein HSP 90-alpha-like    120   9e-28   
ref|XP_011080917.1|  PREDICTED: heat shock protein 83-like              120   9e-28   
gb|ABW87791.1|  heat shock protein 90                                   120   9e-28   
gb|ADM26741.1|  heat shock protein 90                                   120   9e-28   
gb|AAA92343.1|  heat shock protein 90                                   118   1e-27   
ref|XP_006458532.1|  hypothetical protein AGABI2DRAFT_190809            119   1e-27   
gb|AIC33004.1|  heat-shock protein 90                                   119   1e-27   
gb|ADJ00017.1|  heat shock protein 90                                   117   1e-27   
gb|ACR57216.1|  Hsp90                                                   119   1e-27   
ref|XP_007230794.1|  PREDICTED: heat shock protein HSP 90-alpha         119   1e-27   
ref|XP_006126585.1|  PREDICTED: heat shock protein HSP 90-beta          119   1e-27   
gb|ERE80665.1|  heat shock protein HSP 90-alpha                         115   1e-27   
gb|AIL52741.1|  heat shock protein 90                                   119   1e-27   
gb|KEH26332.1|  heat shock protein 81-2                                 119   1e-27   
gb|ABO93609.1|  heat shock protein 90                                   117   1e-27   
gb|AAF82792.1|AF275719_1  chaperone protein HSP90 beta                  119   1e-27   
gb|EDM18740.1|  rCG43497, isoform CRA_a                                 119   1e-27   
gb|EPY33491.1|  molecular chaperone HtpG                                117   1e-27   
ref|XP_007338676.1|  heat shock protein 90                              119   1e-27   
gb|AEJ88466.1|  heat shock protein 90                                   119   1e-27   
gb|AAK59281.1|AF378703_1  heat shock protein 90 alpha                   117   1e-27   
gb|KIJ69237.1|  hypothetical protein HYDPIDRAFT_80562                   119   1e-27   
gb|AAH09206.2|  HSP90AB1 protein                                        119   1e-27   
ref|XP_005072380.1|  PREDICTED: heat shock protein HSP 90-beta is...    119   1e-27   
ref|XP_002864186.1|  heat shock protein 81-1                            119   1e-27   
ref|XP_001518700.3|  PREDICTED: heat shock protein HSP 90-beta          119   1e-27   
ref|XP_002613491.1|  hypothetical protein BRAFLDRAFT_119839             119   1e-27   
gb|EGW07657.1|  Heat shock protein HSP 90-alpha                         114   1e-27   
gb|EPY76710.1|  heat shock cognate protein HSP 90-beta-like isofo...    119   1e-27   
gb|AAO46140.1|  heat shock protein 90                                   114   1e-27   
gb|AAD30456.1|AF123259_1  heat shock protein 90                         117   1e-27   
ref|XP_004408189.1|  PREDICTED: heat shock cognate protein HSP 90...    119   1e-27   
ref|XP_006149126.1|  PREDICTED: heat shock protein HSP 90-beta          119   1e-27   



>gb|KJB63505.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=500

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWK AL SDNVDEVKIS RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  333  KELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  392

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQL Y+TALMESGFN+P+
Sbjct  393  DSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALMESGFNLPE  452

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  453  PKDFASRIYSSVKSSLNISPD  473



>gb|AAF64453.1|AF239931_1 putative heat-shock protein 90 [Euphorbia esula]
Length=317

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKG+L S+NVD+VKIS RL +TPCVVVTSKYG S+NMERIMQ+Q LS
Sbjct  138  KELKESFKELTKWWKGSLASENVDDVKISNRLDNTPCVVVTSKYGWSSNMERIMQAQTLS  197

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA KQAYM+GKRVLEINPRHPIIKELRERVVKDPEDE+ K+TA L Y+TALMESGF + D
Sbjct  198  DAKKQAYMKGKRVLEINPRHPIIKELRERVVKDPEDENVKQTAHLIYQTALMESGFMLSD  257

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  258  PKDFASRIYSSVKSSLNISPD  278



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKI+ RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  559  KELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSKFGWSANMERIMQSQTLS  618

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TAQL Y+TALMESGF++PD
Sbjct  619  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALMESGFSLPD  678

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  679  PKDFASRIYSSVKSSLNISPD  699



>gb|KHG15193.1| Endoplasmin [Gossypium arboreum]
Length=718

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWK AL SDNVDEVKIS RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  551  KELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  610

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKR+LEINPRHPIIKELRERVVKD EDE  K+TAQL Y+TALMESGFN+PD
Sbjct  611  DSSKQAYMRGKRILEINPRHPIIKELRERVVKDSEDEGVKQTAQLIYQTALMESGFNLPD  670

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  671  PKDFASRIYSSVKSSLNISPD  691



>gb|KJB63503.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
 gb|KJB63504.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=540

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWK AL SDNVDEVKIS RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  373  KELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  432

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQL Y+TALMESGFN+P+
Sbjct  433  DSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALMESGFNLPE  492

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  493  PKDFASRIYSSVKSSLNISPD  513



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL SDNVD+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TAQL Y+TAL+ESGF + D
Sbjct  698  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQTALLESGFLLND  757

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y SVKSSLN+SP
Sbjct  758  PKDFASRIYSSVKSSLNVSP  777



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL SDNVD+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TAQL Y+TAL+ESGF + D
Sbjct  698  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQTALLESGFLLND  757

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y SVKSSLN+SP
Sbjct  758  PKDFASRIYSSVKSSLNVSP  777



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKI+ RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  638  KELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSKFGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TAQL Y+TALMESGF++PD
Sbjct  698  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALMESGFSLPD  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  758  PKDFASRIYSSVKSSLNISPD  778



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKI+ RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  654  KELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSKFGWSANMERIMQSQTLS  713

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TAQL Y+TALMESGF++PD
Sbjct  714  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALMESGFSLPD  773

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  774  PKDFASRIYSSVKSSLNISPD  794



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL SDNVD+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  639  KELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  698

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELR+RV+KDPEDES K+TAQL Y+TAL+ESGF + D
Sbjct  699  DANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPEDESVKQTAQLMYQTALLESGFLLND  758

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLN+SPD
Sbjct  759  PKDFASRIYSSVKSSLNVSPD  779



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL SDNVD+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  639  KELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  698

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELR+RV+KDPEDES K+TAQL Y+TAL+ESGF + D
Sbjct  699  DANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPEDESVKQTAQLMYQTALLESGFLLND  758

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLN+SPD
Sbjct  759  PKDFASRIYSSVKSSLNVSPD  779



>gb|AAB63606.1| HSP90 isolog [Arabidopsis thaliana]
Length=335

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  147  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  206

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  207  DANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFILTD  266

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA+  Y SVKS LNISPD
Sbjct  267  PKDFAARIYNSVKSGLNISPD  287



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE+KES+K+LTKWWK AL SDNVD+VK+S RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  639  KEVKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQTLS  698

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TAQL Y+TALMESGFN+PD
Sbjct  699  DASKQAYMRGKRILEINPRHPIIKELRERVVKNAEDESVKQTAQLIYQTALMESGFNLPD  758

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNI+PD
Sbjct  759  PKDFASRIYSSVKSSLNINPD  779



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKES+K+LTKWWKGAL SDNVD+VK+S RLADTPCVVVTSK+G SANME+IMQSQ LS
Sbjct  635  KELKESYKELTKWWKGALASDNVDDVKLSNRLADTPCVVVTSKFGWSANMEKIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D++KQAYMRGKRVLEINPRHPIIKELRERVVK+PEDES K TAQL Y+TALMESGF +PD
Sbjct  695  DSAKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKHTAQLIYQTALMESGFVLPD  754

Query  197  PKDFASXXYXSVKSSLNISPDavveedxeve--eeaetsskeaeSNPENAEDGADGIKDE  24
            PKDFAS  Y SVKSSLNI+PDA VEE+ + E   EAE  +   E+ PE     AD +KDE
Sbjct  755  PKDFASRIYSSVKSSLNINPDATVEEEDDTEDPAEAEAETPANEATPEAEAANADSLKDE  814

Query  23   L  21
            L
Sbjct  815  L  815



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWK AL SDNVDEVKIS RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  614  KELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  673

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQL Y+TALMESGFN+P+
Sbjct  674  DSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALMESGFNLPE  733

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  734  PKDFASRIYSSVKSSLNISPD  754



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL SDN+D+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KELKESFKELTKWWKGALASDNIDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR+RV KDPEDES ++TAQL Y+TAL+ESGF + D
Sbjct  698  DASKQAYMRGKRVLEINPRHPIIKELRDRVAKDPEDESVEQTAQLMYQTALLESGFLLND  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLN+SPD
Sbjct  758  PKDFASRIYSSVKSSLNVSPD  778



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE+KES+K+LTKWWK AL SDNVD+VK+S RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  639  KEVKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQTLS  698

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TAQL Y+TALMESGFN+PD
Sbjct  699  DASKQAYMRGKRILEINPRHPIIKELRERVVKNAEDESVKQTAQLIYQTALMESGFNLPD  758

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y SVKSSLNI+P
Sbjct  759  PKDFASRIYSSVKSSLNINP  778



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK AL SDNVD+VK+S RL DTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  634  KELKESFKDLTKWWKSALASDNVDDVKVSNRLDDTPCVVVTSKYGWSANMERIMQSQTLS  693

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+T+QL Y+TALMESGF + D
Sbjct  694  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTSQLIYQTALMESGFMLTD  753

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA+  Y SVKSSLNI+PD
Sbjct  754  PKDFANRIYSSVKSSLNINPD  774



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWK AL SDNVDEVKIS RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  656  KELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  715

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQL Y+TALMESGFN+P+
Sbjct  716  DSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALMESGFNLPE  775

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  776  PKDFASRIYSSVKSSLNISPD  796



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKES+K+LTKWWK AL SDNVD+VK+S RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQ YMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TAQL Y+TALMESGFN+PD
Sbjct  698  DANKQGYMRGKRILEINPRHPIIKELRERVVKNAEDESVKKTAQLIYQTALMESGFNLPD  757

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y SVKSSLNI+P
Sbjct  758  PKDFASRIYSSVKSSLNINP  777



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKES+K+LTKWWK AL SDNVD+VK+S RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQ YMRGKR+LEINPRHPI+KELRERVVK+ EDES K+TAQL Y+TALMESGFN+PD
Sbjct  698  DANKQGYMRGKRILEINPRHPIVKELRERVVKNAEDESVKKTAQLIYQTALMESGFNLPD  757

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y SVKSSLNI+P
Sbjct  758  PKDFASRIYSSVKSSLNINP  777



>gb|ABK92622.1| unknown [Populus trichocarpa]
Length=214

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKIS RLADTPC+VVTSKYG SANMERIMQ+Q LS
Sbjct  29   KELKESFKELTKWWKGALASENVDDVKISNRLADTPCIVVTSKYGWSANMERIMQAQTLS  88

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA L Y+TALMESGF + D
Sbjct  89   DANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALMESGFILND  148

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSL+ISPD
Sbjct  149  PKDFASRIYSSVKSSLSISPD  169



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWKG L S+NVD+VKIS RLA+TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  637  KELKESFKDLTKWWKGTLASENVDDVKISNRLANTPCVVVTSKYGWSANMERIMQSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELRERVVKDPE ES K+TA L Y+TALMESGF + D
Sbjct  697  DSSKQAYMRGKRVLEINPRHPIIKELRERVVKDPEGESVKQTAHLMYQTALMESGFMLND  756

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSL+ISPD
Sbjct  757  PKDFASRIYDSVKSSLHISPD  777



>gb|KDO84885.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=679

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VK+S RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  501  KELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  560

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TAQL Y+TALMESGF++ D
Sbjct  561  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSLND  620

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y +VKSSLNISP
Sbjct  621  PKDFASRIYSTVKSSLNISP  640



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKES+K+LTKWWK AL SDNVD+VK+S RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQ YMRGKR+LEINPRHPIIKELRERVVK+ EDES K TAQL Y+TALMESGFN+PD
Sbjct  698  DANKQGYMRGKRILEINPRHPIIKELRERVVKNAEDESVKLTAQLIYQTALMESGFNLPD  757

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y SVKSSLNI+P
Sbjct  758  PKDFASRIYSSVKSSLNINP  777



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKIS RL +TPCVVVTSKYG SANMERIM SQ LS
Sbjct  637  KELKESFKELTKWWKGALASENVDDVKISNRLDNTPCVVVTSKYGWSANMERIMSSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S KETAQL Y+TALMESGF + D
Sbjct  697  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKETAQLIYQTALMESGFMLND  756

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSL+ISP+
Sbjct  757  PKDFASRIYNSVKSSLDISPE  777



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VK+S RL +TPCVVVTSKYG SANMERIMQSQ L+
Sbjct  638  KELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLT  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED S K+TA L Y+TALMESGF + D
Sbjct  698  DANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDASVKQTAHLIYQTALMESGFMLSD  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  758  PKDFASRIYSSVKSSLNISPD  778



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VK+S RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  644  KELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  703

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TAQL Y+TALMESGF++ D
Sbjct  704  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSLND  763

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y +VKSSLNISP
Sbjct  764  PKDFASRIYSTVKSSLNISP  783



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LTKWWKG+L S+NVD+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  633  KDLKESFKELTKWWKGSLTSENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  692

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQ YMRGKRVLEINPRHPIIKELRERVV DPEDES K+TA+L Y+TALMESGF + D
Sbjct  693  DASKQGYMRGKRVLEINPRHPIIKELRERVVNDPEDESVKQTARLMYQTALMESGFMLND  752

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SL ISPD
Sbjct  753  PKDFASRIYDSVKASLKISPD  773



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VK+S RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  640  KELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  699

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TAQL Y+TALMESGF++ D
Sbjct  700  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSLND  759

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y +VKSSLNISP
Sbjct  760  PKDFASRIYSTVKSSLNISP  779



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VK+S RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  642  KELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  701

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TAQL Y+TALMESGF++ D
Sbjct  702  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSLND  761

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  Y +VKSSLNISP
Sbjct  762  PKDFASRIYSTVKSSLNISP  781



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFKDLTKWWK AL S+NVD+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  634  KDLKESFKDLTKWWKSALASENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  693

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKEL+ERVVKD EDE  K+TAQL Y+TALMESGF + D
Sbjct  694  DASKQAYMRGKRVLEINPRHPIIKELQERVVKDSEDEGVKKTAQLMYQTALMESGFLLSD  753

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK FAS  Y SVKSSLNISPD
Sbjct  754  PKHFASNIYDSVKSSLNISPD  774



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKIS RLA+TPCVVVTSKYG S+NMERIMQSQ LS
Sbjct  639  KELKESFKELTKWWKGALASENVDDVKISNRLANTPCVVVTSKYGWSSNMERIMQSQTLS  698

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKD EDES K+TA+L Y+TALMESGF + D
Sbjct  699  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDAEDESVKQTARLMYQTALMESGFMLND  758

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SVKSSL ISPD
Sbjct  759  PKEFASSIYDSVKSSLKISPD  779



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK LTKWWKGAL SDNVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  708  KELKESFKGLTKWWKGALASDNVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  767

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYM+GKRVLEINPRHPIIKELRERV+KDPEDES K+TAQL Y+TALMESGF + D
Sbjct  768  DANKQAYMKGKRVLEINPRHPIIKELRERVLKDPEDESIKQTAQLVYQTALMESGFVLTD  827

Query  197  PKDFASXXYXSVKSSLNISP  138
            PK FAS  Y SVK+SL ISP
Sbjct  828  PKSFASQIYSSVKNSLEISP  847



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557   KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
             K+LKESFKDLTKWWK AL S+NVD+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  900   KDLKESFKDLTKWWKSALASENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  959

Query  377   DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
             DASKQAYMRGKRVLEINPRHPIIKEL+ERVVKD EDE  K+TAQL Y+TALMESGF + D
Sbjct  960   DASKQAYMRGKRVLEINPRHPIIKELQERVVKDSEDEGVKKTAQLMYQTALMESGFLLSD  1019

Query  197   PKDFASXXYXSVKSSLNISPD  135
             PK FAS  Y SVKSSLNISPD
Sbjct  1020  PKHFASNIYDSVKSSLNISPD  1040



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S NVD+VKIS RLAD+PCVVVTSKYG ++NMERIMQSQ LS
Sbjct  638  KELKESFKELTKWWKGALASHNVDDVKISNRLADSPCVVVTSKYGWTSNMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELR+RVVKD EDES K+TAQL Y+TALMESGF + D
Sbjct  698  DANKQAYMRGKRVLEINPRHPIIKELRDRVVKDSEDESVKQTAQLIYQTALMESGFMLSD  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+DFAS  Y SVK+SL ISPD
Sbjct  758  PQDFASRIYSSVKNSLKISPD  778



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFILTD  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA+  Y SVKS LNISPD
Sbjct  755  PKDFAARIYNSVKSGLNISPD  775



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFILTD  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA+  Y SVKS LNISPD
Sbjct  755  PKDFAARIYNSVKSGLNISPD  775



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWK +L ++NVD+VKIS RLADTPCVVVTSKYG SANMERIMQSQ LS
Sbjct  640  KELKESFKELTKWWKESLATENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  699

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKEL+ERV  DPE+ES KETA+L Y+TAL+ESGF + D
Sbjct  700  DASKQAYMRGKRVLEINPRHPIIKELKERVASDPEEESAKETAKLMYQTALLESGFILQD  759

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SLNISPD
Sbjct  760  PKDFASRIYNSVKTSLNISPD  780



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK+SFK+LTKWWKG L +++VDEVKIS RL +TPCVVVTSK+G SANMER+MQ+Q L+
Sbjct  633  RELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSKFGWSANMERLMQAQTLT  692

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKR+LEINPRHPI+KELRERVVKDPEDE  K+TAQL Y+TALMESGF + D
Sbjct  693  DASKQAYMRGKRILEINPRHPIVKELRERVVKDPEDEGVKQTAQLIYQTALMESGFILSD  752

Query  197  PKDFASXXYXSVKSSLNISPDavveedxeveeeaetsskeaeSNPENAEDGADGIKDEL  21
            PKDFAS  Y SVKSSLNISPDA +EE+ +VEE       +A  +  +AE  + G+KDEL
Sbjct  753  PKDFASRIYSSVKSSLNISPDATIEEEDDVEETETEPETKAGKDGADAE--SSGLKDEL  809



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKIS RL ++PCVVVTSKYG SANMERIMQSQ LS
Sbjct  634  KELKESFKELTKWWKGALTSENVDDVKISNRLDNSPCVVVTSKYGWSANMERIMQSQSLS  693

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D  KQAYMRGKRVLEINPRHPIIKELRERVVKDPED S K+TA+L Y+T+LMESGF + D
Sbjct  694  DHRKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDNSVKQTARLIYQTSLMESGFMLDD  753

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SLNISPD
Sbjct  754  PKDFASRIYDSVKTSLNISPD  774



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK +L +DNVD+VKIS RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  638  KELKESFKDLTKWWKNSLANDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA KQAYMRGKRVLEINPRHPIIKELRERVVK+PEDES K+TAQL Y+TAL ESGF + D
Sbjct  698  DAKKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKQTAQLMYQTALFESGFLLND  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SL+ISPD
Sbjct  758  PKDFASRIYDSVKTSLDISPD  778



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK AL  DNVD+VK+S RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KELKESFKDLTKWWKTALSFDNVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIK+LRER+VKDPEDE  K+ A+L Y+TAL+ESGF + D
Sbjct  698  DASKQAYMRGKRVLEINPRHPIIKDLRERIVKDPEDEGAKQAAKLMYQTALLESGFILSD  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y +VK+SLNISPD
Sbjct  758  PKDFASQIYDTVKTSLNISPD  778



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELK+SFK+LTKWWKG L +++VDEVKIS RL +TPCVVVTSK+G SANMER+MQ+Q L+
Sbjct  636  KELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSKFGWSANMERLMQAQTLT  695

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRG+R+LEINPRHPIIKELRERVVKDPEDE  K+TAQL Y+TALMESGF + D
Sbjct  696  DASKQAYMRGRRILEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALMESGFILTD  755

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNI PD
Sbjct  756  PKDFASRIYSSVKSSLNIGPD  776



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFA+  Y SVKS LNISP
Sbjct  755  PKDFAARIYNSVKSGLNISP  774



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK LTKWWK  L SDNV++VKIS RLADTPCVVVTSKYG SA ME+IM SQ LS
Sbjct  638  KELKESFKGLTKWWKNTLASDNVEDVKISSRLADTPCVVVTSKYGWSAYMEKIMHSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIK LRERVV DPEDES K TA+L Y+TALMESGF++ D
Sbjct  698  DASKQAYMRGKRVLEINPRHPIIKALRERVVTDPEDESVKLTAKLIYQTALMESGFDLSD  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  758  PKDFASHIYSSVKSSLNISPD  778



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFLLTD  754

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFA+  Y SVKS LNISP
Sbjct  755  PKDFAARIYNSVKSGLNISP  774



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK AL  DNVD+VKIS RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  637  KELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TAQL Y+TAL ESGF + D
Sbjct  697  DASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFESGFLLDD  756

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SL+ISP+
Sbjct  757  PKDFASRIYDSVKTSLDISPE  777



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK AL  DNVD+VK+S RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KELKESFKDLTKWWKTALSFDNVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPI+K+LRER+VKDPEDE  K+ A+L Y+TAL+ESGF + D
Sbjct  698  DASKQAYMRGKRVLEINPRHPIVKDLRERIVKDPEDEGAKQAAKLMYQTALLESGFILSD  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y +VK+SLNISPD
Sbjct  758  PKDFASQIYDTVKTSLNISPD  778



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK AL  DNVD+VKIS RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  638  KELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TAQL Y+TAL ESGF + D
Sbjct  698  DASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFESGFLLDD  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SL+ISP+
Sbjct  758  PKDFASRIYDSVKTSLDISPE  778



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKES+K+LTKWWK AL SDNVD+VKIS RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  642  KDLKESYKELTKWWKSALASDNVDDVKISNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  701

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQ YMRGKRVLEINPRHPIIKELRERVVK+PEDES K TAQL Y+TALMESGF + D
Sbjct  702  DANKQGYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKNTAQLMYQTALMESGFTLSD  761

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFAS  + SVKS LNISP
Sbjct  762  PKDFASRIHDSVKSGLNISP  781



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK LTKWWK  L SDNV++VKIS RLADTPCVVVTSKYG SA ME+IM SQ LS
Sbjct  632  KELKESFKGLTKWWKTTLASDNVEDVKISNRLADTPCVVVTSKYGWSAYMEKIMHSQTLS  691

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIK LRERVV DPEDES K TA+L Y+TALMESGF++ D
Sbjct  692  DASKQAYMRGKRVLEINPRHPIIKALRERVVTDPEDESVKLTAKLIYQTALMESGFDLSD  751

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  752  PKDFASHIYSSVKSSLNISPD  772



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFLLND  754

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFA+  Y SVKS LNISP
Sbjct  755  PKDFAARIYNSVKSGLNISP  774



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK +L  DNVD+VKIS RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  639  KELKESFKDLTKWWKSSLSKDNVDDVKISNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  698

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K+TAQL Y+TAL ESGF + D
Sbjct  699  DASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKQTAQLMYQTALFESGFLLDD  758

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDF S  Y SVK+SL+ISP+
Sbjct  759  PKDFTSRIYDSVKTSLDISPE  779



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK AL  DNVD+VKIS RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  637  KELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLE+NPRHPIIKELRERVVK+PEDE  K TAQL Y+TAL ESGF + D
Sbjct  697  DASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFESGFLLDD  756

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SL+ISP+
Sbjct  757  PKDFASRIYDSVKTSLDISPE  777



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWK +L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  604  KELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  663

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  664  DANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFVLND  723

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA   Y SVKSSL ISPD
Sbjct  724  PKDFAGRIYNSVKSSLKISPD  744



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWK +L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA   Y SVKSSL ISPD
Sbjct  755  PKDFAGRIYNSVKSSLKISPD  775



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK AL  DNVD+VKIS RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  638  KELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLE+NPRHPIIKELRERVVK+PEDE  K TAQL Y+TAL ESGF + D
Sbjct  698  DASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFESGFLLDD  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SL+ISP+
Sbjct  758  PKDFASRIYDSVKTSLDISPE  778



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWK +L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA   Y SVKSSL ISPD
Sbjct  755  PKDFAGRIYNSVKSSLKISPD  775



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFA+  Y SVKSSL+ISP
Sbjct  755  PKDFAARIYNSVKSSLSISP  774



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWK +L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA   Y SVKSSL ISPD
Sbjct  755  PKDFAGRIYNSVKSSLKISPD  775



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK +L  DNVD+VKIS RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  638  KELKESFKDLTKWWKNSLSKDNVDDVKISDRLDNTPCVVVTSKFGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TAQL Y+TAL ESGF + D
Sbjct  698  DASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKNTAQLMYQTALFESGFLLND  757

Query  197  PKDFASXXYXSVKSSLNISPDa--vveedxeveeeaetsskeaeSNPENAEDGADGIKDE  24
            PKDFAS  Y SVK+SL+ISP+A    E+D EVE E+ET  + + SNPE A++  D +KDE
Sbjct  758  PKDFASRIYDSVKTSLDISPEATVEEEDDTEVEVESETKEETSTSNPE-ADEVNDDVKDE  816

Query  23   L  21
            L
Sbjct  817  L  817



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFKDLTKWWK +L  DNVD+VKIS RL +TPCVVVTSK+G SANMERIMQSQ LS
Sbjct  637  KELKESFKDLTKWWKNSLSKDNVDDVKISDRLDNTPCVVVTSKFGWSANMERIMQSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TAQL Y+TAL ESGF + D
Sbjct  697  DASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKNTAQLMYQTALFESGFLLND  756

Query  197  PKDFASXXYXSVKSSLNISPDa--vveedxeveeeaetsskeaeSNPENAEDGADGIKDE  24
            PKDFAS  Y SVK+SL+ISP+A    E+D EVE E+ET  + + SNPE A++  D +KDE
Sbjct  757  PKDFASRIYDSVKTSLDISPEATVEEEDDTEVEVESETKEETSTSNPE-ADEVNDDVKDE  815

Query  23   L  21
            L
Sbjct  816  L  816



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFA+  Y SVKSSL+ISP
Sbjct  755  PKDFAARIYNSVKSSLSISP  774



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K LKESFK+LTKWWKGAL S+NVD+VKIS RL+ +PCVVVTSKYG SANMERIMQSQ LS
Sbjct  635  KALKESFKELTKWWKGALVSENVDDVKISNRLSGSPCVVVTSKYGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA KQ+YMRGKRVLEIN RHPIIKELRERVVKDPEDES K+TAQL Y+TAL+ESGF + D
Sbjct  695  DARKQSYMRGKRVLEINARHPIIKELRERVVKDPEDESVKQTAQLMYQTALLESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVK+SL ISPD
Sbjct  755  PKDFASRIYSSVKNSLRISPD  775



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWK +L S+NVD+VKIS RLADTPCVVV SK+G SANMERIMQSQ LS
Sbjct  631  KELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVASKFGWSANMERIMQSQTLS  690

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  691  DANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFVLND  750

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA   Y SVKSSL ISPD
Sbjct  751  PKDFAGRIYNSVKSSLKISPD  771



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 145/179 (81%), Gaps = 5/179 (3%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE+KES+K+LTKWWKGAL +D VD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  637  KEIKESYKELTKWWKGALATDKVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELRERV  DPED+  K+TA+L Y+TAL ESGF + D
Sbjct  697  DANKQAYMRGKRVLEINPRHPIIKELRERVATDPEDDGVKQTARLMYQTALFESGFLLDD  756

Query  197  PKDFASXXYXSVKSSLNISPDavveedxeveeeaetsskeaeSNPENAEDGADGIKDEL  21
            PKDFAS  Y SVK+SL+I+PDA VEE+ + EE       ++ SN E     AD +KDEL
Sbjct  757  PKDFASRVYDSVKTSLSINPDAAVEEEDDTEEPEIEMKGDSSSNAE-----ADDVKDEL  810



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE+KESFK+LTKWWKGAL SDNVD+VKIS RL+D+PCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KEVKESFKELTKWWKGALASDNVDDVKISSRLSDSPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQA-YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVP  201
            D++KQ+ YMRGKRVLEINPRHPIIKELR+RV  +PEDE  K+TAQL Y+TALMESGF + 
Sbjct  698  DSNKQSSYMRGKRVLEINPRHPIIKELRDRVALNPEDEGVKQTAQLMYQTALMESGFVLN  757

Query  200  DPKDFASXXYXSVKSSLNISPD  135
            DPKDFAS  Y SVK+SLNISPD
Sbjct  758  DPKDFASRIYGSVKNSLNISPD  779



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWKG L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFLLND  754

Query  197  PKDFASXXYXSVKSSLNIS  141
            PKDFA+  Y SVKSSL IS
Sbjct  755  PKDFAARIYNSVKSSLKIS  773



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWK +L S+NVD+VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++RV  D EDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRVASDAEDESVKETAQLMYQTALIESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA+  Y SVKSSL ISPD
Sbjct  755  PKDFAARIYNSVKSSLKISPD  775



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LT WWK AL S+NVD VKIS RL +TPCVVVTSKYG SANME+IMQSQ LS
Sbjct  635  KELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERV +DPEDES K+TA+L Y+TALMESGFN+ D
Sbjct  695  DASKQAYMRGKRVLEINPRHPIIKELRERVAQDPEDESMKQTARLIYQTALMESGFNLND  754

Query  197  PKDFASXXYXSVKSSLNISP  138
            PK+FAS  Y SV  SL+ISP
Sbjct  755  PKEFASSIYKSVHKSLDISP  774



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LT WWK AL S+NVD VKIS RL +TPCVVVTSKYG SANME+IMQSQ LS
Sbjct  640  KELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQTLS  699

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERV +DP+DES K+TAQL Y+TALMESGF + D
Sbjct  700  DASKQAYMRGKRVLEINPRHPIIKELRERVAQDPKDESVKQTAQLIYQTALMESGFILND  759

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+ SL+ISPD
Sbjct  760  PKEFASSIYKSVQKSLDISPD  780



>gb|AFW75769.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=429

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LT WWK AL S+NVD VKIS RL DTPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  258  KELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQTLS  317

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L Y+TALMESGFN+PD
Sbjct  318  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNLPD  377

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+  L++SPD
Sbjct  378  PKEFASSIYKSVQKGLDLSPD  398



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKIS RLADTPCVVVTSKYG SANMERIMQ+Q LS
Sbjct  638  KELKESFKELTKWWKGALASENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQAQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA L Y+TALMESGF + D
Sbjct  698  DANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALMESGFILND  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSL+ISPD
Sbjct  758  PKDFASRIYSSVKSSLSISPD  778



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWK AL ++NVD VKIS RL +TPCVVVTSKYG SANME+IMQSQ LS
Sbjct  636  KELKETFKELTKWWKDALSAENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQTLS  695

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRER+  +P+DES K+TA+L Y+TALMESGF + D
Sbjct  696  DASKQAYMRGKRVLEINPRHPIIKELRERIAANPQDESIKQTARLMYQTALMESGFLLND  755

Query  197  PKDFASXXYXSVKSSLNISPDavveedxeveeeaetsskeaeSNPENAEDGADGIKDEL  21
            PKDFA   Y SVK+SL+ISPDA  EE+ ++EE      + A ++ E  E+ +  +KDEL
Sbjct  756  PKDFAERIYSSVKASLDISPDATAEEEDDIEETEAEEKESASADKEADEEDSSSLKDEL  814



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKIS RLADTPC+VVTSKYG SANMERIMQ+Q LS
Sbjct  638  KELKESFKELTKWWKGALASENVDDVKISNRLADTPCIVVTSKYGWSANMERIMQAQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA L Y+TALMESGF + D
Sbjct  698  DANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALMESGFILND  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSL+ISPD
Sbjct  758  PKDFASRIYSSVKSSLSISPD  778



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL S+NVD VKIS RL DTPCVVVTSKYG SANME+IMQSQ LS
Sbjct  635  KDLKESFKELTDWWKKALDSENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L Y+TALMESGFN+PD
Sbjct  695  DASKQAYMRGKRVLEINPRHPIIKELRDKVAEDNESESLKQTAKLVYQTALMESGFNLPD  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  755  PKDFASSIYKSVQKSLDLSPD  775



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL S+NVD VKIS RL +TPCVVVTSKYG SANME+IMQSQ LS
Sbjct  635  KDLKESFKELTSWWKEALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELRERV  DP+DE+ K+TA+L Y+TALMESGF + D
Sbjct  695  DASKQAYMRGKRVLEINPRHPIIKELRERVAVDPQDENIKQTAKLIYQTALMESGFLMND  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FA+  Y SVKSSLNISPD
Sbjct  755  PKEFATSIYSSVKSSLNISPD  775



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LT WWK AL S+NVD VKIS RL +TPCVVVTSKYG SANME+IMQSQ LS
Sbjct  656  KELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQTLS  715

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPI+KELRERV +DP+DES K+TA+L Y+TALMESGF + D
Sbjct  716  DASKQAYMRGKRVLEINPRHPIVKELRERVAQDPKDESVKQTARLIYQTALMESGFILND  775

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+ SL+ISPD
Sbjct  776  PKEFASSIYKSVQKSLDISPD  796



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE KESFK+LT WWK  L SDNVD VKIS RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  638  KETKESFKELTNWWKDVLSSDNVDSVKISNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  697

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELRERV  DP+DE+ KETA+L Y+TALMESGF + +
Sbjct  698  DANKQAYMRGKRVLEINPRHPIIKELRERVAVDPQDENVKETAKLMYQTALMESGFMLSE  757

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SVKSSL ISPD
Sbjct  758  PKEFASSIYNSVKSSLKISPD  778



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL +++VD VKIS RL+DTPCVVVTSKYG SANME+IMQSQ LS
Sbjct  634  KDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQTLS  693

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L Y+TALMESGFN+PD
Sbjct  694  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNLPD  753

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  754  PKDFASSIYRSVQKSLDLSPD  774



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL +++VD VKIS RL+DTPCVVVTSKYG SANME+IMQSQ LS
Sbjct  636  KDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQTLS  695

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L Y+TALMESGFN+PD
Sbjct  696  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNLPD  755

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  756  PKDFASSIYRSVQKSLDLSPD  776



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LT WWKG L SDNVD VKIS RLADTPCVVVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTTWWKGILASDNVDSVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKEL++R+  D EDES KETAQL Y+TAL+ESGF + D
Sbjct  695  DANKQAYMRGKRVLEINPRHPIIKELKDRIASDSEDESVKETAQLMYQTALIESGFVLND  754

Query  197  PKDFASXXYXSVKSSLNIS  141
            PKDFA+  Y SVKS L IS
Sbjct  755  PKDFAARIYNSVKSGLKIS  773



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL +++VD VKIS RL+DTPCVVVTSKYG SANME+IMQSQ LS
Sbjct  661  KDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQTLS  720

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L Y+TALMESGFN+PD
Sbjct  721  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNLPD  780

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  781  PKDFASSIYRSVQKSLDLSPD  801



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL +++VD VKIS RL+DTPCVVVTSKYG SANME+IMQSQ LS
Sbjct  662  KDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQTLS  721

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L Y+TALMESGFN+PD
Sbjct  722  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNLPD  781

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  782  PKDFASSIYRSVQKSLDLSPD  802



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LT WWK +L S+NVD VKIS RL +TPCVVVTSKYG SANME+IMQSQ LS
Sbjct  640  KELKESFKELTDWWKNSLSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQTLS  699

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYM GKRVLEINPRHPIIKELRERV +DP+DES K+TA+L Y+TALMESGF + D
Sbjct  700  DASKQAYMHGKRVLEINPRHPIIKELRERVAQDPKDESVKQTARLIYQTALMESGFILND  759

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+ SL+ISPD
Sbjct  760  PKEFASSIYNSVQKSLDISPD  780



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FK+LTKWWK +L  +NVD+VKIS RLADTPC+VVTSK+G SANMERIMQSQ LS
Sbjct  635  KELKEAFKELTKWWKESLAGENVDDVKISNRLADTPCIVVTSKFGWSANMERIMQSQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA KQAYMRGKRVLEINPRHPIIKEL++RV  D ED+S KETAQL Y+TAL+ESGF + D
Sbjct  695  DAKKQAYMRGKRVLEINPRHPIIKELKDRVASDQEDKSVKETAQLMYQTALIESGFILND  754

Query  197  PKDFASXXYXSVKSSLNISP  138
            PKDFA   Y SVKSSL ISP
Sbjct  755  PKDFAGRIYNSVKSSLKISP  774



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL +++VD VKIS RL+DTPCVVVTSKYG SANME+IMQSQ LS
Sbjct  634  KDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQTLS  693

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L Y+TALMESGFN+PD
Sbjct  694  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNLPD  753

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA   Y SV+ SL++SPD
Sbjct  754  PKDFAFSIYRSVQKSLDLSPD  774



>gb|AFW75768.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=667

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LT WWK AL S+NVD VKIS RL DTPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  496  KELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQTLS  555

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L Y+TALMESGFN+PD
Sbjct  556  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNLPD  615

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+  L++SPD
Sbjct  616  PKEFASSIYKSVQKGLDLSPD  636



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKE+FKDLTKWWK +L  +NVD+VKIS RLADT CVVVTSK+G SANMERIMQSQ LS
Sbjct  617  KELKEAFKDLTKWWKESLAGENVDDVKISNRLADTLCVVVTSKFGWSANMERIMQSQTLS  676

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA KQAYMRGKRVLEIN RHPIIKEL++RV  DPED S KETAQL Y+TAL+ESGF + D
Sbjct  677  DAKKQAYMRGKRVLEINLRHPIIKELKDRVASDPEDGSVKETAQLMYQTALIESGFILND  736

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA   Y SVKSSL ISPD
Sbjct  737  PKDFAGRIYNSVKSSLKISPD  757



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL S+NVD VKIS RL DTPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  632  KDLKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQTLS  691

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA+L Y+TALMESGFN+PD
Sbjct  692  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDTESEGLKQTARLVYQTALMESGFNLPD  751

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+ SL++SPD
Sbjct  752  PKEFASSIYKSVQKSLDLSPD  772



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LT WWK AL S+NVD VKIS RL DTPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  633  KELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQTLS  692

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L Y+TALMESGFN+PD
Sbjct  693  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNLPD  752

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+  L++SPD
Sbjct  753  PKEFASSIYKSVQKGLDLSPD  773



>dbj|BAJ89816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL ++ +D VKIS RL +TPCVVVTSKYG S+NME+IMQ+Q LS
Sbjct  365  KDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTLS  424

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA+L Y+TALMESGFN+PD
Sbjct  425  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNLPD  484

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  485  PKDFASSIYRSVQKSLDLSPD  505



>gb|ABK24228.1| unknown [Picea sitchensis]
Length=466

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE+K+SFK+LT WWK  L S+NVD VKIS RL +TP VVVTSKYG SANMERIMQSQ LS
Sbjct  269  KEIKDSFKELTNWWKDILSSENVDSVKISNRLDNTPGVVVTSKYGWSANMERIMQSQTLS  328

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA++Q+YMRGKRVLEINPRHPIIKELRERV + PEDE+ K+TA+L Y+TALMESGF + D
Sbjct  329  DANRQSYMRGKRVLEINPRHPIIKELRERVTQSPEDENIKQTARLIYQTALMESGFILND  388

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y ++K++LN++PD
Sbjct  389  PKEFASSIYSTIKTTLNVNPD  409



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL S+NVD VKIS RL DTPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  635  KDLKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQTLS  694

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L Y+TALMESGFN+PD
Sbjct  695  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNLPD  754

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+  L++SPD
Sbjct  755  PKEFASSIYKSVQKGLDLSPD  775



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   221 bits (563),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL S+NVD VKIS RL +TPCVVVTSKYG SANME+IMQSQ LS
Sbjct  637  KDLKESFKELTNWWKDALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA+KQAYMRGKRVLEINPRHPIIKELR+RV +D +DE  K TA+L Y+TALMESGF + D
Sbjct  697  DATKQAYMRGKRVLEINPRHPIIKELRDRVAQDSKDEGLKHTARLIYQTALMESGFILND  756

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL+ISPD
Sbjct  757  PKDFASSIYKSVQKSLDISPD  777



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+L+ WWK AL S+NVD VKIS RL +TPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  633  KELKESFKELSDWWKKALESENVDSVKISNRLHNTPCVVVTSKYGWSANMEKIMQAQTLS  692

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L Y+TALMESGFN+PD
Sbjct  693  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNLPD  752

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+ SL++SPD
Sbjct  753  PKEFASSIYKSVQKSLDLSPD  773



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL S+++D VKIS RL +TPCVVVTSKYG S+NME+IMQ+Q LS
Sbjct  632  KDLKESFKELTDWWKKALESESIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTLS  691

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L Y+TALMESGFN+PD
Sbjct  692  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTARLVYQTALMESGFNLPD  751

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++S D
Sbjct  752  PKDFASSIYRSVQKSLDLSED  772



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL ++ +D VKIS RL +TPCVVVTSKYG S+NME+IMQ+Q LS
Sbjct  631  KDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTLS  690

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D ED   K+TA+L Y+TALMESGFN+PD
Sbjct  691  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDNEDVGLKQTARLVYQTALMESGFNLPD  750

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  751  PKDFASSIYRSVQKSLDLSPD  771



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WW  AL S+NVD VKIS RL +TPCVVVTSKYG SANME+IMQSQ LS
Sbjct  634  KDLKESFKELTNWWNDALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQTLS  693

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHP+IKELR+RV +D +DES K TA+L Y+TALMESGF + D
Sbjct  694  DASKQAYMRGKRVLEINPRHPVIKELRDRVAQDSKDESLKHTARLIYQTALMESGFILND  753

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FAS  Y SV+ SL+ISPD
Sbjct  754  PKEFASSIYKSVQKSLDISPD  774



>ref|NP_001146348.1| shepherd-like1 [Zea mays]
 gb|ACL53742.1| unknown [Zea mays]
Length=719

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT+WWK AL S++VD VK+S RL DTPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  544  KDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSKYGWSANMEKIMQAQTLS  603

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA+L Y+TALMESGFN+PD
Sbjct  604  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALMESGFNLPD  663

Query  197  PKDFASXXYXSVKSSLNISP  138
            PK+FAS  Y SV  SL++SP
Sbjct  664  PKEFASSIYKSVHKSLDLSP  683



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL ++ +D VKIS RL +TPCVVVTSKYG S+NME+IMQ+Q LS
Sbjct  632  KDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTLS  691

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA+L Y+TALMESGFN+PD
Sbjct  692  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNLPD  751

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  752  PKDFASSIYRSVQKSLDLSPD  772



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL ++ +D VKIS RL +TPCVVVTSKYG S+NME+IMQ+Q LS
Sbjct  700  KDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTLS  759

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA+L Y+TALMESGFN+PD
Sbjct  760  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNLPD  819

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  820  PKDFASSIYRSVQKSLDLSPD  840



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT+WWK AL S++VD VK+S RL DTPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  633  KDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSKYGWSANMEKIMQAQTLS  692

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA+L Y+TALMESGFN+PD
Sbjct  693  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALMESGFNLPD  752

Query  197  PKDFASXXYXSVKSSLNISP  138
            PK+FAS  Y SV  SL++SP
Sbjct  753  PKEFASSIYKSVHKSLDLSP  772



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 8/141 (6%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VKIS RL+D+PCVVVTSKYG S+NMERIMQSQ LS
Sbjct  637  KELKESFKELTKWWKGALASENVDDVKISNRLSDSPCVVVTSKYGWSSNMERIMQSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPII  +        +DES K+TAQL Y+TALMESGF + D
Sbjct  697  DASKQAYMRGKRVLEINPRHPIIFLV--------QDESVKQTAQLMYQTALMESGFLLND  748

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SVKSSLNISPD
Sbjct  749  PKDFASRIYSSVKSSLNISPD  769



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT+WWK AL S++VD VK+S RL DTPCVVVTSKYG SANME+IMQ+Q LS
Sbjct  826  KDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSKYGWSANMEKIMQAQTLS  885

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA+L Y+TALMESGFN+PD
Sbjct  886  DSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALMESGFNLPD  945

Query  197  PKDFASXXYXSVKSSLNISP  138
            PK+FAS  Y SV  SL++SP
Sbjct  946  PKEFASSIYKSVHKSLDLSP  965



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   218 bits (555),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKESFK+LT WWK AL ++ +D VKIS RL +TPCVVVTSKYG S+NME+IMQ+Q LS
Sbjct  641  KDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTLS  700

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA+L Y+TALMESGFN+PD
Sbjct  701  DASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNLPD  760

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFAS  Y SV+ SL++SPD
Sbjct  761  PKDFASSIYRSVQKSLDLSPD  781



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE+K+SFK+LT WWK  L S+NVD VKIS RL +TP VVVTSKYG SANMERIMQSQ LS
Sbjct  637  KEIKDSFKELTNWWKDVLSSENVDSVKISNRLDNTPGVVVTSKYGWSANMERIMQSQTLS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA++Q+YMRGKRVLEINP+HPIIKELRERV ++PE+E+ K+TA+L Y+TALMESGF + D
Sbjct  697  DANRQSYMRGKRVLEINPKHPIIKELRERVTQNPEEENIKQTARLIYQTALMESGFILND  756

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK+FA+  Y ++K++LN++PD
Sbjct  757  PKEFATSIYSTIKTTLNVNPD  777



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELK+SFK L  WWK  L  + VD VKIS RLADTP VVVTS YG SANMERIM++Q L+
Sbjct  657  KELKQSFKPLLAWWKDVLKPEGVDSVKISNRLADTPAVVVTSTYGWSANMERIMRAQTLT  716

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S+Q YMRGKRVLEINPRHPIIKELR +V + PEDESTK T +L YKTAL++SGF V D
Sbjct  717  DNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPEDESTKATGKLIYKTALIDSGFLVDD  776

Query  197  PKDFASXXYXSVKSSLNISPD  135
             K+FAS  Y  +KS+LNISPD
Sbjct  777  SKEFASQIYSIIKSNLNISPD  797



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELK+SFK L  WWK  L  + VD VKIS RLADTP VVVTS YG SANMERIM++Q L+
Sbjct  657  KELKQSFKPLLAWWKDVLKPEGVDSVKISNRLADTPAVVVTSTYGWSANMERIMRAQTLT  716

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S+Q YMRGKRVLEINPRHPIIKELR +V + PEDESTK T +L YKTAL++SGF V D
Sbjct  717  DNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPEDESTKATGKLIYKTALIDSGFLVDD  776

Query  197  PKDFASXXYXSVKSSLNISPD  135
             K+FAS  Y  +KS+LNISPD
Sbjct  777  SKEFASQIYSIIKSNLNISPD  797



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE+KES+K+LTKWWK  L  + V+ VK+S RLA+TP VVVTSKYG SANMERIMQ+Q L+
Sbjct  642  KEIKESYKELTKWWKDLLSGEMVEAVKVSNRLANTPAVVVTSKYGWSANMERIMQAQTLA  701

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D SKQ+YMRGKR+LEINP+HPIIK+L+E++    ED+S K+ A+L ++TAL+ESGF + D
Sbjct  702  DPSKQSYMRGKRILEINPKHPIIKDLKEKISLSSEDDSAKQAAKLVFETALLESGFVLED  761

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PKDFA+  Y  +KS+LN+SPD
Sbjct  762  PKDFANRIYSVIKSNLNVSPD  782



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KELKESFK+LTKWWKGAL S+NVD+VK+S RL +TPCVVVTSKYG SANMERIMQSQ LS
Sbjct  640  KELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLS  699

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  267
            DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE E
Sbjct  700  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEVE  736



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKE FKD T+WWK  L +D V+ VKIS RL  TPC VVTSKYG SANMERIM++Q LS
Sbjct  637  KKLKEQFKDFTRWWKDVLPADEVESVKISNRLVTTPCSVVTSKYGWSANMERIMKAQALS  696

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S+ +YM+GK+ LEINPRHPIIK L+ER   D +DE TK  A++ ++TA++ESGF   +
Sbjct  697  DESRLSYMKGKKTLEINPRHPIIKALKERAADDADDEETKTLAKVMFETAMLESGFTFEE  756

Query  197  PKDFASXXYXSVKSSLNIS  141
            P  FAS  +  V+S++ +S
Sbjct  757  PAGFASRLFDMVRSNMGVS  775



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK+SFK+LTKWWKG L +++VDEVKIS RL +TPCVVVTSK+G SANMER+MQ+Q L+
Sbjct  633  RELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSKFGWSANMERLMQAQTLT  692

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  273
            DASKQAYMRGKR+LEINPRHPI+KELRERVVKDPE
Sbjct  693  DASKQAYMRGKRILEINPRHPIVKELRERVVKDPE  727



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K++KE FKD TKWWK  L S+ V+ VKIS RL  TPC VVTSKYG SANMERIM++Q LS
Sbjct  613  KKVKEEFKDFTKWWKEILPSEEVEAVKISNRLVTTPCSVVTSKYGWSANMERIMKAQALS  672

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D  + AYMRG++ LEINP HPIIK L+E+   D  DE TK TA + Y+TAL+ESGF   +
Sbjct  673  DDGRMAYMRGRKTLEINPGHPIIKALKEKSEDDAGDEDTKRTALIMYETALLESGFMFEE  732

Query  197  PKDFASXXYXSVKSSLNISPD  135
            PK FA   +  V+  L +  D
Sbjct  733  PKGFAGRLFDMVRRDLGVEAD  753



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 100/141 (71%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+ KE+FK  T WWK  L    ++ VK+S RL+ TPCVVV+SKYG SANMERIM++Q + 
Sbjct  618  KKTKEAFKSFTTWWKSKLPDTMIEAVKVSNRLSTTPCVVVSSKYGWSANMERIMKAQAMG  677

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S+  YMRGK+ LE+NPRHP+I  L+ER   DP+ E T+  A+L ++TA++ESGF+   
Sbjct  678  DESRHEYMRGKKTLEVNPRHPMIAALKERAATDPDSEETETLAKLMFETAMLESGFSFDK  737

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+++ S  +  +KS++ I  D
Sbjct  738  PQEYTSRVFDLLKSNMGIEKD  758



>gb|ACN26939.1| unknown [Zea mays]
Length=123

 Score =   144 bits (362),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -2

Query  410  MERIMQSQXLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKT  231
            ME+IMQ+Q LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L Y+T
Sbjct  1    MEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQT  60

Query  230  ALMESGFNVPDPKDFASXXYXSVKSSLNISPD  135
            ALMESGFN+PDPK+FAS  Y SV+  L++SPD
Sbjct  61   ALMESGFNLPDPKEFASSIYKSVQKGLDLSPD  92



>gb|AFK40768.1| unknown [Lotus japonicus]
Length=82

 Score =   142 bits (357),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -2

Query  410  MERIMQSQXLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKT  231
            MERIMQSQ LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TAQL Y+T
Sbjct  1    MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQT  60

Query  230  ALMESGFNVPDPKDFAS  180
            AL ESGF + DPKDFAS
Sbjct  61   ALFESGFLLNDPKDFAS  77



>ref|XP_005842771.1| hypothetical protein CHLNCDRAFT_59468, partial [Chlorella variabilis]
 gb|EFN50654.1| hypothetical protein CHLNCDRAFT_59468 [Chlorella variabilis]
Length=325

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+LKE FKDL KWWK +L    V+ VK+S RLA TPCVVV+SKYG SA ME+I +SQ L 
Sbjct  200  KKLKEEFKDLAKWWKESL-GPAVESVKVSKRLATTPCVVVSSKYGWSATMEKIARSQTLG  258

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+ +  +MRG+R LEINPRHP+I+EL+ + + DPE  S K+ AQL Y+T L+ESG  + D
Sbjct  259  DSERAKWMRGQRTLEINPRHPLIRELKAQHIADPESASVKDNAQLLYQTCLLESGCLLDD  318

Query  197  PKDFAS  180
             K+F S
Sbjct  319  MKEFNS  324



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+ K++FK  T WWK  L  + ++ VK+S RL+ TPCVVV+SKYG SANMERIM++Q + 
Sbjct  616  KKTKDAFKTFTTWWKSKLPDNVIEAVKVSNRLSTTPCVVVSSKYGWSANMERIMKAQAMG  675

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S+  YMRGK+ LEINPRHP+I  L+ER   DP+    +  A+L ++TA++ESGF+   
Sbjct  676  DESRHEYMRGKKTLEINPRHPMIAALKERAASDPDSTENEALAKLMFETAMLESGFSFDK  735

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P D+A   +  +K ++ +  D
Sbjct  736  PGDYAGRVFDLLKMNMGVEKD  756



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+ K++FK  T WWK  L  + ++ VK+S RL+ TPCVVV+SKYG SANMERIM++Q + 
Sbjct  615  KKTKDAFKTFTTWWKSKLPDNVIEAVKVSNRLSTTPCVVVSSKYGWSANMERIMKAQAMG  674

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S+  YMRGK+ LEINPRHP+I  L+ER   DP+    +  A+L ++TA++ESGF+   
Sbjct  675  DESRHEYMRGKKTLEINPRHPMIAALKERAASDPDSTENEALAKLMFETAMLESGFSFDK  734

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P D+A   +  +K ++ +  D
Sbjct  735  PGDYAGRVFDLLKMNMGVEKD  755



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 3/144 (2%)
 Frame = -2

Query  557   KELKESFKDLTKWWKGALXS---DNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQ  387
             K+ KE FK  TKWWK AL +   D+++ VKIS RL+ TPCVVVTSKYG SANMERIM++Q
Sbjct  1036  KKTKEHFKPFTKWWKDALLTSYPDSIENVKISNRLSTTPCVVVTSKYGWSANMERIMRAQ  1095

Query  386   XLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFN  207
              LSD S+  YM+GK+ LEIN +HP++  L+E+   D EDE++K  A + ++TAL+ESGF 
Sbjct  1096  ALSDDSRAQYMKGKKTLEINYKHPLVAALKEKYEADGEDETSKNLAVVMFETALIESGFV  1155

Query  206   VPDPKDFASXXYXSVKSSLNISPD  135
             + D K  AS  +  +K  + +  D
Sbjct  1156  IDDSKSMASRVFDLLKDKMGVEKD  1179



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 92/137 (67%), Gaps = 1/137 (1%)
 Frame = -2

Query  545  ESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASK  366
            E FKD+  WWK  L +  V +VK+S RLA +P +V+TSKYG SANMERIM+SQ L D + 
Sbjct  606  EEFKDVLAWWKELLGA-AVGQVKVSTRLATSPAIVLTSKYGWSANMERIMKSQALGDTAD  664

Query  365  QAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDF  186
            ++YM+G + LEINPRHP++ EL+ +  +D E +     A+L + TAL+ESGF +  PK+F
Sbjct  665  RSYMKGMKTLEINPRHPLVLELKRQFEEDKESDKAAAYARLLWDTALLESGFEIEAPKEF  724

Query  185  ASXXYXSVKSSLNISPD  135
             S  Y  +  + NI  D
Sbjct  725  NSRIYGLLAQAYNIQGD  741



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -2

Query  530  LTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQAYMR  351
            LT+WWK  L  +++  VK+S RLA+TP VVVTS+ G S+NMER++ +Q L D SK + M+
Sbjct  590  LTRWWKDLLAGESIGFVKVSARLANTPAVVVTSRTGWSSNMERVVLAQALVDPSKVSQMK  649

Query  350  GKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFASXXY  171
             KR+LEINPRHPII+ L ++V +DP DE     A L Y+TAL+ESGF + + K FA   +
Sbjct  650  SKRILEINPRHPIIRMLLQKVTEDPADEVAHRVAVLIYETALLESGFTLNNAKTFAEQIH  709

Query  170  XSVKSSLNISPD  135
              +K  L++ P+
Sbjct  710  SLMKLVLDVDPN  721



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 92/141 (65%), Gaps = 4/141 (3%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELKE FKDLTKWWK  +    +  VK+S RLA TPC+VVT KYG SANMERIM++Q  S
Sbjct  584  EELKEQFKDLTKWWKKVVDDSKLQGVKVSNRLATTPCIVVTGKYGNSANMERIMRAQAFS  643

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE---DESTKETAQLXYKTALMESGFN  207
                 ++   +R LEINPRHP+I  L++++    E   +ES   TA+L Y+TAL+ESGF 
Sbjct  644  RPG-SSFTPTQRTLEINPRHPLIVALKDKLAAATEETVEESAVATARLLYETALLESGFV  702

Query  206  VPDPKDFASXXYXSVKSSLNI  144
              D K F+   Y  +K +L +
Sbjct  703  PDDAKAFSQRMYGVLKDTLGV  723



>ref|XP_006678605.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80649.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
Length=586

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K+ KE+F+ LTK  K  L  D V++V IS R+ ++PCV+VT++YG SANMERIM++Q L 
Sbjct  421  KQQKEAFEPLTKQIKEIL-GDKVEKVTISNRIVNSPCVLVTNQYGWSANMERIMKAQALR  479

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DAS Q+YM GK+ LE+NP + I+K L+ +V +D  D++ K+  QL Y+TAL+ SGF++ +
Sbjct  480  DASMQSYMLGKKTLELNPDNAIVKALKVKVDEDKNDKTVKDLTQLLYETALLSSGFSLEE  539

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P  FA   +  +K  L+I  D
Sbjct  540  PSSFAGRIHRMIKLGLSIDED  560



>ref|XP_007515443.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14322.1| predicted protein [Bathycoccus prasinos]
Length=802

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +++ + FK +T+W K  L  + V++V++S RL +TPC++VTSK+G SANMERIM++Q + 
Sbjct  652  EQIADEFKTVTEWLKKELVGE-VEKVEVSSRLTETPCILVTSKFGWSANMERIMKAQAMG  710

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DA  Q YM+GK+ LEINP  P+IK+L+ RV   P+ E TKE  +L + TAL+ SGF++  
Sbjct  711  DARAQDYMKGKKTLEINPFSPVIKQLKMRVESAPDAEETKEMCKLLFDTALLTSGFSIDQ  770

Query  197  PKDFASXXYXSVKSSLNI  144
            P +FA   +  +    N+
Sbjct  771  PAEFAERVFKLMTQEANL  788



>ref|XP_005538149.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
 dbj|BAC67671.2| heat shock 90kD protein [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82113.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
Length=706

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F +L K  K  L  D V++V +S RLAD+PC++VTS++G SANMERIM++Q L D++   
Sbjct  542  FANLLKVMKDIL-GDRVEKVILSERLADSPCILVTSEFGWSANMERIMKAQALRDSTMSM  600

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+++E+NP +PII+ELR+RV  DP D++ K+   L Y TAL+ SGF++ +P  F+S
Sbjct  601  YMSAKKIMEVNPSNPIIRELRDRVEADPSDKTVKDLVNLLYDTALLASGFSLDEPNTFSS  660

Query  179  XXYXSVKSSLNISPD  135
              +  +K  L+I  D
Sbjct  661  RIHRMIKLGLSIDED  675



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = -2

Query  533  DLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQAYM  354
            DLTKWWK  +    +  VK+S RLA TPCVVV+ KYG SANMERIM++Q  S  S  ++ 
Sbjct  646  DLTKWWKKVIEDSRLQTVKVSNRLATTPCVVVSGKYGQSANMERIMRAQAFS-RSAGSFT  704

Query  353  RGKRVLEINPRHPIIKELRERVV---KDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
             G+RVLEINPRHP+I  L++++    +D  DE+T  TA++ Y+TAL+ESGF   D K F+
Sbjct  705  PGQRVLEINPRHPLIVALKDKLAAASEDTVDETTVATARILYETALLESGFIPDDAKSFS  764

Query  182  SXXYXSVKSSLNI  144
               Y  +K +L +
Sbjct  765  QRVYSVLKGNLGV  777



>ref|XP_308799.3| AGAP006959-PA [Anopheles gambiae str. PEST]
 gb|EAA04769.4| AGAP006959-PA [Anopheles gambiae str. PEST]
Length=393

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L S  V++V +S RL D+PC +VTS+YG SANMERIM++Q L 
Sbjct  215  EEDKAKFENLCKVMKSVLES-KVEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQALR  273

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L ++TAL+ SGF++ +
Sbjct  274  DSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDE  333

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P   AS  Y  +K  L I  D
Sbjct  334  PGTHASRIYRMIKLGLGIDED  354



>gb|KDE07091.1| heat shock protein 90-1 [Microbotryum violaceum p1A1 Lamole]
Length=707

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 96/141 (68%), Gaps = 2/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE KE F+DLT+  K  L  D V++V IS R++D+PCV+VT  +G SANMERIM++Q L 
Sbjct  537  KETKE-FEDLTRTIKEIL-GDKVEKVSISNRISDSPCVLVTGAFGWSANMERIMKAQALR  594

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            DAS  +YM+ K+ LEINP + I+KELR +V +D  D++ ++   L Y+TAL+ SGF +  
Sbjct  595  DASMSSYMQSKKTLEINPHNAIVKELRSKVQEDAADKTVRDLVTLLYETALLTSGFTLDA  654

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P DFA+  +  +   L+I  D
Sbjct  655  PTDFAARIHRMISLGLSIDED  675



>ref|XP_006220022.1| PREDICTED: heat shock protein 90-like, partial [Vicugna pacos]
Length=189

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 87/135 (64%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL  +PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  25   FENLCKVIKDILEK-KVEKVAVSNRLVHSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  83

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H I+K LRERV  D  D++ K+   L ++TAL+ SGF + +P+  AS
Sbjct  84   YMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLSSGFTLEEPQSHAS  143

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L+I  D
Sbjct  144  RIYRMIKLGLDIGDD  158



>gb|EWM29604.1| heat shock protein 90 [Nannochloropsis gaditana]
Length=713

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 94/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK   + L K  K  L  + VD+V +S RLAD+PCV+VT +YG SANMERIM++Q L 
Sbjct  543  EELKAKTEGLCKLMKEVL-DEKVDKVVVSPRLADSPCVLVTGEYGWSANMERIMKAQALR  601

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP+HPI+K LRE+   +  D++ K+   L Y T+L+ SGF++ D
Sbjct  602  DSSTSAYMTSKKTMEINPKHPIVKALREKAEANQTDKTLKDLTWLLYDTSLLTSGFSLDD  661

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P  FAS  +  +K  L+I  D
Sbjct  662  PNTFASRIHRLIKLGLSIDED  682



>emb|CAG01829.1| unnamed protein product [Tetraodon nigroviridis]
Length=212

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L D+S   
Sbjct  48   FENLCKIMKDILDK-KIEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQALRDSSTMG  106

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HPII+ LRE+   D  D++ K+   L Y+TAL+ SGF + DP+  A+
Sbjct  107  YMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLYETALLSSGFTLEDPQTHAN  166

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L I  D
Sbjct  167  RIYRMIKLGLGIDDD  181



>gb|ABF61871.1| chaperone [Agave tequilana]
Length=174

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 89/136 (65%), Gaps = 1/136 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            +F++L K  K  L  D V++V +S R+ D+PC +VT +YG +ANMERIM++Q L D +  
Sbjct  15   AFENLCKTMKEIL-GDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNNMS  73

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            AYM  K+ +EINP + I++ELR+R   D  D+S K+   L ++TAL+ SGF++ DP  FA
Sbjct  74   AYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFA  133

Query  182  SXXYXSVKSSLNISPD  135
               +  +K  LNI  D
Sbjct  134  GRIHRMLKLGLNIDED  149



>ref|XP_005855339.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
 gb|EKU21014.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
Length=712

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK   + L K  K  L  + VD+V +S RLAD+PCV+VT +YG SANMERIM++Q L 
Sbjct  543  EELKAKTEGLCKLMKEVL-DEKVDKVVVSPRLADSPCVLVTGEYGWSANMERIMKAQALR  601

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP+HPI+K LRE+   +  D++ K+   L Y T+L+ SGF++ D
Sbjct  602  DSSTSAYMTSKKTMEINPKHPIVKALREKAEANQTDKTLKDLTWLLYDTSLLTSGFSLDD  661

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FAS  +  +K  L+I
Sbjct  662  PNTFASRIHRLIKLGLSI  679



>gb|KHJ75602.1| Hsp90 protein [Oesophagostomum dentatum]
Length=212

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL ++PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  48   FENLCKVIKDILEK-KVEKVVVSNRLVNSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  106

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H I+K LRERV  D  D++ K+   L ++TAL+ SGF++ +P+  AS
Sbjct  107  YMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLSSGFSLEEPQSHAS  166

Query  179  XXYXSVKSSLNIS  141
              Y  +K  L+I 
Sbjct  167  RIYRMIKLGLDIG  179



>ref|XP_010902983.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Esox lucius]
Length=725

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 89/141 (63%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK +F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  555  EELKTTFENLCKIMKDILDK-KIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQALR  613

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L ++TALM SGF + D
Sbjct  614  DNSTMGYMTAKKHLEINPTHPIIETLREKAEADKNDKAVKDLVILLFETALMSSGFTLDD  673

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  674  PQTHANRIYRMIKLGLGIDDD  694



>ref|XP_009616710.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=163

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = -2

Query  554  ELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSD  375
            EL+ SF  L + WK  L  DN+D VKI+  L DT  V+VTS YG +A +ER++QSQ + D
Sbjct  33   ELENSFNKLAQRWKNILAEDNID-VKINHVLVDTLYVIVTSTYGLTAYLERLLQSQAILD  91

Query  374  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDP  195
              KQ YM  KRVL+IN +H IIKELR RV KDP+D++ KE  ++ Y  A + +G  + D 
Sbjct  92   LDKQTYMLNKRVLKINHKHSIIKELRSRVAKDPKDDNAKEIEKIIYGIASLTNGLKLTDL  151

Query  194  KDFASXXYXSVK  159
               A   Y  V+
Sbjct  152  DSAAFHPYNLVQ  163



>gb|ACU45247.1| HSP90 [Karlodinium veneficum]
Length=373

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -2

Query  554  ELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSD  375
            ELK  F+ LTK  K  L  D V++V IS R+AD+PCV+ TS+YG SANMERIM++Q L D
Sbjct  205  ELKAEFEPLTKLMKEVL-GDKVEKVLISSRMADSPCVLTTSEYGWSANMERIMKAQALRD  263

Query  374  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDP  195
             S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L + T+L+ SGFN+ +P
Sbjct  264  NSMTSYMVSKKTMEVNPKHSIMTELKKKAAADKSDKTVKDLIWLLFDTSLLTSGFNLDEP  323

Query  194  KDFASXXYXSVKSSLNI  144
              FA   +  +K  L+I
Sbjct  324  TQFAGRIHRMIKLGLSI  340



>ref|XP_001445076.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK77679.1| unnamed protein product [Paramecium tetraurelia]
Length=322

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 93/141 (66%), Gaps = 2/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K LK+ F+ LT WW+  L S+NVD V IS RL + P +VV+S+ G SANMERI ++Q  S
Sbjct  134  KALKKVFQPLTDWWR-KLLSENVDSVVISQRLIEDPIIVVSSESGYSANMERISKAQAYS  192

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
                 +   GK+++EINP H  I+EL +RV  DP D+ T+E A++ Y+ AL+ SG+++P+
Sbjct  193  SKGSNSQQFGKKIVEINPNHQAIQELLQRVKDDP-DQETEEMAKVLYEAALVNSGYSIPN  251

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+ FAS  Y    S+L I  D
Sbjct  252  PEKFASRFYKLFNSALGIDRD  272



>ref|XP_011398501.1| Heat shock protein 90-2 [Auxenochlorella protothecoides]
 gb|KFM25605.1| Heat shock protein 90-2 [Auxenochlorella protothecoides]
Length=432

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (65%), Gaps = 1/137 (1%)
 Frame = -2

Query  554  ELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSD  375
            E K +F+ L +  K  L  D V++V +  R+ D+PCV+VT +YG SANMERIM++Q L D
Sbjct  266  ETKAAFEPLCRLMKDVL-GDRVEKVVVGERIVDSPCVLVTGEYGWSANMERIMKAQALRD  324

Query  374  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDP  195
            +S   YM  K+ LEIN  +P+I ELR R   D  D++ ++  QL ++TAL+ SGF++ DP
Sbjct  325  SSMAGYMSSKKTLEINAANPVIAELRTRAEADKGDKTVRDLVQLLFETALLASGFSLDDP  384

Query  194  KDFASXXYXSVKSSLNI  144
              FAS  +  VK  L+I
Sbjct  385  NTFASRIHRMVKLGLSI  401



>gb|AEG19531.1| heat shock protein 90 [Glaciozyma antarctica]
Length=707

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DLT+  K  L  D V++V IS R+AD+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  546  FEDLTRTMKDIL-GDKVEKVSISNRIADSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  604

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM+ K+ LEINP + IIKELR +V +D  D++ K    L Y+TAL+ SGF +  P DFA+
Sbjct  605  YMQSKKTLEINPHNAIIKELRRKVQEDAADKTVKSLIVLLYETALLTSGFTLDAPVDFAN  664

Query  179  XXYXSVKSSLNI  144
              +  +   L+I
Sbjct  665  RIHNMISLGLSI  676



>ref|XP_308800.3| AGAP006958-PA [Anopheles gambiae str. PEST]
 sp|Q7PT10.3|HSP83_ANOGA RecName: Full=Heat shock protein 83 [Anopheles gambiae]
 gb|EAA04712.4| AGAP006958-PA [Anopheles gambiae str. PEST]
Length=720

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L S  V++V +S RL D+PC +VTS+YG SANMERIM++Q L 
Sbjct  542  EEDKAKFENLCKVMKSVLES-KVEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQALR  600

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L ++TAL+ SGF++ +
Sbjct  601  DSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDE  660

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P   AS  Y  +K  L I  D
Sbjct  661  PGTHASRIYRMIKLGLGIDED  681



>gb|ACO58580.1| heat shock protein 90 [Apis mellifera]
Length=362

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL D+PC +VTS+YG +ANMERIM++Q L DAS   
Sbjct  198  FENLCKVMKDILDK-KVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  256

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HPI++ LR++   D  D+S K+   L ++TAL+ SGF + DP+  AS
Sbjct  257  YMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLSSGFALEDPQVHAS  316

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L    D
Sbjct  317  RIYRMIKLGLGFDDD  331



>ref|XP_005843734.1| hypothetical protein CHLNCDRAFT_140066 [Chlorella variabilis]
 gb|EFN51632.1| hypothetical protein CHLNCDRAFT_140066 [Chlorella variabilis]
Length=574

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 83/125 (66%), Gaps = 3/125 (2%)
 Frame = -2

Query  545  ESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASK  366
            E  K LT + K  L  D V++V ++ RL D+P VVV SK+G SANMERIM+SQ + DA  
Sbjct  406  EELKGLTAYMKKVL-GDKVEKVAVTSRLTDSPAVVVASKFGWSANMERIMRSQAMGDARS  464

Query  365  QAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDF  186
              YMRG+R++E+NP+HPII+ L+ +V  + E    KE  QL Y+ AL+  GF +  PKDF
Sbjct  465  AEYMRGRRIMELNPQHPIIRTLKSKV--ELESREAKEQVQLLYEAALLAGGFMIESPKDF  522

Query  185  ASXXY  171
            A+  Y
Sbjct  523  AARIY  527



>ref|XP_001740319.1| heat shock protein [Entamoeba dispar SAW760]
 gb|EDR23250.1| heat shock protein, putative [Entamoeba dispar SAW760]
Length=207

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  536  KDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQAY  357
            ++L+K  K  L  D +++V IS RL ++PC +VT +YG SANMERIM++Q L D S   Y
Sbjct  49   EELSKVVKEIL-GDKIEKVVISNRLVNSPCALVTGEYGWSANMERIMKAQALRDNSMSTY  107

Query  356  MRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFASX  177
            M  K+ LEINP HPI++ELR+RV  D  D++ K+   L ++TAL+ SGF++ +P  FA  
Sbjct  108  MVSKKTLEINPDHPIVQELRKRVHTDNSDKTVKDLVVLLFETALLSSGFSLDEPAAFAGR  167

Query  176  XYXSVKSSLNI  144
             Y  VK  L++
Sbjct  168  IYRMVKLGLSL  178



>emb|CAK22426.1| heat shock protein 83 [Beta vulgaris]
Length=350

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            SF++L K  K  L  D V++V +S R+ D+PC +VT +YG SANMERIM++Q L D+S  
Sbjct  191  SFENLCKVIKDVL-GDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMG  249

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            AYM  K+ +EINP + I++ELR+R   D  D+S K+   L ++TAL+ SGF++ DP  FA
Sbjct  250  AYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFA  309

Query  182  SXXYXSVKSSLNISPD  135
            +  +  +K  L+I  D
Sbjct  310  ARIHRMLKLGLSIEED  325



>ref|NP_999808.1| heat shock protein gp96 precursor [Strongylocentrotus purpuratus]
 gb|AAO21341.1| heat shock protein gp96 [Strongylocentrotus purpuratus]
Length=806

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 92/144 (64%), Gaps = 3/144 (2%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +EL+  F+ L KW K A   D + + K+S RL+D+PC +V S+YG S NMERIM++Q  +
Sbjct  611  EELEAKFEPLLKWLKDAALGDEIKDAKLSNRLSDSPCALVASQYGWSGNMERIMKAQAYA  670

Query  377  DASK---QAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFN  207
             A+    + Y   K+ LE+NPRHP+IK L E+V  D EDE+ K+ A + ++TA + SGF 
Sbjct  671  QANNPNTEYYASQKKTLEVNPRHPLIKTLLEKVEADAEDETAKDLAVVMFETATLRSGFA  730

Query  206  VPDPKDFASXXYXSVKSSLNISPD  135
            +PD   FA      +K S+N+ P+
Sbjct  731  LPDSAAFAGRIERMLKISMNLDPN  754



>gb|AAB05638.1| heat shock protein 82 [Anopheles albimanus]
 gb|AAB05639.1| heat shock protein 82 [Anopheles albimanus]
Length=721

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L S  V++V +S RL D+PC +VTS+YG SANMERIM++Q L 
Sbjct  544  EEDKAKFENLCKVMKSVLES-KVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALR  602

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L ++TAL+ SGF++ +
Sbjct  603  DSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDE  662

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P   A+  Y  VK  L I  D
Sbjct  663  PGTHAARIYRMVKLGLGIDDD  683



>emb|CDP96098.1| Protein BM-DAF-21, isoform a [Brugia malayi]
Length=717

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL  +PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L ++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L+I+ D
Sbjct  669  RIYRMIKLGLDITED  683



>gb|EJW88125.1| heat shock protein 90 [Wuchereria bancrofti]
Length=717

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL  +PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L ++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L+I+ D
Sbjct  669  RIYRMIKLGLDITED  683



>ref|XP_001901767.1| heat shock protein 90 [Brugia malayi]
Length=699

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL  +PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  532  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  590

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L ++TAL+ SGF++ DP+  AS
Sbjct  591  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  650

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L+I+ D
Sbjct  651  RIYRMIKLGLDITED  665



>sp|O61998.2|HSP90_BRUPA RecName: Full=Heat shock protein 90 [Brugia pahangi]
 emb|CAA06695.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL  +PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L ++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L+I+ D
Sbjct  669  RIYRMIKLGLDITED  683



>emb|CAA06694.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL  +PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L ++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L+I+ D
Sbjct  669  RIYRMIKLGLDITED  683



>gb|ETN67039.1| heat shock protein [Anopheles darlingi]
Length=721

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L S  V++V +S RL D+PC +VTS+YG SANMERIM++Q L 
Sbjct  544  EEDKAKFENLCKVMKSVLES-KVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALR  602

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L ++TAL+ SGF++ +
Sbjct  603  DSSAMGYMAGKKHLEINPDHAIIETLRQRADADKNDKAVKDLVILLFETALLSSGFSLDE  662

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P   A+  Y  VK  L I  D
Sbjct  663  PGTHAARIYRMVKLGLGIDDD  683



>gb|EMS22510.1| molecular chaperone HtpG [Rhodosporidium toruloides NP11]
 emb|CDR46785.1| RHTO0S13e01772g1_1 [Rhodosporidium toruloides]
Length=697

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DLT+  K  L  D V++V IS R+AD+PC++VT ++G SANMERIM++Q L DAS  +
Sbjct  535  FEDLTRTMKEVL-GDRVEKVTISNRIADSPCILVTGQFGWSANMERIMKAQALRDASMSS  593

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP + II+EL+ +V  D  D++ ++   L Y+TAL+ SGF + +P  FA 
Sbjct  594  YMMSKKTLEINPNNAIIRELKNKVQADSADKAVRDLVVLLYETALLTSGFTLDEPHHFAE  653

Query  179  XXYXSVKSSLNISPD  135
              +  +   L+I  D
Sbjct  654  RIHAMISLGLSIDAD  668



>gb|KFB48797.1| hypothetical protein ZHAS_00016808 [Anopheles sinensis]
Length=573

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L  + V++V +S RL D+PC +VTS+YG SANMERIM++Q L 
Sbjct  396  EEDKAKFENLCKVMKSVL-ENKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALR  454

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S   YM GK+ LEINP H I++ LR+R   D  D++ K+   L ++TAL+ SGF++ +
Sbjct  455  DSSAMGYMAGKKHLEINPDHAIVETLRQRADADKNDKAVKDLVILLFETALLSSGFSLDE  514

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P   AS  Y  +K  L I  D
Sbjct  515  PGTHASRIYRMIKLGLGIDED  535



>gb|KDQ60746.1| hypothetical protein JAAARDRAFT_172907 [Jaapia argillacea MUCL 
33604]
Length=703

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F DL    K AL  D V++V IS R+AD+PCV+VT ++G SANMERIM++Q L D+S  +
Sbjct  540  FNDLCSAVKEAL-GDKVEKVVISNRIADSPCVLVTGQFGWSANMERIMKAQALRDSSMSS  598

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP++P+IKEL+++V +D  D+S ++   L ++TAL+ SGF + DP  FA 
Sbjct  599  YMASKKTLELNPKNPVIKELKKKVAEDRADKSVRDLTFLLFETALLTSGFTLDDPTSFAK  658

Query  179  XXYXSVKSSLNISPD  135
              +  +   L++  D
Sbjct  659  RIHRMIALGLDVDED  673



>gb|ACO55133.1| heat shock protein 90 [Litomosoides sigmodontis]
Length=718

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL  +PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  551  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  609

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L ++TAL+ SGF++ DP+  AS
Sbjct  610  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLDDPQLHAS  669

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L+I+ D
Sbjct  670  RIYRMIKLGLDITED  684



>ref|XP_001649751.1| AAEL014845-PA [Aedes aegypti]
 gb|EAT32918.1| AAEL014845-PA [Aedes aegypti]
Length=560

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L  + V++V +S RL D+PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  394  FENLCKVMKSVL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMG  452

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM GK+ +EINP H II+ LR+R   D  D++ K+   L ++TAL+ SGF++ +P   AS
Sbjct  453  YMAGKKHMEINPDHSIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGVHAS  512

Query  179  XXYXSVKSSLNISPD  135
              Y  VK  L I  D
Sbjct  513  RIYRMVKLGLGIDED  527



>ref|XP_007863437.1| HSP90-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58188.1| HSP90-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=701

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F DL    K AL  D V++V +S R++D+PCV+VT ++G SANMERIM++Q L D+S  +
Sbjct  539  FNDLCSAVKEAL-GDKVEKVVVSNRISDSPCVLVTGQFGWSANMERIMKAQALRDSSMSS  597

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP++PIIKEL+ +V +D  D+S ++   L ++TAL+ SGF++ DP  FA 
Sbjct  598  YMASKKTLELNPKNPIIKELKNKVAQDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  657

Query  179  XXYXSVKSSLNISPD  135
              +  +   L++  D
Sbjct  658  RIHRMIALGLDVDED  672



>ref|XP_007385736.1| HSP90-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN07443.1| HSP90-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=697

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            SF DL    K AL  D V++V +S R+ D+PCV+VT ++G SANMERIM++Q L D+S  
Sbjct  536  SFADLCTAVKDAL-GDKVEKVVVSNRITDSPCVLVTGQFGWSANMERIMKAQALRDSSMS  594

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            +YM  K+ LE+NP +PIIKELR++V +D  D+S ++   L ++TAL+ SGF + DP  FA
Sbjct  595  SYMASKKTLELNPHNPIIKELRKKVSEDKADKSVRDLTYLLFETALLTSGFTLDDPTSFA  654

Query  182  SXXYXSVKSSLNI  144
               +  +   L++
Sbjct  655  KRIHRMISLGLDV  667



>gb|EXX78198.1| Hsp90 family chaperone HSC82 [Rhizophagus irregularis DAOM 197198w]
Length=359

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F DL K  K  L  D V++V +S R++++PCV+VT +YG +AN ERIM++Q L D+S  +
Sbjct  198  FDDLCKQIKEIL-GDKVEKVLVSNRISESPCVLVTGQYGWAANFERIMKAQALRDSSMAS  256

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+++EINP HPI+K L+ +V  D  D++ K+   L ++T+L++SGF + +P  FA 
Sbjct  257  YMASKKIMEINPNHPIVKSLKSKVEADKNDKTVKDLTWLLFETSLLQSGFTLEEPSSFAG  316

Query  179  XXYXSVKSSLNISPD  135
              +  +K  L+I  D
Sbjct  317  RIFKMIKLGLDIGGD  331



>gb|EJT49886.1| chaperone [Trichosporon asahii var. asahii CBS 2479]
 gb|EKC98967.1| chaperone [Trichosporon asahii var. asahii CBS 8904]
Length=691

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE KE F+DL K  K  L  D V++V +S R+ D+PCV+VT ++G S+NMERIM++Q L 
Sbjct  527  KEQKE-FEDLCKNIKETL-GDRVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALR  584

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  +YM  K+ LEINP+HPIIKEL+++  +D  D++ K+   L Y+T+L+ SGF + +
Sbjct  585  DSSMSSYMASKKTLEINPQHPIIKELKKKSDEDKGDKTVKDLTTLLYETSLLTSGFTLNN  644

Query  197  PKDFASXXYXSVKSSLNI  144
            P+DFAS     +   L+I
Sbjct  645  PQDFASRINRMISLGLSI  662



>ref|XP_002021279.1| GL24896 [Drosophila persimilis]
 gb|EDW40435.1| GL24896 [Drosophila persimilis]
Length=362

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F+ L K  K  L S  V++V +S RL D+PC +VTS++G SANMERIM++Q L 
Sbjct  192  EEDKAKFEGLCKLMKSILDS-KVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALR  250

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D +   YM GK+ LEINP HPI++ LR++   D  D++ K+   L ++T+L+ SGF++  
Sbjct  251  DTATMGYMAGKKQLEINPDHPIVEALRQKADADKNDKAVKDLVILLFETSLLSSGFSLDS  310

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  AS  Y  +K  L I  D
Sbjct  311  PQVHASRIYRMIKLGLGIDED  331



>gb|ADV03069.1| heat shock protein 90 [Amphidinium carterae]
Length=710

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E+K  F+ LTK  K  L  D V++V IS R+AD+PCV+ TS+YG SANMERIM++Q L 
Sbjct  541  EEMKAEFEPLTKLMKEVL-GDKVEKVLISSRMADSPCVLTTSEYGWSANMERIMKAQALR  599

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L + TAL+ SGFN+ +
Sbjct  600  DSSMTSYMVSKKTMEVNPKHSIMSELKKKASADKSDKTVKDLIWLLFDTALLTSGFNLDE  659

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA   +  +K  L+I
Sbjct  660  PTQFAGRIHRMIKLGLSI  677



>gb|AAQ63041.1| heat shock protein HSP 90 alpha, partial [Platichthys flesus]
Length=207

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L    V++V +S RL  +PC +VTS YG +ANMERIM++Q L 
Sbjct  36   EEKKSKFENLCKIMKDILEK-KVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALR  94

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LR++   D  D+S K+   L ++TAL+ SGF + D
Sbjct  95   DNSTMGYMAAKKHLEINPDHPIVETLRQKAEADKNDKSVKDLVILLFETALLSSGFTLDD  154

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  ++  Y  +K  L I  D
Sbjct  155  PQTHSNRIYRMIKLGLGIDED  175



>gb|ACF95812.1| heat shock protein 90 [Amphidinium carterae]
Length=682

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E+K  F+ LTK  K  L  D V++V IS R+AD+PCV+ TS+YG SANMERIM++Q L 
Sbjct  513  EEMKAEFEPLTKLMKEVL-GDKVEKVLISSRMADSPCVLTTSEYGWSANMERIMKAQALR  571

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L + TAL+ SGFN+ +
Sbjct  572  DSSMTSYMVSKKTMEVNPKHSIMSELKKKASADKSDKTVKDLIWLLFDTALLTSGFNLDE  631

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA   +  +K  L+I
Sbjct  632  PTQFAGRIHRMIKLGLSI  649



>gb|ABA28987.1| heat shock protein 90 3 [Symbiodinium sp. C3]
Length=441

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -2

Query  554  ELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSD  375
            ELK  F+ LTK  K  L  D V++V +S R+AD+PCV+ TS+YG SANMERIM++Q L D
Sbjct  291  ELKAEFEPLTKLMKEVL-GDKVEKVLVSSRMADSPCVLTTSEYGWSANMERIMKAQALRD  349

Query  374  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDP  195
             S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L + T+L+ SGFN+ +P
Sbjct  350  NSMTSYMVSKKTMEVNPKHSIMVELKKKAAADKSDKTVKDLIWLLFDTSLLTSGFNLDEP  409

Query  194  KDFASXXYXSVKSSLNI  144
              FA   +  +K  L+I
Sbjct  410  TQFAGRIHRMIKLGLSI  426



>gb|EPT06188.1| hypothetical protein FOMPIDRAFT_1109676 [Fomitopsis pinicola 
FP-58527 SS1]
Length=702

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V +S R++D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  541  FEDLCKAVKDAL-GDKVEKVVVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  599

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +PI+KELR++V +D  D+S ++   L ++TAL+ SGF++ DP  FA 
Sbjct  600  YMASKKTLELNPHNPIVKELRKKVAEDKADKSVRDLTFLLFETALLTSGFSLDDPTSFAK  659

Query  179  XXYXSVKSSLNI  144
              +  +   L++
Sbjct  660  RIHRMISLGLDV  671



>dbj|BAF92789.1| cytosolic heat shock protein 90 alpha [Solea senegalensis]
Length=724

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  554  EELKNKFENLCKIMKDILDK-KIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQALR  612

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  613  DNSTMGYMTAKKHLEINPMHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLED  672

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  673  PQTHANRIYRMIKLGLGIDDD  693



>ref|XP_010736427.1| PREDICTED: heat shock protein HSP 90-alpha isoform X3 [Larimichthys 
crocea]
 ref|XP_010736428.1| PREDICTED: heat shock protein HSP 90-alpha isoform X4 [Larimichthys 
crocea]
Length=727

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  557  EELKNKFENLCKIMKDILDK-KIEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQALR  615

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  616  DNSTMGYMTAKKHLEINPMHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTLED  675

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  676  PQTHANRIYRMIKLGLGIDDD  696



>ref|XP_008297037.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Stegastes partitus]
Length=724

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 1/140 (1%)
 Frame = -2

Query  554  ELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSD  375
            ELK  F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L D
Sbjct  555  ELKNKFENLCKIMKDILDK-KIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQALRD  613

Query  374  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDP  195
             S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TAL+ SGF + DP
Sbjct  614  NSTMGYMTAKKHLEINPMHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLEDP  673

Query  194  KDFASXXYXSVKSSLNISPD  135
            +  A+  Y  +K  L I  D
Sbjct  674  QTHANRIYRMIKLGLGIDDD  693



>gb|EYD92886.1| hsp90 family protein, partial [Escherichia coli 1-176-05_S1_C1]
Length=294

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 94/143 (66%), Gaps = 6/143 (4%)
 Frame = -2

Query  554  ELKESFKDLTKWWK------GALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQ  393
            E KE+F+ L K ++        +  D VD+V  S R++D+PCV+VTS+YG SANMERIM+
Sbjct  123  EEKEAFEALQKEYEPLCQLIKEVLHDKVDKVITSQRISDSPCVLVTSEYGWSANMERIMK  182

Query  392  SQXLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESG  213
            +Q L D S  +YM  K+ +EINP +PI+ EL+ ++V D  D++ K+   L Y+T+L+ SG
Sbjct  183  AQALRDTSMTSYMMSKKTMEINPYNPIMTELKNKIVNDKSDKTVKDLIWLLYETSLLTSG  242

Query  212  FNVPDPKDFASXXYXSVKSSLNI  144
            F++ DP  F+S     +K  L+I
Sbjct  243  FSLEDPTQFSSRINRMIKLGLSI  265



>gb|KFB48798.1| heat shock protein 82 [Anopheles sinensis]
Length=717

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L  + V++V +S RL D+PC +VTS+YG SANMERIM++Q L 
Sbjct  540  EEDKAKFENLCKVIKTVL-ENKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALR  598

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L ++TAL+ SGF++ +
Sbjct  599  DSSAMGYMAGKKHLEINPDHAIIETLRQRADADKNDKAVKDLVILLFETALLSSGFSLDE  658

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P   AS  Y  +K  L I  D
Sbjct  659  PGTHASRIYRMIKLGLGIDED  679



>ref|XP_008551765.1| PREDICTED: heat shock protein 83 [Microplitis demolitor]
Length=723

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L S  V++V +S RL D+PC +VTS+YG +ANMERIM++Q L 
Sbjct  554  EEDKAKFEELCKVMKTILDS-KVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALR  612

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HP+I+ LR++   D  D+S K+   L ++TAL+ SGF++ D
Sbjct  613  DTSTMGYMAAKKHLEINPDHPVIENLRQKAEADKNDKSVKDLVVLLFETALLSSGFSLDD  672

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  673  PQVHAARIYRMIKLGLGIDED  693



>ref|XP_308797.3| AGAP006961-PA [Anopheles gambiae str. PEST]
 gb|EAA45456.3| AGAP006961-PA [Anopheles gambiae str. PEST]
Length=369

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = -2

Query  491  VDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQAYMRGKRVLEINPRHPI  312
            V++V +S RL D+PC +VTS+YG SANMERIM++Q L D+S   YM GK+ LEINP H I
Sbjct  212  VEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAI  271

Query  311  IKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFASXXYXSVKSSLNISPD  135
            I+ LR+R   D  D++ K+   L ++TAL+ SGF++ +P   AS  Y  +K  L I  D
Sbjct  272  IETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGIDED  330



>ref|XP_006793113.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X1 
[Neolamprologus brichardi]
 ref|XP_006793114.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X2 
[Neolamprologus brichardi]
Length=724

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F+DL K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  554  EELKTKFEDLCKIMKDILDK-KIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQALR  612

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  613  DNSTLGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLED  672

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  673  PQTHANRIYRMIKLGLGIDDD  693



>gb|EPY32689.1| heat shock protein 83-1 [Strigomonas culicis]
Length=272

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            SF+ L K  K  L  D V++V++S RLA +PC++VTS++G SA+ME+IM++Q L D+S  
Sbjct  108  SFEKLCKLIKDIL-GDKVEKVQLSERLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMA  166

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
             YM  K+ +E+NP H I+KEL+ RV  D  D++ K+   L + T+L+ SGFN+ DP  +A
Sbjct  167  TYMMSKKTMEVNPHHVIVKELKRRVDSDENDKAIKDLVFLLFDTSLLTSGFNLEDPTAYA  226

Query  182  SXXYXSVKSSLNISPD  135
               +  +K  L++  D
Sbjct  227  ERIHHMIKLGLSLDDD  242



>gb|AEH27540.1| cytosolic heat shock protein 90-alpha [Lates calcarifer]
Length=724

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  554  EELKNKFENLCKIMKDILDK-KIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQALR  612

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  613  DNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTLED  672

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  673  PQTHANRIYRMIKLGLGIDDD  693



>gb|EMD38391.1| hypothetical protein CERSUDRAFT_153213 [Ceriporiopsis subvermispora 
B]
Length=698

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V +S R+ D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKAVKEAL-GDKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +P++KEL+++V +D  D+S ++   L ++TAL+ SGF++ DP  FA 
Sbjct  597  YMASKKTLELNPHNPVVKELKKKVAEDSADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  656

Query  179  XXYXSVKSSLNISPD  135
              +  +   L++  D
Sbjct  657  RIHRMIALGLDVEED  671



>gb|ABI14419.1| heat shock protein 90 [Karlodinium veneficum]
Length=709

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F+ LTK  K  L  D V++V IS R+AD+PCV+ TS+YG SANMERIM++Q L 
Sbjct  540  EELKAEFEPLTKLMKEVL-GDKVEKVLISSRMADSPCVLTTSEYGWSANMERIMKAQALR  598

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L + T+L+ SGFN+ +
Sbjct  599  DNSMTSYMVSKKTMEVNPKHSIMTELKKKAAADKSDKTVKDLIWLLFDTSLLTSGFNLDE  658

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA   +  +K  L+I
Sbjct  659  PTQFAGRIHRMIKLGLSI  676



>emb|CDQ81678.1| unnamed protein product [Oncorhynchus mykiss]
Length=725

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +EL   F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  555  EELNSKFENLCKIMKDILDK-KIEKVSVSNRLVSSPCCIVTSTYGWTANMERIMKSQALR  613

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TALM SGF + D
Sbjct  614  DNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALMSSGFTLDD  673

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  674  PQTHANRIYRMIKLGLGIDDD  694



>emb|CDO69548.1| hypothetical protein BN946_scf184785.g53 [Trametes cinnabarina]
Length=698

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V +S R+ D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  536  FEDLCKAVKDAL-GDKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  594

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +PIIKEL+ +V +D  D+S ++   L ++TAL+ SGF++ DP  FA 
Sbjct  595  YMASKKTLELNPHNPIIKELKRKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  654

Query  179  XXYXSVKSSLNI  144
              +  +   L++
Sbjct  655  RIHRMIALGLDV  666



>gb|KIL68560.1| hypothetical protein M378DRAFT_184990 [Amanita muscaria Koide 
BX008]
Length=705

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            +F DL    K AL  D V++V IS R+AD+PCV+VT ++G S+NMERIM++Q L D S  
Sbjct  543  AFNDLCSVVKDAL-GDKVEKVVISNRIADSPCVLVTGQFGWSSNMERIMKAQALRDTSMS  601

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            +YM  K+ LE+NP +PI+KEL+++V +D  D+S ++   L Y TAL+ SGF + +P  FA
Sbjct  602  SYMASKKTLELNPHNPIVKELKKKVAEDKADKSVRDLTYLLYDTALLTSGFALDEPTSFA  661

Query  182  SXXYXSVKSSLNI  144
               Y  +   L++
Sbjct  662  KRIYRMISLGLDV  674



>ref|XP_005805662.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X1 
[Xiphophorus maculatus]
Length=724

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  554  EELKNKFENLCKIMKDILDK-KIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQALR  612

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  613  DNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTLED  672

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  673  PQTHANRIYRMIKLGLGIDDD  693



>gb|AGT57167.1| heat shock protein 90-alpha 3 [Salmo salar]
Length=727

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +EL   F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  557  EELNSKFENLCKIMKDILDK-KIEKVSVSNRLVSSPCCIVTSNYGWTANMERIMKSQALR  615

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TALM SGF + D
Sbjct  616  DNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALMSSGFTLDD  675

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  676  PQTHANRIYRMIKLGLGIDDD  696



>ref|XP_005805663.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X2 
[Xiphophorus maculatus]
Length=676

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  506  EELKNKFENLCKIMKDILDK-KIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQALR  564

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  565  DNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTLED  624

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  625  PQTHANRIYRMIKLGLGIDDD  645



>ref|XP_007577310.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Poecilia formosa]
Length=724

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  554  EELKNKFENLCKIMKDILDK-KIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQALR  612

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  613  DNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTLED  672

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  673  PQTHANRIYRMIKLGLGIDDD  693



>gb|AAG22091.1|AF306643_1 90 kDa heat-shock protein [Scyliorhinus torazame]
Length=138

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 83/135 (61%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            + DL K  K  L    V++V +S RL  +PC +VTS YG +ANMERIM++Q L D S   
Sbjct  5    YDDLCKLMKEILDK-KVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMG  63

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HPI+  LR++   D  D++ K+   L ++TAL+ SGF++ DP+  ++
Sbjct  64   YMMAKKHLEINPDHPIVDTLRQKADVDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSN  123

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L I  D
Sbjct  124  RIYRMIKLGLGIDDD  138



>gb|AGW82181.1| heat shcok protein 90, partial [Corbicula fluminea]
Length=190

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = -2

Query  554  ELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSD  375
            E K  F+ L K  K  L    V++V +S RL ++PC +VTS+YG SANMERIM++Q L D
Sbjct  53   EQKAEFEGLCKVMKEIL-DKKVEKVTVSNRLVNSPCCIVTSQYGWSANMERIMKAQALRD  111

Query  374  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDP  195
            +S   YM  K+ LEINP H IIK L+E+V  D  D+S K+   L ++TAL+ SGF + DP
Sbjct  112  SSTMGYMAAKKHLEINPDHSIIKALKEKVSVDKNDKSVKDLVLLMFETALLASGFALEDP  171

Query  194  KDFASXXYXSVKSSLNI  144
               A+     +K  L I
Sbjct  172  TTHANRINRMIKLGLGI  188



>ref|XP_001649752.1| AAEL014843-PA [Aedes aegypti]
 ref|XP_001655642.1| AAEL011704-PA [Aedes aegypti]
 gb|EAT32919.1| AAEL014843-PA [Aedes aegypti]
 gb|EAT36187.1| AAEL011704-PA [Aedes aegypti]
Length=715

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L  + V++V +S RL D+PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  549  FENLCKVMKSVL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMG  607

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM GK+ +EINP H II+ LR+R   D  D++ K+   L ++TAL+ SGF++ +P   AS
Sbjct  608  YMAGKKHMEINPDHSIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGVHAS  667

Query  179  XXYXSVKSSLNISPD  135
              Y  VK  L I  D
Sbjct  668  RIYRMVKLGLGIDED  682



>ref|XP_001655641.1| AAEL011708-PA [Aedes aegypti]
 gb|EAT36186.1| AAEL011708-PA [Aedes aegypti]
Length=715

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L  + V++V +S RL D+PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  549  FENLCKVMKSVL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMG  607

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM GK+ +EINP H II+ LR+R   D  D++ K+   L ++TAL+ SGF++ +P   AS
Sbjct  608  YMAGKKHMEINPDHSIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGVHAS  667

Query  179  XXYXSVKSSLNISPD  135
              Y  VK  L I  D
Sbjct  668  RIYRMVKLGLGIDED  682



>gb|KDP25390.1| hypothetical protein JCGZ_20546 [Jatropha curcas]
Length=706

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            SF++L K  K  L  D V++V +S R+ D+PC +VT +YG +ANMERIM++Q L D S  
Sbjct  545  SFENLCKTIKEVL-GDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNSMS  603

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            AYM  K+++EINP +PI+ ELR+R   D  D+S K+   L ++TAL+ SGF++ DP  FA
Sbjct  604  AYMSSKKIMEINPDNPIMDELRKRAEADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFA  663

Query  182  SXXYXSVKSSLNISPD  135
            +  +  +K  L I  D
Sbjct  664  ARIHRMLKLGLGIDED  679



>gb|KIP08934.1| hypothetical protein PHLGIDRAFT_103566 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=698

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V +S R++D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKAVKEAL-GDKVEKVVVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +PI++EL+ +V +D  D+S ++   L ++TAL+ SGF++ DP  FA 
Sbjct  597  YMASKKTLELNPHNPIVRELKSKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  656

Query  179  XXYXSVKSSLNISPD  135
              +  +   L++  D
Sbjct  657  RIHRMIALGLDVDED  671



>ref|XP_004974995.1| PREDICTED: heat shock protein 82-like [Setaria italica]
Length=709

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K+ F+DL K  K  L  D V++V +S R+ D+PC +VT +YG +ANMERIM++Q L 
Sbjct  544  EERKKQFEDLCKVIKEIL-GDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALR  602

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP + I++ELR+R   D  D+S K+   L ++TAL+ SGF++ D
Sbjct  603  DSSMSAYMASKKTMEINPDNGIMEELRKRAEADRNDKSVKDLVMLLFETALLTSGFSLDD  662

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA+  +  +K  LNI
Sbjct  663  PNTFAARIHRMLKLGLNI  680



>ref|XP_008045254.1| heat shock protein 90 [Trametes versicolor FP-101664 SS1]
 gb|EIW51690.1| heat shock protein 90 [Trametes versicolor FP-101664 SS1]
Length=700

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V +S R+ D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKAVKEAL-GDKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +P+IKEL+ +V +D  D+S ++   L ++TAL+ SGF++ DP  FA 
Sbjct  597  YMASKKTLELNPHNPVIKELKRKVSEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  656

Query  179  XXYXSVKSSLNISPD  135
              +  +   L++  D
Sbjct  657  RIHRMIALGLDVDED  671



>ref|XP_010788727.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Notothenia coriiceps]
Length=721

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 88/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F+++ K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  551  EELKNKFENICKIMKDILDK-KIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQALR  609

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L Y+T+L+ SGF + D
Sbjct  610  DNSTMGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDLVILLYETSLLSSGFTLED  669

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  670  PQTHANRIYRMIKLGLGIDDD  690



>gb|ACO57617.1| heat shock protein 90 [Pteromalus puparum]
Length=715

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L S  V++V +S RL D+PC +VTS+YG +ANMERIM++Q L DAS   
Sbjct  552  FENLCKVMKNILDS-KVEKVLVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  610

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HP+I  LRE+   D  D+S K+   L ++TAL+ SGF++ +P+  A+
Sbjct  611  YMAAKKHLEINPDHPVINTLREKAEADKNDKSVKDLVVLLFETALLSSGFSLDEPQVHAA  670

Query  179  XXYXSVKSSLNI  144
              Y  +K  L I
Sbjct  671  RIYRMIKLGLGI  682



>ref|NP_001278186.1| heat shock protein HSP 90-alpha 1-like [Astyanax mexicanus]
 gb|AAO52675.1| heat shock protein 90 alpha [Astyanax mexicanus]
Length=723

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 1/140 (1%)
 Frame = -2

Query  554  ELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSD  375
            ELK  F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L D
Sbjct  554  ELKTKFENLCKIMKDILDK-KIEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQALRD  612

Query  374  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDP  195
             S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TAL+ SGF + DP
Sbjct  613  NSTMGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLEDP  672

Query  194  KDFASXXYXSVKSSLNISPD  135
            +  A+  Y  +K  L I  D
Sbjct  673  QTHANRIYRMIKLGLGIDDD  692



>ref|XP_007361188.1| HSP90-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF65926.1| HSP90-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=703

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V +S R+ D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  542  FEDLCKAVKDAL-GDKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  600

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +PI+KEL+ +V +D  D+S ++   L ++TAL+ SGF++ DP  FA 
Sbjct  601  YMASKKTLELNPHNPIVKELKRKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  660

Query  179  XXYXSVKSSLNI  144
              +  +   L++
Sbjct  661  RIHRMIALGLDV  672



>ref|XP_002447413.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
 gb|EES11741.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
Length=716

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K+ F+DL K  K  L  D V++V +S R+ D+PC +VT +YG +ANMERIM++Q L 
Sbjct  551  EERKKQFEDLCKVIKDIL-GDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALR  609

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP + I++ELR+R   D  D+S K+   L ++TAL+ SGF++ D
Sbjct  610  DSSMSAYMSSKKTMEINPDNGIMEELRKRAEADRNDKSVKDLVLLLFETALLTSGFSLDD  669

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA+  +  +K  LNI
Sbjct  670  PNTFAARIHRMLKLGLNI  687



>gb|EKF32566.1| heat shock protein 85, putative, partial [Trypanosoma cruzi marinkellei]
Length=323

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            +++ L K  K  L  D V++V +S RLA +PC++VTS++G SA+ME+IM++Q L D+S  
Sbjct  161  AYERLCKAMKDVL-GDKVEKVVVSERLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMS  219

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            AYM  K+ +EINP HPI+KEL+ RV  D  D++ K+   L + TAL+ SGF + DP  +A
Sbjct  220  AYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLTSGFTLDDPTSYA  279

Query  182  SXXYXSVKSSLNI  144
               +  +K  L++
Sbjct  280  ERIHRMIKLGLSL  292


 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            +++ L K  K  L  D V++V +S RLA +PC++VTS++G SA+ME+IM++Q L D+S  
Sbjct  17   AYERLCKAMKDVL-GDKVEKVVVSERLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMS  75

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            AYM  K+ +EINP HPI+KEL+ RV  D  D++ K+   L + TAL+ SGF + DP  +A
Sbjct  76   AYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLTSGFTLDDPTSYA  135

Query  182  SXXYXSVK  159
               +  +K
Sbjct  136  ERIHRMIK  143



>emb|CBK20696.2| unnamed protein product [Blastocystis hominis]
Length=814

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 89/138 (64%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K  +E ++  TKW K  L  D VD+V+IS +L   P V+ TS+YG SA MERIM+SQ L 
Sbjct  610  KAYEEKYESFTKWLK-ELLGDKVDKVEISSKLESAPAVLSTSRYGYSATMERIMKSQALQ  668

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            +  +  Y++  +++EINPRHPII  L++   +DPE +  ++ A L Y +ALM SGF + +
Sbjct  669  NPERAKYLKSHKIMEINPRHPIISSLQKMADEDPESDVARDFANLLYDSALMNSGFMIEE  728

Query  197  PKDFASXXYXSVKSSLNI  144
            P +FA+  Y  +K SL +
Sbjct  729  PNEFATRLYSLMKESLQL  746



>ref|XP_001023330.1| Hsp90 protein [Tetrahymena thermophila]
 gb|EAS03085.1| heat shock protein HSP90 [Tetrahymena thermophila SB210]
Length=794

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 3/142 (2%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K +K++F+ LT WWK  L +D +DEV+IS RL D PCV+V+S++G SA MERI ++Q  +
Sbjct  610  KAVKKAFEPLTSWWKKLLTND-LDEVRISQRLHDDPCVIVSSEHGYSAQMERISKAQAYA  668

Query  377  DASK-QAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVP  201
            +  +       K++LEINP HP IKEL ERV +DP D  T+E A + Y+ AL+ SG+++ 
Sbjct  669  NQDRSNPAANQKKILEINPNHPAIKELLERVKEDP-DSQTEEIANVLYEGALVNSGYSLK  727

Query  200  DPKDFASXXYXSVKSSLNISPD  135
            DP  FA   Y  + ++L I  D
Sbjct  728  DPAGFAKKFYRLLNNALGIPKD  749



>emb|CBK22622.2| unnamed protein product [Blastocystis hominis]
Length=811

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 89/138 (64%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K  +E ++  TKW K  L  D VD+V+IS +L   P V+ TS+YG SA MERIM+SQ L 
Sbjct  607  KAYEEKYESFTKWLK-ELLGDKVDKVEISSKLESAPAVLSTSRYGYSATMERIMKSQALQ  665

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            +  +  Y++  +++EINPRHPII  L++   +DPE +  ++ A L Y +ALM SGF + +
Sbjct  666  NPERAKYLKSHKIMEINPRHPIISSLQKMADEDPESDVARDFANLLYDSALMNSGFMIEE  725

Query  197  PKDFASXXYXSVKSSLNI  144
            P +FA+  Y  +K SL +
Sbjct  726  PNEFATRLYSLMKESLQL  743



>emb|CBK24402.2| unnamed protein product [Blastocystis hominis]
Length=812

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 89/138 (64%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K  +E ++  TKW K  L  D VD+V+IS +L   P V+ TS+YG SA MERIM+SQ L 
Sbjct  608  KAYEEKYESFTKWLK-ELLGDKVDKVEISSKLESAPAVLSTSRYGYSATMERIMKSQALQ  666

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            +  +  Y++  +++EINPRHPII  L++   +DPE +  ++ A L Y +ALM SGF + +
Sbjct  667  NPERAKYLKSHKIMEINPRHPIISSLQKMADEDPESDVARDFANLLYDSALMNSGFMIEE  726

Query  197  PKDFASXXYXSVKSSLNI  144
            P +FA+  Y  +K SL +
Sbjct  727  PNEFATRLYSLMKESLQL  744



>emb|CAU15484.1| heat shock protein 90 [Meloidogyne artiellia]
Length=723

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+ L K  K  L    V +V IS RL  +PC +VT +YG +ANMERIM++Q L D+S   
Sbjct  557  FEKLCKVIKDILDK-KVQKVSISNRLVSSPCCIVTGEYGWTANMERIMKAQALRDSSTMG  615

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H IIK LRERV  D +D++ K+   L Y+TAL+ SGF++ DP+  AS
Sbjct  616  YMASKKNLEINPDHSIIKSLRERVDSDQDDKTAKDLVVLLYETALLTSGFSLEDPQQHAS  675

Query  179  XXYXSVKSSLNISPD  135
              Y  VK  L+I+ +
Sbjct  676  RIYRMVKLGLDITEE  690



>gb|ESA08764.1| hypothetical protein GLOINDRAFT_348967 [Rhizophagus irregularis 
DAOM 181602]
Length=706

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F DL K  K  L  D V++V +S R++++PCV+VT +YG SAN ERIM++Q L D+S  +
Sbjct  545  FDDLCKQIKEIL-GDKVEKVLVSNRISESPCVLVTGQYGWSANFERIMKAQALRDSSMAS  603

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+++EINP HPI+K L+ +V  D  D++ K+   L ++T+L++SGF + +P  FA 
Sbjct  604  YMASKKIMEINPNHPIVKSLKSKVEADKNDKTVKDLTWLLFETSLLQSGFTLEEPSSFAG  663

Query  179  XXYXSVKSSLNISPD  135
              +  +K  L+I  D
Sbjct  664  RIFKMIKLGLDIGGD  678



>gb|AAM02974.1|AF421541_1 Hsp90 [Crypthecodinium cohnii]
Length=711

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F+ LTK  K  L  D V++V +S R+AD+PCV+ TS+YG SANMERIM++Q + 
Sbjct  542  EELKAEFEPLTKLMKEVL-GDKVEKVLVSSRMADSPCVLTTSEYGWSANMERIMKAQAMR  600

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S  +YM  K+ +EINP+H I+ EL+++   D  D++ K+   L + T+L+ SGFN+ +
Sbjct  601  DNSMTSYMVSKKTMEINPKHSIMSELKKKAAADKSDKTVKDLIWLLFDTSLLTSGFNLDE  660

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA   +  +K  L+I
Sbjct  661  PTQFAGRIHRMIKLGLSI  678



>ref|XP_011345590.1| PREDICTED: heat shock protein 83 [Cerapachys biroi]
 gb|EZA50089.1| Heat shock protein HSP 90-alpha [Cerapachys biroi]
Length=722

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 89/141 (63%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L    V++V +S RL D+PC +VTS+YG +ANMERIM++Q L 
Sbjct  552  EEDKTKFENLCKVMKDILDK-KVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALR  610

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LR++V  D  D+S K+   L ++TAL+ SGF + D
Sbjct  611  DTSTMGYMAAKKHLEINPDHPIMENLRQKVEADKHDKSVKDLVMLLFETALLSSGFVLED  670

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  AS  Y  +K  L    D
Sbjct  671  PQVHASRIYRMIKLGLGFEDD  691



>gb|ADO30471.1| heat shock protein 90 [Bactrocera dorsalis]
Length=516

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 90/138 (65%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L  + V++V +S RL ++PC +VTS++G SANMERIM++Q L 
Sbjct  346  EEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQALR  404

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM GK+ LEINP HPII+ LR++   D  D++ K+   L ++TAL+ SGF++  
Sbjct  405  DTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDLCILLFETALLSSGFSLDS  464

Query  197  PKDFASXXYXSVKSSLNI  144
            P+  AS  Y  +K  L I
Sbjct  465  PQVHASRIYRMIKLGLGI  482



>ref|XP_010552350.1| PREDICTED: heat shock protein 90-2 [Tarenaya hassleriana]
Length=699

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 90/139 (65%), Gaps = 1/139 (1%)
 Frame = -2

Query  551  LKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDA  372
            LKE F+ L K  K  L  D V++V +S R+ D+PC +VT +YG +ANMERIM++Q L D+
Sbjct  535  LKEKFEGLCKVIKDVL-GDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDS  593

Query  371  SKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPK  192
            S   YM  K+ +EINP +PI+ ELR+R   D  D+S K+   L ++TAL+ SGF++ DP 
Sbjct  594  SMAGYMSSKKTMEINPENPIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPN  653

Query  191  DFASXXYXSVKSSLNISPD  135
             F +  +  +K  L+I  D
Sbjct  654  TFGNRIHRMLKLGLSIDED  672



>gb|ABV55506.1| heat shock protein 90 [Microplitis mediator]
Length=723

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L S  V++V +S RL D+PC +VTS++G +ANMERIM++Q L 
Sbjct  554  EEDKAKFEELCKVMKTILDS-KVEKVVVSNRLVDSPCCIVTSQFGWTANMERIMKAQALR  612

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HP+I+ LR++   D  D+S K+   L ++TAL+ SGF++ D
Sbjct  613  DTSTMGYMAAKKHLEINPDHPVIENLRQKAEADKNDKSVKDLVVLLFETALLSSGFSLDD  672

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  673  PQVHAARIYRMIKLGLGIDED  693



>ref|XP_005176932.1| PREDICTED: heat shock protein 83 [Musca domestica]
Length=716

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L  + VD+V +S RL ++PC +VTS++G SANMERIM++Q L D S   
Sbjct  552  FENLCKIMKSIL-DNKVDKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQALRDTSTMG  610

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM GK+ LEINP HPII+ LR++   D  D++ K+   L ++T+L+ SGF++  P+  AS
Sbjct  611  YMAGKKHLEINPDHPIIETLRQKAEADKNDKAVKDLVILLFETSLLSSGFSLQSPQTHAS  670

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L I  D
Sbjct  671  RIYRMIKLGLGIDED  685



>gb|KIP09595.1| hypothetical protein PHLGIDRAFT_126182 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=697

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V +S R++D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  537  FEDLCKAVKEAL-GDKVEKVIVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  595

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +PI+KEL+ +V +D  D+S ++   L ++TAL+ SGF++ DP  FA 
Sbjct  596  YMASKKTLELNPHNPIVKELKSKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  655

Query  179  XXYXSVKSSLNI  144
              +  +   L++
Sbjct  656  RIHRMIALGLDV  667



>gb|ADM83426.1| heat shock protein 90 [Panonychus citri]
Length=730

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 87/135 (64%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+ L K  K  L    V++V IS RL  +PC +VTS+YG SANMERIM++Q L D +   
Sbjct  564  FETLCKVMKDVLEK-RVEKVTISNRLVTSPCCIVTSQYGWSANMERIMKAQALRDTTTMG  622

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HPI++ LR+R+  D  D++ K+   L ++TAL+ SGF++ DP++ +S
Sbjct  623  YMAAKKHLEINPDHPIVENLRQRIEADKSDKAVKDLVMLLFETALLCSGFSLEDPQNHSS  682

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L I  D
Sbjct  683  RIYRMIKLGLGIDED  697



>ref|XP_004023992.1| hypothetical protein IMG5_201300 [Ichthyophthirius multifiliis]
 gb|EGR27108.1| hypothetical protein IMG5_201300 [Ichthyophthirius multifiliis]
Length=816

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K +K+ FK LT WWK  L +D ++EV+IS RL D PCV+V+S++G SA MERI ++Q  +
Sbjct  629  KAIKKIFKPLTDWWKKLLTAD-LEEVRISQRLHDDPCVIVSSEHGYSAQMERISRAQAYA  687

Query  377  DASK---QAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFN  207
            ++ +   QA    K++LEINP HP IKEL ERV +DP D  T+E A++ Y+ A++ SG+N
Sbjct  688  NSDRSNPQA--NQKKILEINPNHPAIKELLERVKEDP-DNQTEELAKVLYEGAMVNSGYN  744

Query  206  VPDPKDFASXXYXSVKSSLNISPD  135
            + +P  FA   Y  + S+L I  D
Sbjct  745  LKEPIGFAQRFYRLLNSALGIPKD  768



>emb|CCA68353.1| related to HSP80 heat shock protein 80 [Piriformospora indica 
DSM 11827]
Length=702

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V IS R++D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  541  FEDLCKTVKDAL-GDKVEKVVISNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  599

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +PIIKEL+++V +D  D+S ++   L ++TAL+ SGF + +P  FA 
Sbjct  600  YMASKKTLELNPHNPIIKELKKKVAEDKADKSVRDLTYLLFETALLVSGFVLEEPTGFAK  659

Query  179  XXYXSVKSSLNISPD  135
              +  +   L++  D
Sbjct  660  RIHRMISLGLDVDED  674



>ref|XP_008311364.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Cynoglossus semilaevis]
Length=724

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK  F+DL K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  554  EELKNKFEDLCKIMKDILDK-KIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQALR  612

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LR +   D  D++ K+   L ++TAL+ SGF + D
Sbjct  613  DNSTMGYMTAKKHLEINPMHPIVETLRVKAEVDKNDKAVKDLVILLFETALLSSGFTLED  672

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  673  PQTHANRIYRMIKLGLGIDDD  693



>gb|EKG06682.1| heat shock protein 85, putative, partial [Trypanosoma cruzi]
Length=343

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            +++ L K  K  L  D V++V +S RLA +PC++VTS++G SA+ME+IM++Q L D+S  
Sbjct  181  AYERLCKAMKDVL-GDKVEKVVVSERLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMS  239

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            AYM  K+ +EINP HPI+KEL+ RV  D  D++ K+   L + TAL+ SGF + DP  +A
Sbjct  240  AYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLTSGFTLDDPTSYA  299

Query  182  SXXYXSVKSSLNI  144
               +  +K  L++
Sbjct  300  ERIHRMIKLGLSL  312



>ref|XP_003424204.1| PREDICTED: heat shock protein 83 [Nasonia vitripennis]
Length=723

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L  + V++V +S RL D+PC +VTS+YG +ANMERIM++Q L DAS   
Sbjct  560  FENLCKVMKNIL-DNKVEKVLVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  618

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HP+I  LRE+   D  D+S K+   L ++TAL+ SGF++ +P+  A+
Sbjct  619  YMAAKKHLEINPDHPVIDTLREKAEADKNDKSVKDLVVLLFETALLSSGFSLDEPQVHAA  678

Query  179  XXYXSVKSSLNI  144
              Y  VK  L I
Sbjct  679  RIYRMVKLGLGI  690



>ref|NP_001153536.1| heat shock protein 90 [Apis mellifera]
 gb|ACO58573.1| heat shock protein 90 [Apis mellifera]
Length=724

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL D+PC +VTS+YG +ANMERIM++Q L DAS   
Sbjct  560  FENLCKVMKDILDK-KVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  618

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HPI++ LR++   D  D+S K+   L ++TAL+ SGF + DP+  AS
Sbjct  619  YMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLSSGFALEDPQVHAS  678

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L    D
Sbjct  679  RIYRMIKLGLGFDDD  693



>ref|XP_003396897.1| PREDICTED: heat shock protein 83-like [Bombus terrestris]
 ref|XP_003486638.1| PREDICTED: heat shock protein 83-like [Bombus impatiens]
Length=725

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL D+PC +VTS+YG +ANMERIM++Q L DAS   
Sbjct  561  FENLCKVMKDILDK-KVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  619

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HPI++ LR++   D  D+S K+   L ++TAL+ SGF + DP+  AS
Sbjct  620  YMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLSSGFALEDPQVHAS  679

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L    D
Sbjct  680  RIYRMIKLGLGFDDD  694



>ref|XP_006619000.1| PREDICTED: heat shock protein HSP 90-alpha-like [Apis dorsata]
Length=724

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F++L K  K  L    V++V +S RL D+PC +VTS+YG +ANMERIM++Q L DAS   
Sbjct  560  FENLCKVMKDILDK-KVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  618

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP HPI++ LR++   D  D+S K+   L ++TAL+ SGF + DP+  AS
Sbjct  619  YMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLSSGFALEDPQVHAS  678

Query  179  XXYXSVKSSLNISPD  135
              Y  +K  L    D
Sbjct  679  RIYRMIKLGLGFDDD  693



>ref|XP_005911315.1| PREDICTED: heat shock protein HSP 90-alpha-like, partial [Bos 
mutus]
Length=164

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -2

Query  536  KDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQAY  357
            ++L K  K  L    V++V +S RL  +PC +VTS YG +ANMERIM++Q L D SK  Y
Sbjct  1    ENLCKIMKDILEK-KVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSKMGY  59

Query  356  MRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFASX  177
            M  K+ LEINP H II+ LR++   D  D+S K+   L Y TAL+ SGF++ DP+  A+ 
Sbjct  60   MAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYDTALLSSGFSLEDPQTHANR  119

Query  176  XYXSVKSSLNISPD  135
             Y  +K  L I  D
Sbjct  120  IYRMIKLGLGIDED  133



>gb|ACO55134.1| heat shock protein 90 [Ascaris suum]
Length=721

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            +++L K  K  L   NV++V +S RL  +PC +VTS+YG SANMERIM++Q L D+S   
Sbjct  554  YENLCKVIKDILEK-NVEKVVVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  612

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L ++TAL+ SGF++ DP+  AS
Sbjct  613  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLDDPQLHAS  672

Query  179  XXYXSVKSSLNI  144
              Y  +K  L+I
Sbjct  673  RIYRMIKLGLDI  684



>ref|XP_001433808.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK66411.1| unnamed protein product [Paramecium tetraurelia]
Length=785

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 95/142 (67%), Gaps = 5/142 (4%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K LK+ F+ LT WW+  L S+NVD V IS RL D P +VV+S+ G SANMERI ++Q  S
Sbjct  598  KALKKVFQPLTDWWR-KLLSENVDSVIISQRLIDDPIIVVSSESGYSANMERISKAQAYS  656

Query  377  D-ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVP  201
              A  Q +  GK+++EINP H  I+EL +RV  DP D+ T+E A++ Y+ AL+ SG+++P
Sbjct  657  SKAGSQQF--GKKIVEINPNHQAIQELLQRVKDDP-DQETEEMAKVLYEAALVNSGYSIP  713

Query  200  DPKDFASXXYXSVKSSLNISPD  135
            +P+ FAS  Y    S+L I  D
Sbjct  714  NPEKFASRFYKLFNSALGIDRD  735



>ref|XP_001439907.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72510.1| unnamed protein product [Paramecium tetraurelia]
Length=849

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 92/141 (65%), Gaps = 2/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K LK+ F+ LT WW+  L S+NVD V IS RL + P +VV+S+ G SANMERI ++Q  S
Sbjct  661  KALKKVFQPLTDWWR-KLLSENVDSVVISQRLIEDPIIVVSSESGYSANMERISKAQAYS  719

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
                 +   GK+++EINP H  I+EL +RV  DP D+ T+E A++ Y+ AL+ SG+++P 
Sbjct  720  SKGSNSQQFGKKIVEINPNHQAIQELLQRVKDDP-DQETEEMAKVLYEAALVNSGYSIPS  778

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+ FAS  Y    S+L I  D
Sbjct  779  PEKFASRFYKLFNSALGIDRD  799



>ref|XP_010671625.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=703

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = -2

Query  542  SFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQ  363
            SF++L K  K  L  D V++V +S R+ D+PC +VT +YG SANMERIM++Q L D+S  
Sbjct  544  SFENLCKVIKDVL-GDKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMG  602

Query  362  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFA  183
            AYM  K+ +EINP + I++ELR+R   D  D+S K+   L ++TAL+ SGF++ DP  FA
Sbjct  603  AYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFA  662

Query  182  SXXYXSVKSSLNISPD  135
            +  +  +K  L+I  D
Sbjct  663  ARIHRMLKLGLSIEED  678



>gb|ETK95017.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETL48421.1| heat shock protein 90-2 [Phytophthora parasitica]
Length=706

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K + + L K  K  L  D V++V+IS R+ ++PCV+VT +YG SANMERIM++Q L 
Sbjct  539  EEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGEYGWSANMERIMKAQALR  597

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+   L Y T+L+ SGF++ +
Sbjct  598  DSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLIWLLYDTSLLTSGFSLDE  657

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA+  +  +K  L+I
Sbjct  658  PTTFANRIHRLIKLGLSI  675



>ref|XP_008915791.1| heat shock protein 90-2 [Phytophthora parasitica INRA-310]
 gb|ETI55191.1| heat shock protein 90-2 [Phytophthora parasitica P1569]
 gb|ETM01491.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETM54696.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETM98910.1| heat shock protein 90-2 [Phytophthora parasitica INRA-310]
 gb|ETO83922.1| heat shock protein 90-2 [Phytophthora parasitica P1976]
 gb|ETP24998.1| heat shock protein 90-2 [Phytophthora parasitica CJ01A1]
 gb|ETP52997.1| heat shock protein 90-2 [Phytophthora parasitica P10297]
Length=706

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K + + L K  K  L  D V++V+IS R+ ++PCV+VT +YG SANMERIM++Q L 
Sbjct  539  EEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGEYGWSANMERIMKAQALR  597

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+   L Y T+L+ SGF++ +
Sbjct  598  DSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLIWLLYDTSLLTSGFSLDE  657

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA+  +  +K  L+I
Sbjct  658  PTTFANRIHRLIKLGLSI  675



>emb|CAY56585.1| putative heat shock protein 83 [Bactrocera oleae]
Length=666

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L  + V++V +S RL ++PC +VTS++G SANMERIM++Q L 
Sbjct  504  EEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQALR  562

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM GK+ LEINP HPII+ LR++   D +D++ K+   L ++TAL+ SGF++  
Sbjct  563  DTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKDDKAVKDLCILLFETALLSSGFSLDS  622

Query  197  PKDFASXXYXSVKSSLNI  144
            P+  AS  Y  +K  L I
Sbjct  623  PQVHASRIYRMIKLGLGI  640



>gb|AER28025.1| heat shock protein 83S2 [Stratiomys singularior]
Length=719

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F+ L K  K  L  + V++V +S RL D+PC +VTS+YG SANMERIM++Q L 
Sbjct  548  EEDKAKFEGLCKVMKSIL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALR  606

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S   YM  K+ LEINP HPII+ LR++   D  D+S K+   L ++T+L+ SGF++ D
Sbjct  607  DSSTMGYMTSKKHLEINPDHPIIENLRQKTEADKNDKSVKDLVILLFETSLLSSGFSLDD  666

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  AS  +  +K  L I  D
Sbjct  667  PQVHASRIHRMIKLGLGIDDD  687



>gb|EAY92778.1| hypothetical protein OsI_14582 [Oryza sativa Indica Group]
Length=703

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE K SF+ L K  K  L  D V++V +S R+ D+PC +VT +YG +ANMERIM++Q L 
Sbjct  536  KERKRSFEPLCKVIKDIL-GDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALR  594

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP + I++ELR+R   D  D+S ++   L ++TAL+ SGF++ D
Sbjct  595  DSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLFETALLTSGFSLDD  654

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA+  +  +K  LNI
Sbjct  655  PNTFAARIHRMLKLGLNI  672



>ref|XP_001458509.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK91112.1| unnamed protein product [Paramecium tetraurelia]
Length=842

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 92/141 (65%), Gaps = 2/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K LK+ F+ LT WW+  L S+NVD V IS RL + P +VV+S+ G SANMERI ++Q  S
Sbjct  654  KALKKVFQPLTDWWR-KLLSENVDSVVISQRLIEDPIIVVSSESGYSANMERISKAQAYS  712

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
                 +   GK+++EINP H  I+EL +RV  DP D+ T+E A++ Y+ AL+ SG+++P 
Sbjct  713  SKGSNSQQFGKKIVEINPNHQAIQELLQRVKDDP-DQETEEMAKVLYEAALVNSGYSIPS  771

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+ FAS  Y    S+L I  D
Sbjct  772  PEKFASRFYKLFNSALGIDRD  792



>gb|EJU00792.1| heat shock protein 90 [Dacryopinax sp. DJM-731 SS1]
Length=695

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F DL K  K AL  D V++V +S R+ D+PCV+VT ++G S+NMERIM++Q L DAS  +
Sbjct  534  FDDLCKSIKEAL-GDKVEKVVVSNRIVDSPCVLVTGQFGWSSNMERIMKAQALRDASMSS  592

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +PIIKEL+ +V  D  D++ ++   L Y+TAL+ SGF + +P  FA 
Sbjct  593  YMASKKTLELNPHNPIIKELKTKVAADKNDKTVRDLTYLLYETALLTSGFVLDEPSSFAK  652

Query  179  XXYXSVKSSLNISPD  135
              +  +   L++  D
Sbjct  653  RIHRMISLGLDVDED  667



>ref|XP_002998541.1| heat shock protein 90 [Phytophthora infestans T30-4]
 gb|EEY69894.1| heat shock protein 90 [Phytophthora infestans T30-4]
Length=706

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K + + L K  K  L  D V++V+IS R+ ++PCV+VT +YG SANMERIM++Q L 
Sbjct  539  EEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGEYGWSANMERIMKAQALR  597

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+   L Y T+L+ SGF++ +
Sbjct  598  DSSTSAYMSSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLIWLLYDTSLLTSGFSLDE  657

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA+  +  +K  L+I
Sbjct  658  PTTFANRIHRLIKLGLSI  675



>gb|AFD34191.2| HSP90 [Prorocentrum minimum]
Length=709

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E+K  F+ LTK  K  L  D V++V IS R+AD+PCV+ TS+YG SANMERIM++Q L 
Sbjct  540  EEMKAEFEPLTKLMKEVL-GDKVEKVVISSRMADSPCVLTTSEYGWSANMERIMKAQALR  598

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L + T+L+ SGFN+ +
Sbjct  599  DNSMTSYMVSKKTMEVNPKHSIMSELKKKASADKSDKTVKDLIWLLFDTSLLTSGFNLDE  658

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA   +  +K  L+I
Sbjct  659  PTQFAGRIHRMIKLGLSI  676



>emb|CDQ59969.1| unnamed protein product [Oncorhynchus mykiss]
Length=718

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +EL   F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  548  EELNTKFENLCKTMKDILDK-KIEKVSVSNRLVSSPCCIVTSTYGWTANMERIMKSQALR  606

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  607  DNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLDD  666

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  667  PQTHANRIYRMIKLGLGIDGD  687



>ref|XP_009534751.1| hypothetical protein PHYSODRAFT_355817 [Phytophthora sojae]
 gb|EGZ09890.1| hypothetical protein PHYSODRAFT_355817 [Phytophthora sojae]
Length=706

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K + + L K  K  L  D V++V+IS R+ ++PCV+VT +YG SANMERIM++Q L 
Sbjct  539  EEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGEYGWSANMERIMKAQALR  597

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+   L Y T+L+ SGF++ +
Sbjct  598  DSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLIWLLYDTSLLTSGFSLDE  657

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA+  +  +K  L+I
Sbjct  658  PTTFANRIHRLIKLGLSI  675



>ref|XP_002165028.1| PREDICTED: heat shock protein HSP 90-alpha 1-like [Hydra vulgaris]
Length=722

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +ELK SF++L K  K  L    V++V +S RL D+PC +VTS YG SANMERIM++Q L 
Sbjct  551  EELKASFEELCKVIKDILDK-RVEKVTVSNRLVDSPCCIVTSTYGWSANMERIMKAQALR  609

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP H I+  L+++V  D  D+S K+   L Y+T+L+ SGF++ D
Sbjct  610  DTSTMGYMAAKKHLEINPEHSIMVALKKKVDADKNDKSIKDLIVLLYETSLLSSGFSLED  669

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P++ A+  +  VK  L +  D
Sbjct  670  PQNHAARIHRMVKLGLGVDED  690



>emb|CAE02770.2| OSJNBb0085F13.17 [Oryza sativa Japonica Group]
 emb|CAD39419.2| OSJNBa0027H06.1 [Oryza sativa Japonica Group]
Length=703

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            KE K SF+ L K  K  L  D V++V +S R+ D+PC +VT +YG +ANMERIM++Q L 
Sbjct  536  KERKRSFEPLCKVIKDIL-GDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALR  594

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D+S  AYM  K+ +EINP + I++ELR+R   D  D+S ++   L ++TAL+ SGF++ D
Sbjct  595  DSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLFETALLTSGFSLDD  654

Query  197  PKDFASXXYXSVKSSLNI  144
            P  FA+  +  +K  LNI
Sbjct  655  PNTFAARIHRMLKLGLNI  672



>ref|XP_001432500.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK65103.1| unnamed protein product [Paramecium tetraurelia]
Length=790

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 95/142 (67%), Gaps = 5/142 (4%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            K LK+ F+ LT WW+  L S+NVD V IS RL D P +VV+S+ G SANMERI ++Q  S
Sbjct  603  KALKKVFQPLTDWWR-KLLSENVDSVIISQRLIDDPIIVVSSESGYSANMERISKAQAYS  661

Query  377  D-ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVP  201
              A  Q +  GK+++EINP H  I+EL +RV  DP D+ T+E A++ Y+ AL+ SG+++P
Sbjct  662  SKAGSQQF--GKKIVEINPNHQAIQELLQRVKDDP-DQETEEMAKVLYEAALVNSGYSIP  718

Query  200  DPKDFASXXYXSVKSSLNISPD  135
            +P+ FAS  Y    S+L I  D
Sbjct  719  NPEKFASRFYKLFNSALGIDRD  740



>ref|XP_009542788.1| hypothetical protein HETIRDRAFT_311260 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW85997.1| hypothetical protein HETIRDRAFT_311260 [Heterobasidion irregulare 
TC 32-1]
Length=701

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  + V++V +S R+ D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  540  FEDLCKVIKDAL-GEKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  598

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP HPIIKEL+ +V +D  D+S ++   L ++TAL+ SGF++ +P  FA 
Sbjct  599  YMASKKTLELNPTHPIIKELKRKVSEDKADKSVRDLTYLLFETALLTSGFSLEEPTSFAK  658

Query  179  XXYXSVKSSLNI  144
              +  +   L++
Sbjct  659  RIHRMISLGLDV  670



>gb|AAB49983.1| heat shock protein hsp90 [Oncorhynchus tshawytscha]
Length=726

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +EL   F++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L 
Sbjct  556  EELNTKFENLCKTMKDILDK-KIEKVSVSNRLVSSPCCIVTSTYGWTANMERIMKSQALR  614

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TAL+ SGF + D
Sbjct  615  DNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLDD  674

Query  197  PKDFASXXYXSVKSSLNISPD  135
            P+  A+  Y  +K  L I  D
Sbjct  675  PQTHANRIYRMIKLGLGIDGD  695



>gb|KIO34802.1| hypothetical protein M407DRAFT_90187 [Tulasnella calospora MUT 
4182]
Length=697

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  539  FKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSDASKQA  360
            F+DL K  K AL  D V++V +S R++D+PCV+VT ++G S+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKTIKDAL-GDKVEKVVVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  359  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDPKDFAS  180
            YM  K+ LE+NP +PI+KEL+++V +D  D+S ++   L ++TAL+ SGF + DP  FA 
Sbjct  597  YMASKKTLELNPHNPIVKELKKKVAEDKADKSVRDLTFLLFETALLTSGFVLDDPTSFAK  656

Query  179  XXYXSVKSSLNI  144
              +  +   L++
Sbjct  657  RIHRMISLGLDV  668



>gb|AAW49252.2| heat shock protein 90 [Liriomyza huidobrensis]
Length=714

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = -2

Query  557  KELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLS  378
            +E K  F++L K  K  L  + V++V +S RL D+PC +VTS+YG SANMERIM++Q L 
Sbjct  543  EEDKAKFENLCKLIKSIL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKTQALR  601

Query  377  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPD  198
            D++   YM GK+ LEINP HPII+ LRE+   D  D++ K+   L ++T+L+ SGF++  
Sbjct  602  DSNTMGYMSGKKHLEINPDHPIIETLREKSEADKNDKAVKDLVILLFETSLLSSGFSLDS  661

Query  197  PKDFASXXYXSVKSSLNI  144
            P+  AS  Y  +K  L I
Sbjct  662  PQVHASRIYRMIKLGLGI  679



>gb|AAH75757.1| Hsp90a.1 protein [Danio rerio]
Length=725

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (1%)
 Frame = -2

Query  554  ELKESFKDLTKWWKGALXSDNVDEVKISXRLADTPCVVVTSKYGXSANMERIMQSQXLSD  375
            ELK  +++L K  K  L    +++V +S RL  +PC +VTS YG +ANMERIM+SQ L D
Sbjct  556  ELKAKYENLCKIMKDILDK-KIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQALRD  614

Query  374  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLXYKTALMESGFNVPDP  195
             S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L ++TAL+ SGF + DP
Sbjct  615  NSTMGYMTAKKHLEINPAHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTLDDP  674

Query  194  KDFASXXYXSVKSSLNISPD  135
            +  A+  Y  +K  L I  D
Sbjct  675  QTHANRIYRMIKLGLGIDDD  694



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840