BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002I17

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU42831.1|  hypothetical protein MIMGU_mgv1a003489mg                284   3e-88   Erythranthe guttata [common monkey flower]
ref|XP_009612399.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    283   5e-88   Nicotiana tomentosiformis
ref|XP_009784852.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    282   1e-87   Nicotiana sylvestris
ref|XP_009612398.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    283   1e-87   Nicotiana tomentosiformis
ref|XP_009784851.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    281   2e-87   Nicotiana sylvestris
ref|XP_009784850.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    282   2e-87   Nicotiana sylvestris
gb|AJD25227.1|  cytochrome P450 CYP97B34                                278   6e-86   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006354415.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    278   7e-86   Solanum tuberosum [potatoes]
ref|XP_009347871.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     276   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_008342307.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     276   3e-85   
ref|XP_010321037.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    275   8e-85   Solanum lycopersicum
ref|XP_004239253.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    275   9e-85   Solanum lycopersicum
ref|XP_011100398.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     275   1e-84   Sesamum indicum [beniseed]
ref|XP_002520583.1|  cytochrome P450, putative                          274   1e-84   Ricinus communis
gb|KHG14945.1|  Cytochrome P450, chloroplastic                          274   2e-84   Gossypium arboreum [tree cotton]
ref|XP_004147731.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    274   2e-84   Cucumis sativus [cucumbers]
ref|XP_010093134.1|  Cytochrome P450                                    274   2e-84   Morus notabilis
ref|XP_002308766.1|  hypothetical protein POPTR_0006s00800g             274   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_007158591.1|  hypothetical protein PHAVU_002G165400g             273   3e-84   Phaseolus vulgaris [French bean]
ref|XP_004164429.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    273   8e-84   
ref|XP_007215027.1|  hypothetical protein PRUPE_ppa003405mg             272   1e-83   
gb|KDP42786.1|  hypothetical protein JCGZ_00485                         272   1e-83   Jatropha curcas
ref|XP_008451892.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    272   2e-83   
gb|KJB10650.1|  hypothetical protein B456_001G213800                    269   2e-83   Gossypium raimondii
ref|XP_010680161.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     271   2e-83   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH27406.1|  cytochrome P450 family 97 protein                       267   3e-83   Medicago truncatula
gb|KJB10648.1|  hypothetical protein B456_001G213800                    270   7e-83   Gossypium raimondii
ref|XP_011002376.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     270   9e-83   Populus euphratica
ref|XP_010044825.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     269   2e-82   Eucalyptus grandis [rose gum]
ref|XP_010313051.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    269   3e-82   
ref|XP_003610974.1|  Cytochrome P450                                    268   4e-82   Medicago truncatula
gb|KHN35086.1|  Cytochrome P450 97B2, chloroplastic                     267   8e-82   Glycine soja [wild soybean]
ref|NP_001235534.1|  cytochrome P450 97B2, chloroplastic                267   9e-82   
ref|XP_007049043.1|  Cytochrome P450 97B2 isoform 1                     268   1e-81   
ref|XP_002266883.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     266   1e-81   Vitis vinifera
gb|KDO64373.1|  hypothetical protein CISIN_1g014372mg                   261   5e-81   Citrus sinensis [apfelsine]
ref|XP_006429774.1|  hypothetical protein CICLE_v10011353mg             261   6e-81   
dbj|BAJ97821.1|  predicted protein                                      264   1e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010914244.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     264   2e-80   Elaeis guineensis
ref|XP_010260624.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    261   2e-80   
dbj|BAJ87287.1|  predicted protein                                      263   2e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007049044.1|  Cytochrome P450 97B2, chloroplastic isoform 2      264   2e-80   
gb|EMS51606.1|  Cytochrome P450 97B2, chloroplastic                     263   2e-80   Triticum urartu
dbj|BAG90081.1|  unnamed protein product                                258   4e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002451628.1|  hypothetical protein SORBIDRAFT_04g004850          262   5e-80   Sorghum bicolor [broomcorn]
ref|XP_010233882.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    258   6e-80   Brachypodium distachyon [annual false brome]
emb|CDP16026.1|  unnamed protein product                                263   7e-80   Coffea canephora [robusta coffee]
ref|XP_004951757.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    262   7e-80   Setaria italica
ref|XP_010440341.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     262   9e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006429775.1|  hypothetical protein CICLE_v10011353mg             261   2e-79   
ref|XP_010260623.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    261   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_006481375.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    261   3e-79   Citrus sinensis [apfelsine]
ref|XP_008809593.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     259   7e-79   Phoenix dactylifera
emb|CDY22733.1|  BnaA08g05630D                                          259   9e-79   Brassica napus [oilseed rape]
ref|XP_008679919.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     259   1e-78   Zea mays [maize]
ref|XP_006648355.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    258   2e-78   
ref|XP_010435019.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    259   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009107829.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     258   2e-78   Brassica rapa
emb|CDY09057.1|  BnaC08g10110D                                          258   2e-78   Brassica napus [oilseed rape]
ref|XP_003570274.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    258   2e-78   Brachypodium distachyon [annual false brome]
gb|KFK33561.1|  hypothetical protein AALP_AA5G029500                    258   3e-78   Arabis alpina [alpine rockcress]
gb|EAZ21913.1|  hypothetical protein OsJ_05566                          257   5e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006414564.1|  hypothetical protein EUTSA_v10024764mg             257   7e-78   Eutrema salsugineum [saltwater cress]
dbj|BAD26183.1|  putative cytochrome P450                               256   8e-78   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84668.1|  hypothetical protein OsI_06039                          256   8e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_010532498.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     256   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_006285060.1|  hypothetical protein CARUB_v10006369mg             256   2e-77   Capsella rubella
ref|XP_010495892.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    256   2e-77   Camelina sativa [gold-of-pleasure]
emb|CAB10290.1|  cytochrome P450 like protein                           256   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193247.2|  cytochrome P450 97B3                                  256   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412060.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    251   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002868224.1|  hypothetical protein ARALYDRAFT_493377             252   6e-76   
ref|XP_006854622.1|  hypothetical protein AMTR_s00030p00167800          248   6e-76   
ref|XP_009412059.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    251   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004303949.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     249   8e-75   Fragaria vesca subsp. vesca
ref|XP_008229650.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     248   1e-74   Prunus mume [ume]
gb|AAT28222.1|  putative 97B2-like cytochrome P450                      248   2e-74   Ginkgo biloba [ginkgo]
ref|XP_006841947.1|  hypothetical protein AMTR_s00042p00221280          245   3e-73   
ref|XP_001769554.1|  predicted protein                                  240   2e-71   
ref|XP_002976141.1|  hypothetical protein SELMODRAFT_175360             226   1e-66   
ref|XP_002968239.1|  hypothetical protein SELMODRAFT_145597             227   2e-66   
gb|EMT03024.1|  Cytochrome P450 97B2                                    224   3e-65   
gb|KHN25634.1|  Cytochrome P450 97B2, chloroplastic                     209   9e-62   Glycine soja [wild soybean]
sp|Q43078.1|C97B1_PEA  RecName: Full=Cytochrome P450 97B1, chloro...    200   1e-56   Pisum sativum [garden pea]
ref|XP_011399626.1|  Cytochrome P450 97B2, chloroplastic                173   1e-49   Auxenochlorella protothecoides
gb|AFR36909.1|  chloroplast CYP97B                                      173   1e-46   Haematococcus lacustris
gb|AGK38423.1|  CYP97B1                                                 173   3e-46   Parachlorella kessleri
emb|CBJ27249.1|  Cytochrome P450                                        172   6e-46   Ectocarpus siliculosus
gb|KIY95180.1|  hypothetical protein MNEG_12781                         159   7e-45   Monoraphidium neglectum
gb|AGK38421.1|  CYP97B1                                                 169   9e-45   Parachlorella kessleri
ref|XP_002955478.1|  hypothetical protein VOLCADRAFT_65884              168   2e-44   Volvox carteri f. nagariensis
emb|CDY09055.1|  BnaC08g10090D                                          156   5e-43   Brassica napus [oilseed rape]
ref|XP_002292287.1|  predicted protein                                  162   4e-42   Thalassiosira pseudonana CCMP1335
ref|XP_005845008.1|  hypothetical protein CHLNCDRAFT_138471             160   2e-41   Chlorella variabilis
emb|CBJ27248.1|  Cytochrome P450                                        160   4e-41   Ectocarpus siliculosus
gb|EJK63850.1|  hypothetical protein THAOC_15469                        159   4e-41   Thalassiosira oceanica
gb|EWM30289.1|  cytochrome p450                                         158   5e-41   Nannochloropsis gaditana
ref|XP_005650550.1|  cytochrome P450                                    156   2e-40   Coccomyxa subellipsoidea C-169
gb|AAL73435.1|AF459441_1  cytochrome P450                               156   4e-40   Skeletonema costatum
ref|XP_001421212.1|  predicted protein                                  154   1e-39   Ostreococcus lucimarinus CCE9901
emb|CEG01697.1|  Cytochrome P450, conserved site                        152   7e-39   Ostreococcus tauri
gb|ACF83994.1|  unknown                                                 139   4e-38   Zea mays [maize]
ref|XP_005827896.1|  cytochrome P450                                    149   5e-38   Guillardia theta CCMP2712
gb|AHA51695.1|  P450-type beta-carotene hydroxylase CYP97B29            147   3e-37   Porphyra umbilicalis
ref|XP_003074608.1|  cytochrome P450 (ISS)                              147   4e-37   Ostreococcus tauri
ref|XP_009032928.1|  hypothetical protein AURANDRAFT_19592              146   7e-37   Aureococcus anophagefferens
ref|XP_007509002.1|  predicted protein                                  146   9e-37   Bathycoccus prasinos
ref|XP_005715216.1|  cytochrome P450 family 97G-CYP97G1                 145   1e-36   Chondrus crispus [carageen]
ref|XP_002178724.1|  lutein deficient 1-like protein                    147   1e-36   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002185035.1|  lut1-1                                             145   2e-36   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002185034.1|  lutein deficient 1-like protein                    145   3e-36   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005830096.1|  cytochrome P450                                    144   3e-36   Guillardia theta CCMP2712
ref|XP_002506798.1|  predicted protein                                  144   3e-36   Micromonas commoda
ref|XP_001415984.1|  predicted protein                                  144   3e-36   Ostreococcus lucimarinus CCE9901
ref|XP_003061074.1|  predicted protein                                  144   5e-36   Micromonas pusilla CCMP1545
ref|XP_007514506.1|  predicted protein                                  142   1e-35   Bathycoccus prasinos
ref|XP_009034650.1|  hypothetical protein AURANDRAFT_21944              136   8e-35   Aureococcus anophagefferens
ref|XP_007145289.1|  hypothetical protein PHAVU_007G2265000g            132   1e-34   Phaseolus vulgaris [French bean]
emb|CDY61653.1|  BnaCnng38160D                                          135   1e-34   Brassica napus [oilseed rape]
ref|XP_002293604.1|  cytochrome P450                                    138   5e-34   Thalassiosira pseudonana CCMP1335
ref|XP_005648231.1|  CYP97C3                                            138   6e-34   Coccomyxa subellipsoidea C-169
ref|XP_006391881.1|  hypothetical protein EUTSA_v10023482mg             135   7e-34   
ref|XP_011397501.1|  Cytochrome P450 97B2, chloroplastic                137   8e-34   Auxenochlorella protothecoides
gb|AGK38422.1|  CYP97B2                                                 137   9e-34   Parachlorella kessleri
ref|XP_001700492.1|  cytochrome P450, carotenoid hydroxylase            137   2e-33   Chlamydomonas reinhardtii
dbj|BAD94136.1|  Cytochrom P450 -like protein                           133   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542540.1|  PREDICTED: carotene epsilon-monooxygenase, c...    135   3e-33   Glycine max [soybeans]
ref|XP_003537025.1|  PREDICTED: carotene epsilon-monooxygenase, c...    135   4e-33   Glycine max [soybeans]
gb|KFK34549.1|  hypothetical protein AALP_AA5G160700                    135   5e-33   Arabis alpina [alpine rockcress]
ref|XP_002876190.1|  hypothetical protein ARALYDRAFT_485688             135   5e-33   
ref|XP_006391882.1|  hypothetical protein EUTSA_v10023482mg             134   6e-33   
ref|XP_002958826.1|  hypothetical protein VOLCADRAFT_100143             136   6e-33   Volvox carteri f. nagariensis
gb|KHN36453.1|  Carotene epsilon-monooxygenase, chloroplastic           136   7e-33   Glycine soja [wild soybean]
ref|XP_005761340.1|  hypothetical protein EMIHUDRAFT_471046             129   8e-33   Emiliania huxleyi CCMP1516
ref|XP_004516959.1|  PREDICTED: carotene epsilon-monooxygenase, c...    134   1e-32   Cicer arietinum [garbanzo]
ref|XP_001420992.1|  predicted protein                                  132   3e-32   Ostreococcus lucimarinus CCE9901
ref|XP_010504071.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010426945.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_001422903.1|  predicted protein                                  132   3e-32   Ostreococcus lucimarinus CCE9901
ref|XP_003058421.1|  cytochrome P450 superfamily protein                134   4e-32   Micromonas pusilla CCMP1545
ref|XP_005826161.1|  cytochrome P450                                    133   4e-32   Guillardia theta CCMP2712
ref|XP_010515801.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003574294.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   5e-32   Brachypodium distachyon [annual false brome]
gb|AGN27239.1|  CYP97A1                                                 133   5e-32   Parachlorella kessleri
ref|XP_009125249.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   6e-32   Brassica rapa
gb|EJK46027.1|  hypothetical protein THAOC_35331                        131   7e-32   Thalassiosira oceanica
gb|ACO53105.1|  epsilon carotene hydroxylase                            127   7e-32   Actinidia chinensis
ref|NP_190881.2|  carotene epsilon-monooxygenase                        132   8e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13903.1|  putative cytochrome P450                                132   8e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDY13314.1|  BnaC06g14430D                                          131   9e-32   Brassica napus [oilseed rape]
emb|CDX67558.1|  BnaA07g15980D                                          131   1e-31   
emb|CDP15310.1|  unnamed protein product                                131   1e-31   Coffea canephora [robusta coffee]
gb|AID51468.1|  epsilon-ring carotene hydroxylase                       124   1e-31   Cucumis melo var. makuwa
emb|CAB64216.1|  Cytochrom P450-like protein                            131   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AFP65826.1|  carotene epsilon-ring hydroxylase                       126   2e-31   Eriobotrya japonica [loquat]
emb|CEG00185.1|  Cytochrome P450, conserved site                        130   2e-31   Ostreococcus tauri
gb|AGI61105.1|  carotenoid hydroxylase                                  131   2e-31   Parachlorella kessleri
ref|XP_002506759.1|  predicted protein                                  130   2e-31   Micromonas commoda
ref|XP_004983762.1|  PREDICTED: carotene epsilon-monooxygenase, c...    130   3e-31   Setaria italica
ref|XP_004983761.1|  PREDICTED: carotene epsilon-monooxygenase, c...    130   3e-31   Setaria italica
ref|XP_003082726.1|  probable cytochrome P450 (ISS)                     131   3e-31   
ref|XP_005779653.1|  hypothetical protein EMIHUDRAFT_463287             131   3e-31   Emiliania huxleyi CCMP1516
ref|XP_006403722.1|  hypothetical protein EUTSA_v10010267mg             130   4e-31   Eutrema salsugineum [saltwater cress]
ref|XP_006339098.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   6e-31   
gb|EMS57747.1|  Cytochrome P450 97B2, chloroplastic                     129   7e-31   Triticum urartu
ref|XP_003590442.1|  Cytochrome P450 monooxygenase CYP97C10             129   1e-30   
ref|XP_006662027.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   1e-30   Oryza brachyantha
ref|XP_010241652.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   1e-30   Nelumbo nucifera [Indian lotus]
dbj|BAJ87296.1|  predicted protein                                      128   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005849069.1|  hypothetical protein CHLNCDRAFT_51247              129   1e-30   Chlorella variabilis
ref|XP_002503315.1|  predicted protein                                  129   1e-30   Micromonas commoda
ref|XP_009623194.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   1e-30   
ref|NP_001065217.1|  Os10g0546600                                       128   2e-30   
ref|XP_008462512.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   2e-30   Cucumis melo [Oriental melon]
ref|XP_010241651.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008807069.1|  PREDICTED: LOW QUALITY PROTEIN: carotene eps...    127   2e-30   Phoenix dactylifera
ref|NP_001234058.1|  cytochrome P450-type monooxygenase 97C11           127   3e-30   
ref|XP_006339097.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   3e-30   Solanum tuberosum [potatoes]
ref|XP_011094564.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   3e-30   Sesamum indicum [beniseed]
ref|XP_006491796.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   3e-30   Citrus sinensis [apfelsine]
ref|XP_008658121.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   4e-30   Zea mays [maize]
gb|AIX87504.1|  P450 carotenoid epsilon-ring hydroxylase                127   4e-30   Lycium barbarum [Duke of Argyll's teatree]
gb|AIX87528.1|  P450 carotenoid epsilon-ring hydroxylase                127   5e-30   Lycium ruthenicum
ref|XP_006428525.1|  hypothetical protein CICLE_v10011420mg             127   5e-30   Citrus clementina [clementine]
ref|XP_010098846.1|  Carotene epsilon-monooxygenase                     127   6e-30   
gb|KDO54336.1|  hypothetical protein CISIN_1g008564mg                   126   7e-30   Citrus sinensis [apfelsine]
gb|ABQ59243.1|  CYP97C3                                                 126   8e-30   Chlamydomonas reinhardtii
ref|XP_009623193.1|  PREDICTED: carotene epsilon-monooxygenase, c...    126   8e-30   Nicotiana tomentosiformis
gb|AAK20054.1|AC025783_14  putative cytochrome P450 monooxygenase       126   9e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ACU20919.1|  unknown                                                 118   1e-29   Glycine max [soybeans]
gb|KDO54337.1|  hypothetical protein CISIN_1g008564mg                   125   1e-29   Citrus sinensis [apfelsine]
gb|KDO54334.1|  hypothetical protein CISIN_1g008564mg                   125   1e-29   Citrus sinensis [apfelsine]
gb|KDO54333.1|  hypothetical protein CISIN_1g008564mg                   125   1e-29   Citrus sinensis [apfelsine]
gb|KDO54335.1|  hypothetical protein CISIN_1g008564mg                   125   1e-29   Citrus sinensis [apfelsine]
gb|EEC67393.1|  hypothetical protein OsI_34547                          125   2e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_009382395.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382396.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382394.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG23674.1|  Cytochrome P450, chloroplastic                          125   2e-29   Gossypium arboreum [tree cotton]
ref|XP_009375781.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   2e-29   
ref|XP_002519427.1|  cytochrome P450, putative                          125   2e-29   
gb|KJB46498.1|  hypothetical protein B456_007G372200                    125   2e-29   Gossypium raimondii
ref|XP_009757367.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   2e-29   Nicotiana sylvestris
ref|XP_002467549.1|  hypothetical protein SORBIDRAFT_01g030050          125   2e-29   
ref|XP_007027524.1|  Cytochrome P450 superfamily protein isoform 2      123   3e-29   
ref|XP_008392557.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   3e-29   Malus domestica [apple tree]
ref|XP_010907646.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   4e-29   
ref|XP_004156328.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   4e-29   
ref|XP_010907645.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   4e-29   Elaeis guineensis
ref|XP_006833028.1|  hypothetical protein AMTR_s00094p00105890          115   4e-29   
ref|XP_010907643.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   4e-29   Elaeis guineensis
ref|XP_004143287.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   5e-29   Cucumis sativus [cucumbers]
gb|EYU41579.1|  hypothetical protein MIMGU_mgv1a004062mg                124   5e-29   Erythranthe guttata [common monkey flower]
ref|XP_010546517.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_011468004.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   7e-29   Fragaria vesca subsp. vesca
ref|XP_011396817.1|  Cytochrome P450 97B3, chloroplastic                123   8e-29   Auxenochlorella protothecoides
ref|XP_002955547.1|  hypothetical protein VOLCADRAFT_83281              123   9e-29   Volvox carteri f. nagariensis
ref|XP_008241353.1|  PREDICTED: carotene epsilon-monooxygenase, c...    123   1e-28   Prunus mume [ume]
ref|XP_004306170.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   1e-28   Fragaria vesca subsp. vesca
gb|AFQ31612.1|  CYP97C                                                  123   1e-28   Haematococcus lacustris
ref|XP_011018827.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   1e-28   Populus euphratica
ref|XP_007027523.1|  Cytochrome P450 superfamily protein isoform 1      122   1e-28   
ref|XP_006381359.1|  hypothetical protein POPTR_0006s12150g             122   2e-28   
ref|XP_011018826.1|  PREDICTED: carotene epsilon-monooxygenase, c...    122   2e-28   Populus euphratica
gb|AGT63110.1|  plastid carotenoid epsilon-ring hydroxylase             122   2e-28   Haematococcus lacustris
emb|CBI30186.3|  unnamed protein product                                121   3e-28   Vitis vinifera
ref|XP_003062894.1|  predicted protein                                  122   3e-28   Micromonas pusilla CCMP1545
ref|XP_007204192.1|  hypothetical protein PRUPE_ppa003701mg             122   3e-28   Prunus persica
gb|EPS64627.1|  hypothetical protein M569_10150                         122   4e-28   Genlisea aurea
gb|ADK60778.1|  putative mitochondrial cytochrome P450 monooxygenase    116   5e-28   Arachis diogoi
emb|CAN65775.1|  hypothetical protein VITISV_030413                     120   5e-28   Vitis vinifera
ref|XP_010683980.1|  PREDICTED: carotene epsilon-monooxygenase, c...    121   6e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004516958.1|  PREDICTED: carotene epsilon-monooxygenase, c...    120   6e-28   
ref|XP_002265015.1|  PREDICTED: carotene epsilon-monooxygenase, c...    120   7e-28   
gb|AJB84623.1|  carotene epsilon-monooxygenase                          120   8e-28   Camellia sinensis [black tea]
ref|XP_002992972.1|  hypothetical protein SELMODRAFT_187123             120   1e-27   Selaginella moellendorffii
ref|XP_002991812.1|  hypothetical protein SELMODRAFT_186370             120   1e-27   Selaginella moellendorffii
ref|XP_002971637.1|  hypothetical protein SELMODRAFT_231778             119   1e-27   
gb|KCW89308.1|  hypothetical protein EUGRSUZ_A01599                     120   1e-27   Eucalyptus grandis [rose gum]
ref|XP_010050328.1|  PREDICTED: carotene epsilon-monooxygenase, c...    120   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010674674.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    120   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006833025.1|  hypothetical protein AMTR_s00094p00091950          112   2e-27   
gb|AJD25226.1|  cytochrome P450 CYP97A41                                120   2e-27   Salvia miltiorrhiza [Chinese salvia]
gb|ABD97103.1|  cytochrome P450 monooxygenase CYP97C10                  118   2e-27   Glycine max [soybeans]
ref|XP_002965693.1|  hypothetical protein SELMODRAFT_407294             119   2e-27   
gb|KDP29211.1|  hypothetical protein JCGZ_16600                         119   3e-27   Jatropha curcas
gb|AJD25228.1|  cytochrome P450 CYP97C28                                119   3e-27   Salvia miltiorrhiza [Chinese salvia]
gb|ABB52076.1|  putative epsilon-ring carotene hydroxylase              119   3e-27   Daucus carota subsp. sativus
ref|XP_004170273.1|  PREDICTED: LOW QUALITY PROTEIN: protein LUTE...    119   5e-27   
ref|XP_004133753.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    119   5e-27   Cucumis sativus [cucumbers]
ref|XP_008450166.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    119   8e-27   Cucumis melo [Oriental melon]
ref|XP_003534527.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    118   1e-26   Glycine max [soybeans]
ref|XP_006428546.1|  hypothetical protein CICLE_v10011312mg             118   1e-26   Citrus clementina [clementine]
ref|NP_001234049.1|  cytochrome P450-type monooxygenase 97A29           117   1e-26   Solanum lycopersicum
ref|XP_006428547.1|  hypothetical protein CICLE_v10011312mg             117   1e-26   Citrus clementina [clementine]
gb|KHN29293.1|  Protein LUTEIN DEFICIENT 5, chloroplastic               118   2e-26   Glycine soja [wild soybean]
ref|XP_002512609.1|  cytochrome P450, putative                          117   2e-26   
ref|XP_003552430.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    117   2e-26   Glycine max [soybeans]
ref|XP_009108103.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    117   3e-26   Brassica rapa
emb|CDY12360.1|  BnaC08g08450D                                          117   3e-26   Brassica napus [oilseed rape]
ref|XP_006649172.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   3e-26   Oryza brachyantha
emb|CDY27131.1|  BnaA08g07690D                                          117   3e-26   Brassica napus [oilseed rape]
ref|XP_002890950.1|  hypothetical protein ARALYDRAFT_473366             117   3e-26   
ref|XP_008218412.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   4e-26   Prunus mume [ume]
ref|XP_007139751.1|  hypothetical protein PHAVU_008G056400g             117   4e-26   Phaseolus vulgaris [French bean]
ref|XP_004302135.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   5e-26   Fragaria vesca subsp. vesca
ref|NP_564384.1|  protein LUTEIN DEFICIENT 5                            116   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006340502.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   6e-26   Solanum tuberosum [potatoes]
gb|AAG50718.1|AC079041_11  cytochrome P450, putative                    116   6e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010070132.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   7e-26   Eucalyptus grandis [rose gum]
emb|CBI17673.3|  unnamed protein product                                116   7e-26   Vitis vinifera
ref|XP_006830626.1|  hypothetical protein AMTR_s00120p00092320          115   9e-26   
ref|XP_002279984.3|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   9e-26   Vitis vinifera
ref|XP_009802494.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   1e-25   Nicotiana sylvestris
gb|KDP23307.1|  hypothetical protein JCGZ_23140                         115   1e-25   Jatropha curcas
ref|XP_010245680.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_005652354.1|  cytochrome P450                                    113   1e-25   Coccomyxa subellipsoidea C-169
ref|XP_006415302.1|  hypothetical protein EUTSA_v10007138mg             115   1e-25   Eutrema salsugineum [saltwater cress]
ref|XP_007204988.1|  hypothetical protein PRUPE_ppa003455mg             115   1e-25   
ref|XP_010245679.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   1e-25   
ref|XP_010111039.1|  Protein LUTEIN DEFICIENT 5                         115   1e-25   
gb|ABC59110.1|  cytochrome P450 monooxygenase CYP97A10                  113   2e-25   
ref|XP_009627106.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   2e-25   
ref|XP_006829190.1|  hypothetical protein AMTR_s00001p00271310          114   2e-25   
ref|XP_001783943.1|  predicted protein                                  114   2e-25   
ref|XP_010540722.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   2e-25   
gb|EPS59936.1|  hypothetical protein M569_14868                         113   4e-25   
ref|XP_007029434.1|  Cytochrome P450, family 97, subfamily A, pol...    113   5e-25   
ref|XP_007029436.1|  Cytochrome P450, family 97, subfamily A, pol...    113   7e-25   
ref|XP_007029435.1|  Cytochrome P450 97B2 isoform 2                     113   7e-25   
gb|KJB82186.1|  hypothetical protein B456_013G180200                    113   7e-25   
ref|XP_006304811.1|  hypothetical protein CARUB_v10012441mg             113   7e-25   
gb|EMS64313.1|  Cytochrome P450 97B2, chloroplastic                     112   8e-25   
ref|XP_008646433.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    113   8e-25   
gb|KFK44941.1|  hypothetical protein AALP_AA1G322700                    112   1e-24   
gb|KJB82185.1|  hypothetical protein B456_013G180200                    112   1e-24   
gb|AIX87503.1|  P450 carotenoid beta-ring hydroxylase                   112   1e-24   
gb|KJB82184.1|  hypothetical protein B456_013G180200                    112   1e-24   
ref|XP_010499724.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   1e-24   
ref|XP_007513609.1|  predicted protein                                  112   1e-24   
ref|XP_003624118.1|  Cytochrome P450                                    112   1e-24   
ref|XP_004492816.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   1e-24   
gb|EMT31539.1|  Cytochrome P450 97B2                                    112   1e-24   
ref|XP_010461000.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   2e-24   
ref|XP_004954387.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   2e-24   
ref|XP_011077088.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   2e-24   
ref|NP_001048526.1|  Os02g0817900                                       112   2e-24   
ref|XP_010478597.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   2e-24   
gb|EEC74248.1|  hypothetical protein OsI_09455                          112   2e-24   
gb|EEE58048.1|  hypothetical protein OsJ_08883                          112   2e-24   
gb|AES80336.2|  cytochrome P450 family monooxygenase                    112   2e-24   
gb|EMS57431.1|  Cytochrome P450 97B2, chloroplastic                     110   2e-24   
gb|EYU39507.1|  hypothetical protein MIMGU_mgv1a003045mg                111   2e-24   
ref|XP_001698892.1|  cytochrome P450, carotenoid hydroxylase            112   2e-24   
ref|XP_009346816.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    111   2e-24   
ref|XP_010907644.1|  PREDICTED: carotene epsilon-monooxygenase, c...    111   2e-24   
ref|XP_001781608.1|  predicted protein                                  111   2e-24   
ref|XP_009346815.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    111   3e-24   
gb|AIX87527.1|  P450 carotenoid beta-ring hydroxylase                   111   3e-24   
ref|XP_008388781.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    111   4e-24   
gb|ABC59096.1|  cytochrome P450 monooxygenase CYP97C10                  110   4e-24   
ref|XP_008388780.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    110   5e-24   
emb|CDP04239.1|  unnamed protein product                                110   5e-24   
ref|XP_003570402.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    110   5e-24   
gb|AEQ20873.1|  epsilon-carotene hydroxylase                            102   5e-24   
ref|XP_009337974.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    110   6e-24   
ref|XP_009337972.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    110   6e-24   
ref|XP_008364063.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    110   8e-24   
ref|XP_010264030.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    110   1e-23   
ref|XP_008370918.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   1e-23   
gb|AFU10536.1|  chloroplast cytochrome P450 monooxygenase 97A3          109   1e-23   
ref|XP_009386597.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    109   1e-23   
ref|XP_011013175.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    109   2e-23   
ref|XP_008789534.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    107   5e-23   
ref|XP_002454784.1|  hypothetical protein SORBIDRAFT_04g037300          107   1e-22   
ref|XP_010940645.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    105   3e-22   
ref|XP_009341091.1|  PREDICTED: LOW QUALITY PROTEIN: carotene eps...    100   4e-21   
ref|WP_015803319.1|  cytochrome P450                                  99.0    2e-20   
emb|CEF99083.1|  Cytochrome P450, conserved site                      99.0    5e-20   
ref|XP_001419574.1|  predicted protein                                97.4    2e-19   
gb|EJK60667.1|  hypothetical protein THAOC_18940                      90.1    4e-19   
gb|KIZ06958.1|  hypothetical protein MNEG_0987                        89.7    2e-18   
gb|KJB82188.1|  hypothetical protein B456_013G180200                  94.7    2e-18   
ref|XP_010019089.1|  PREDICTED: cytochrome P450 4V2-like              90.1    3e-18   
ref|XP_007510564.1|  predicted protein                                93.2    5e-18   
ref|XP_009582591.1|  PREDICTED: cytochrome P450 4V2-like              89.0    6e-18   
gb|EYU39508.1|  hypothetical protein MIMGU_mgv1a003045mg              92.8    6e-18   
gb|EMC80620.1|  Cytochrome P450 4V2                                   90.5    7e-18   
ref|XP_009867596.1|  PREDICTED: cytochrome P450 4V2-like              88.6    8e-18   
ref|XP_001959879.1|  GF11817                                          92.0    9e-18   
ref|XP_003763211.1|  PREDICTED: cytochrome P450 3A5-like              90.1    9e-18   
dbj|BAJ91518.1|  predicted protein                                    92.0    1e-17   
ref|WP_035290705.1|  hypothetical protein                             90.1    1e-17   
ref|XP_011412813.1|  PREDICTED: cytochrome P450 4F22-like             91.7    1e-17   
ref|WP_009154628.1|  cytochrome P450                                  90.9    1e-17   
ref|WP_035868092.1|  cytochrome P450                                  90.9    1e-17   
ref|XP_010172881.1|  PREDICTED: cytochrome P450 4V2                   91.3    2e-17   
gb|KFZ48513.1|  Cytochrome P450 4V2                                   91.3    2e-17   
ref|WP_013020288.1|  cytochrome P450                                  90.5    2e-17   
ref|XP_003205823.1|  PREDICTED: cytochrome P450 4V2                   91.3    2e-17   
ref|NP_001001879.1|  cytochrome P450, family 4, subfamily V, poly...  91.3    2e-17   
ref|WP_037968823.1|  cytochrome P450                                  90.5    2e-17   
ref|WP_033201907.1|  cytochrome P450                                  90.5    2e-17   
gb|ABA27087.1|  TO103-3                                               84.7    2e-17   
ref|XP_009960179.1|  PREDICTED: cytochrome P450 4V2                   90.9    3e-17   
ref|XP_006263919.1|  PREDICTED: cytochrome P450 4B1-like              86.3    3e-17   
gb|KFP28925.1|  Cytochrome P450 4V2                                   90.9    3e-17   
ref|WP_026672938.1|  hypothetical protein                             90.1    3e-17   
ref|XP_010209107.1|  PREDICTED: cytochrome P450 4V2                   90.5    3e-17   
gb|EWC58123.1|  cytochrome P450                                       90.1    3e-17   
gb|KFQ05492.1|  Cytochrome P450 4V2                                   90.5    3e-17   
ref|XP_005500270.1|  PREDICTED: cytochrome P450 4V2-like isoform X2   90.1    3e-17   
ref|WP_043466649.1|  cytochrome P450                                  90.1    3e-17   
ref|NP_610473.1|  Cyp4p3                                              90.1    4e-17   
ref|WP_037979442.1|  cytochrome P450                                  89.7    4e-17   
dbj|BAP54527.1|  cytochrome P450                                      89.4    5e-17   
ref|XP_002506185.1|  predicted protein                                90.1    5e-17   
ref|WP_016546059.1|  cytochrome P450                                  89.4    6e-17   
ref|XP_009981146.1|  PREDICTED: cytochrome P450 4V2                   89.4    7e-17   
ref|WP_042816376.1|  cytochrome P450                                  89.0    7e-17   
ref|WP_015152944.1|  cytochrome P450                                  89.0    7e-17   
ref|XP_010190788.1|  PREDICTED: cytochrome P450 4V2                   89.4    7e-17   
ref|WP_006975851.1|  cytochrome P450 family protein                   89.0    7e-17   
ref|XP_005500269.1|  PREDICTED: cytochrome P450 4V2-like isoform X1   89.4    8e-17   
gb|KFQ40732.1|  Cytochrome P450 4V2                                   89.4    8e-17   
gb|KFV58947.1|  Cytochrome P450 4V2                                   89.4    8e-17   
ref|XP_003056711.1|  predicted protein                                89.4    9e-17   
ref|XP_009816577.1|  PREDICTED: cytochrome P450 4V2                   89.4    9e-17   
ref|XP_010290117.1|  PREDICTED: cytochrome P450 4V2                   89.4    9e-17   
gb|KFQ79651.1|  Cytochrome P450 4V2                                   89.4    9e-17   
gb|KFQ59985.1|  Cytochrome P450 4V2                                   87.0    1e-16   
ref|XP_009478507.1|  PREDICTED: cytochrome P450 4V2-like              87.0    1e-16   
ref|WP_018618424.1|  cytochrome P450                                  88.6    1e-16   
ref|WP_019943955.1|  cytochrome P450                                  88.6    1e-16   
ref|WP_005040564.1|  cytochrome P450                                  87.0    1e-16   
gb|EAU67465.1|  cytochrome P450 4A5                                   87.4    1e-16   
ref|WP_026308546.1|  cytochrome P450                                  88.2    1e-16   
ref|XP_006015961.1|  PREDICTED: cytochrome P450 4V2-like              88.2    1e-16   
ref|XP_010080484.1|  PREDICTED: thromboxane-A synthase-like           83.6    1e-16   
ref|XP_002138545.1|  GA24833                                          88.6    1e-16   
gb|KFV14223.1|  Thromboxane-A synthase                                83.6    2e-16   
ref|XP_002408834.1|  cytochrome P450, putative                        85.9    2e-16   
ref|XP_009328930.1|  PREDICTED: cytochrome P450 4V2                   88.6    2e-16   
gb|KFW71810.1|  Cytochrome P450 4V2                                   88.6    2e-16   
ref|WP_019989847.1|  cytochrome P450                                  88.2    2e-16   
ref|XP_009563950.1|  PREDICTED: cytochrome P450 4V2                   88.6    2e-16   
gb|KFR08758.1|  Cytochrome P450 4V2                                   88.2    2e-16   
gb|KFQ43026.1|  Thromboxane-A synthase                                84.0    2e-16   
ref|XP_009924714.1|  PREDICTED: cytochrome P450 4V2                   85.9    2e-16   
gb|KFO79690.1|  Cytochrome P450 4V2                                   88.2    2e-16   
ref|XP_006274266.1|  PREDICTED: cytochrome P450 4V2-like              88.2    2e-16   
ref|XP_009473113.1|  PREDICTED: cytochrome P450 4V2                   88.2    2e-16   
ref|WP_017949162.1|  cytochrome P450                                  87.8    2e-16   
gb|KFM06228.1|  Cytochrome P450 4V2                                   88.2    2e-16   
ref|XP_009275655.1|  PREDICTED: cytochrome P450 4V2                   88.2    2e-16   
ref|XP_010147968.1|  PREDICTED: cytochrome P450 4V2                   88.2    2e-16   
gb|KFV68658.1|  Cytochrome P450 4V2                                   88.2    2e-16   
ref|XP_009900520.1|  PREDICTED: cytochrome P450 4V2                   88.2    2e-16   
gb|KFV96946.1|  Cytochrome P450 4V2                                   87.8    2e-16   
ref|WP_037839946.1|  cytochrome P450                                  87.8    2e-16   
gb|KFO04478.1|  Cytochrome P450 4V2                                   87.8    2e-16   
ref|XP_008946210.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
ref|XP_010298276.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
ref|WP_013374206.1|  cytochrome P450                                  87.4    3e-16   
ref|XP_007498482.1|  PREDICTED: cytochrome P450 3A24-like isoform X2  87.0    3e-16   
ref|WP_031075083.1|  cytochrome P450                                  87.4    3e-16   
ref|XP_009962626.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
gb|KFV42202.1|  Cytochrome P450 4V2                                   87.8    3e-16   
ref|XP_005149111.1|  PREDICTED: cytochrome P450 4V2-like              87.8    3e-16   
ref|XP_010000770.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
gb|AFW58030.1|  putative cytochrome P450 superfamily protein          87.4    3e-16   
ref|WP_031168551.1|  cytochrome P450                                  87.0    3e-16   
ref|XP_009081963.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
ref|NP_001073465.1|  cytochrome P450, family 4, subfamily V, poly...  87.4    3e-16   
ref|WP_043653476.1|  cytochrome P450                                  87.0    3e-16   
ref|XP_008490073.1|  PREDICTED: cytochrome P450 4V2                   87.4    3e-16   
ref|WP_020161050.1|  MULTISPECIES: cytochrome P450                    87.0    3e-16   
gb|ACZ89696.1|  cytochrome P450 family protein                        87.4    3e-16   
gb|KFP18953.1|  Cytochrome P450 4V2                                   87.4    3e-16   
gb|AGT57865.1|  cytochrome P450 4aa1                                  84.0    3e-16   
ref|XP_009640714.1|  PREDICTED: cytochrome P450 4V2                   87.4    4e-16   
ref|XP_004452069.1|  PREDICTED: cytochrome P450 3A29-like isoform 1   87.4    4e-16   
ref|XP_008923000.1|  PREDICTED: cytochrome P450 4V2                   87.4    4e-16   
gb|KFW81676.1|  Cytochrome P450 4V2                                   87.4    4e-16   
ref|WP_033267262.1|  cytochrome P450                                  87.0    4e-16   
gb|EID75083.1|  cytochrome P450                                       86.7    4e-16   
ref|XP_005243199.1|  PREDICTED: cytochrome P450 4V2-like              87.0    5e-16   
ref|XP_009938493.1|  PREDICTED: cytochrome P450 4V2 isoform X2        87.0    5e-16   
ref|XP_009938492.1|  PREDICTED: cytochrome P450 4V2 isoform X1        87.0    5e-16   
ref|XP_010399874.1|  PREDICTED: cytochrome P450 4V2 isoform X4        87.0    5e-16   
dbj|BAH55628.1|  cytochrome P450                                      87.0    5e-16   
gb|KFQ21330.1|  Cytochrome P450 4V2                                   87.0    5e-16   
ref|WP_006078525.1|  cytochrome P450                                  85.1    5e-16   
gb|KFV82217.1|  Cytochrome P450 4V2                                   87.0    5e-16   
ref|XP_009675001.1|  PREDICTED: cytochrome P450 4V2                   87.0    5e-16   
ref|WP_002703072.1|  cytochrome P450 family protein                   86.7    5e-16   
ref|XP_003801475.1|  PREDICTED: cytochrome P450 4X1-like              87.0    5e-16   
ref|WP_039952671.1|  MULTISPECIES: cytochrome P450                    86.7    5e-16   
gb|KFA88208.1|  cytochrome P450                                       86.3    6e-16   
ref|XP_006015877.1|  PREDICTED: cytochrome P450 4A12A-like            85.9    6e-16   
ref|XP_002033066.1|  GM21113                                          86.7    6e-16   
ref|XP_005045213.1|  PREDICTED: cytochrome P450 4V2-like              86.7    6e-16   
gb|KFO65043.1|  Cytochrome P450 4V2                                   86.7    6e-16   
ref|XP_010399871.1|  PREDICTED: cytochrome P450 4V2 isoform X2        86.7    7e-16   
ref|XP_010399870.1|  PREDICTED: cytochrome P450 4V2 isoform X1        86.7    7e-16   
ref|WP_043194054.1|  cytochrome P450                                  86.3    7e-16   
ref|XP_010399873.1|  PREDICTED: cytochrome P450 4V2 isoform X3        86.7    7e-16   
ref|XP_008639675.1|  PREDICTED: cytochrome P450 4V2                   86.7    7e-16   
ref|WP_043409540.1|  cytochrome P450                                  86.3    7e-16   
ref|WP_031155589.1|  cytochrome P450                                  86.3    7e-16   
ref|WP_015163087.1|  cytochrome P450                                  85.9    8e-16   
ref|XP_002018192.1|  GL17580                                          86.3    8e-16   
ref|WP_030265702.1|  cytochrome P450                                  85.9    8e-16   
ref|XP_007498481.1|  PREDICTED: cytochrome P450 3A24-like isoform X1  86.3    9e-16   
ref|WP_018810455.1|  cytochrome P450                                  85.9    9e-16   
ref|WP_011727218.1|  cytochrome P450                                  85.9    9e-16   
ref|XP_005009034.1|  PREDICTED: cytochrome P450 4V2-like              86.3    9e-16   
ref|WP_018219304.1|  cytochrome P450                                  85.9    9e-16   
gb|ELQ91665.1|  cytochrome P450                                       85.9    1e-15   
ref|WP_028184984.1|  cytochrome P450                                  85.9    1e-15   
ref|WP_033096672.1|  cytochrome P450                                  85.9    1e-15   
ref|WP_036452601.1|  cytochrome P450                                  85.9    1e-15   
gb|KFO84157.1|  Cytochrome P450 4V2                                   86.3    1e-15   
ref|XP_002191071.1|  PREDICTED: cytochrome P450 4V2-like              85.9    1e-15   
ref|XP_010142523.1|  PREDICTED: cytochrome P450 4V2                   86.3    1e-15   
ref|WP_040006741.1|  cytochrome P450                                  85.5    1e-15   
emb|CCH55669.1|  cyc2                                                 85.5    1e-15   
ref|XP_005517737.1|  PREDICTED: cytochrome P450 4V2-like              85.9    1e-15   
ref|WP_024100881.1|  cytochrome P450                                  85.5    1e-15   
ref|WP_039587214.1|  cytochrome P450                                  85.5    1e-15   
ref|XP_010220976.1|  PREDICTED: cytochrome P450 4V2                   85.9    1e-15   
ref|WP_030027329.1|  cytochrome P450                                  85.5    1e-15   
gb|KGL73289.1|  Cytochrome P450 4V2                                   85.9    1e-15   
ref|XP_003507508.2|  PREDICTED: cytochrome P450 4V2 isoform X1        83.2    1e-15   
ref|WP_024755714.1|  cytochrome P450                                  85.5    1e-15   
ref|WP_035606804.1|  hypothetical protein                             85.5    1e-15   
ref|WP_030217492.1|  cytochrome P450                                  85.5    1e-15   
ref|XP_007891008.1|  PREDICTED: cytochrome P450 4V2                   85.9    1e-15   
ref|WP_036255934.1|  hypothetical protein                             85.1    1e-15   
ref|XP_001959878.1|  GF19784                                          85.5    1e-15   



>gb|EYU42831.1| hypothetical protein MIMGU_mgv1a003489mg [Erythranthe guttata]
Length=582

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPGGYNGDKDGY+IPAG+DIFISVYNLHRSPYFWD PN+FEPERFQV+K SE+EGWA
Sbjct  433  PDKLPGGYNGDKDGYSIPAGSDIFISVYNLHRSPYFWDNPNDFEPERFQVQKSSEVEGWA  492

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKFD++L+G+
Sbjct  493  GFDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFDVNLRGS  552

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            P+SV+LVTGATIHTKNGLWC+L+KR
Sbjct  553  PDSVELVTGATIHTKNGLWCQLRKR  577



>ref|XP_009612399.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V KES IEGWAG
Sbjct  400  DKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVPKESSIEGWAG  459

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++L+G+P
Sbjct  460  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELRGSP  519

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            ESV+LVTGATIHTK GLWCKLKKR
Sbjct  520  ESVELVTGATIHTKTGLWCKLKKR  543



>ref|XP_009784852.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=548

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPY WDKPNEFEPERF V KES IEGWAG
Sbjct  402  DKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLVPKESSIEGWAG  461

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++L+G+P
Sbjct  462  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELRGSP  521

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDV  293
            ESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  522  ESVELVTGATIHTKTGLWCKLKKRSNV  548



>ref|XP_009612398.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=582

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V KES IEGWAG
Sbjct  436  DKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVPKESSIEGWAG  495

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++L+G+P
Sbjct  496  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELRGSP  555

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            ESV+LVTGATIHTK GLWCKLKKR
Sbjct  556  ESVELVTGATIHTKTGLWCKLKKR  579



>ref|XP_009784851.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPY WDKPNEFEPERF V KES IEGWAG
Sbjct  428  DKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLVPKESSIEGWAG  487

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++L+G+P
Sbjct  488  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELRGSP  547

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDV  293
            ESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  548  ESVELVTGATIHTKTGLWCKLKKRSNV  574



>ref|XP_009784850.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=584

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPY WDKPNEFEPERF V KES IEGWAG
Sbjct  438  DKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLVPKESSIEGWAG  497

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++L+G+P
Sbjct  498  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELRGSP  557

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDV  293
            ESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  558  ESVELVTGATIHTKTGLWCKLKKRSNV  584



>gb|AJD25227.1| cytochrome P450 CYP97B34 [Salvia miltiorrhiza]
Length=582

 Score =   278 bits (711),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPGGYNGD+DGY+IPAGTD+FISVYNLHRSPYFWD PN+FEPERFQV+K S+++GWA
Sbjct  433  PDRLPGGYNGDEDGYSIPAGTDLFISVYNLHRSPYFWDNPNDFEPERFQVQKPSQVDGWA  492

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEII+DFAFLPFGGGPRKCVGDQFALMES +ALA LLQKFD++L+G+
Sbjct  493  GFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAALLQKFDVNLRGS  552

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
            PESV+LVTGATIHTK+G+WC+LKKRL
Sbjct  553  PESVELVTGATIHTKSGMWCQLKKRL  578



>ref|XP_006354415.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Solanum 
tuberosum]
Length=573

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 140/148 (95%), Gaps = 1/148 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D LPGGYNGDK+GY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V+KES+ IEGWA
Sbjct  426  DILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVQKESQGIEGWA  485

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++LKG+
Sbjct  486  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELKGS  545

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PE V+LVTGATIHTK GLWCKLKKR +V
Sbjct  546  PEDVELVTGATIHTKTGLWCKLKKRSNV  573



>ref|XP_009347871.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Pyrus x bretschneideri]
Length=577

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPGGYNG KDGYA+PAGTD+FISVYNLHRSPYFWD PNEFEPERF V K+S +EGWA
Sbjct  429  PDKLPGGYNGAKDGYAVPAGTDLFISVYNLHRSPYFWDNPNEFEPERFLVEKKSHVEGWA  488

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEII+DFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF ++LKG+
Sbjct  489  GFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFTVELKGS  548

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            P+SV+ VTGAT+HTKNGLWCKL+KR D+
Sbjct  549  PDSVEQVTGATLHTKNGLWCKLQKRSDI  576



>ref|XP_008342307.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Malus domestica]
Length=577

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPGGYNG KDGYA+PAGTD+FISVYNLHRSPYFWD PNEFEPERF V K+S +EGWA
Sbjct  429  PDKLPGGYNGAKDGYAVPAGTDLFISVYNLHRSPYFWDNPNEFEPERFLVEKKSHVEGWA  488

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEII+DFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF ++LKG+
Sbjct  489  GFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFTVELKGS  548

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            P+SV+ VTGAT+HTKNGLWCKL+KR D+
Sbjct  549  PDSVEQVTGATLHTKNGLWCKLQKRSDI  576



>ref|XP_010321037.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=573

 Score =   275 bits (703),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 139/148 (94%), Gaps = 1/148 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D LPGGYNGDK+GY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V+KES+ IEGW 
Sbjct  426  DILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVQKESQGIEGWG  485

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++LKG+
Sbjct  486  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELKGS  545

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  546  PEDVELVTGATIHTKTGLWCKLKKRSNI  573



>ref|XP_004239253.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=578

 Score =   275 bits (703),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 139/148 (94%), Gaps = 1/148 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D LPGGYNGDK+GY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V+KES+ IEGW 
Sbjct  431  DILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVQKESQGIEGWG  490

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++LKG+
Sbjct  491  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELKGS  550

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  551  PEDVELVTGATIHTKTGLWCKLKKRSNI  578



>ref|XP_011100398.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Sesamum indicum]
Length=577

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGYNG+KDGYAIP GTD+F+SVYNLHRSP+FWD PN+FEPERF ++K S++EGWAG
Sbjct  430  DTLPGGYNGNKDGYAIPPGTDLFVSVYNLHRSPHFWDNPNDFEPERFLMQKLSQLEGWAG  489

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD+ LKG+P
Sbjct  490  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVSLKGSP  549

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            ESV+LVTGATIHTKNGLWC+LKKR
Sbjct  550  ESVELVTGATIHTKNGLWCQLKKR  573



>ref|XP_002520583.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF41816.1| cytochrome P450, putative [Ricinus communis]
Length=555

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGWA  557
            D LPGGY GD +GYAIP GTDIFISVYNLHRSPYFW+ PNEFEPERF V RK  EIEGWA
Sbjct  407  DVLPGGYKGDNNGYAIPEGTDIFISVYNLHRSPYFWNSPNEFEPERFLVQRKSDEIEGWA  466

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKFD++LKG+
Sbjct  467  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFDVELKGS  526

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PESV+LVTGATIHTKNGLWCKLKKR +V
Sbjct  527  PESVELVTGATIHTKNGLWCKLKKRSNV  554



>gb|KHG14945.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=576

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 138/143 (97%), Gaps = 1/143 (1%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWAGF  551
            LPGGY GDKDGY IPAGTDIFISVYNLHRSPYFWD+P++F PERFQV+KESE IEGWAGF
Sbjct  430  LPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFQVQKESEGIEGWAGF  489

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKFD++L+G+PE
Sbjct  490  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFDVELRGSPE  549

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
            SV+LVTGATIHTKNGLWCKLK+R
Sbjct  550  SVELVTGATIHTKNGLWCKLKRR  572



>ref|XP_004147731.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN53488.1| hypothetical protein Csa_4G056760 [Cucumis sativus]
Length=580

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGYNGDK+GYAIPAGTDIFISVYNLHRSPYFW+ P EFEPERFQV++ SE IEGW
Sbjct  431  PDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQVKRASEGIEGW  490

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
             GFDPSRSPGALYPNEI+SDF+FLPFGGGPRKCVGDQFALMES IALAMLLQKFD++L+G
Sbjct  491  DGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELRG  550

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  551  SPESVELVTGATIHTKSGLWCKLRRRSQV  579



>ref|XP_010093134.1| Cytochrome P450 [Morus notabilis]
 gb|EXB53586.1| Cytochrome P450 [Morus notabilis]
Length=581

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D+LPGGYNGDK+GY IP GTDIFISVYNLHRSPYFWD+PNEFEPERF V K+ E IEGW 
Sbjct  433  DKLPGGYNGDKNGYEIPVGTDIFISVYNLHRSPYFWDRPNEFEPERFLVEKKGECIEGWD  492

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDF+FLPFGGGPRKCVGDQFALMES +ALAMLLQKFD++LKG+
Sbjct  493  GFDPSRSPGALYPNEIISDFSFLPFGGGPRKCVGDQFALMESTVALAMLLQKFDVELKGS  552

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PESV+LVTGATIHTKNGLWCKL+KR  V
Sbjct  553  PESVELVTGATIHTKNGLWCKLRKRSHV  580



>ref|XP_002308766.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
 gb|EEE92289.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
Length=579

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGY GDKDGYAIPAGTDIF+SVYNLHRSPYFWD PNEFEPERF V + ++ IEGW
Sbjct  430  PDVLPGGYKGDKDGYAIPAGTDIFVSVYNLHRSPYFWDNPNEFEPERFLVTRNNDGIEGW  489

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IAL +LLQKFD++L+G
Sbjct  490  SGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALTLLLQKFDVELRG  549

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +PE V+LVTGATIHTKNGLWC+LKKR DV
Sbjct  550  SPEEVELVTGATIHTKNGLWCRLKKRSDV  578



>ref|XP_007158591.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
 gb|ESW30585.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
Length=576

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LPGG+ GDKDGYAIPAGTD+FISVYNLHRSPYFWD+P+EFEPERF V+ K  EIEGW+
Sbjct  428  DVLPGGHKGDKDGYAIPAGTDLFISVYNLHRSPYFWDRPHEFEPERFLVQNKNEEIEGWS  487

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ FD++LKGT
Sbjct  488  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNFDVELKGT  547

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PESV+LVTGATIHTKNGLWCKLKKR D+
Sbjct  548  PESVELVTGATIHTKNGLWCKLKKRSDL  575



>ref|XP_004164429.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
Length=580

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 140/149 (94%), Gaps = 1/149 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGYNGDK+GYAIPAGTDIFISVYNLHRSPYFW+ P EFEPERFQV++ SE IEGW
Sbjct  431  PDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQVKRASEGIEGW  490

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
             GFDPSRSPGALYPNEI+SDF+FLPFGGGPRKCVGDQFALMES IALA+LLQKFD++L+G
Sbjct  491  DGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALALLLQKFDVELRG  550

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  551  SPESVELVTGATIHTKSGLWCKLRRRSQV  579



>ref|XP_007215027.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
 gb|EMJ16226.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
Length=577

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGYNG+KDGY IPAGTDIF+SVYNLHRSPYFWD PNEFEPERF V K+SE+EGWAG
Sbjct  430  DTLPGGYNGEKDGYVIPAGTDIFLSVYNLHRSPYFWDNPNEFEPERFLVPKKSEVEGWAG  489

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSR PGALYP+EI +DFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF ++LKG+P
Sbjct  490  FDPSRIPGALYPSEITADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFTVELKGSP  549

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDV  293
            ESV+ VTGATIHTKNGLWCKL+KR DV
Sbjct  550  ESVEQVTGATIHTKNGLWCKLRKRSDV  576



>gb|KDP42786.1| hypothetical protein JCGZ_00485 [Jatropha curcas]
Length=583

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGWA  557
            D LPGGY G KDGYAIP GTDIFISVYNLHRSPYFWD PNEFEPERF V RK  EIEGW 
Sbjct  439  DVLPGGYKGSKDGYAIPKGTDIFISVYNLHRSPYFWDLPNEFEPERFLVQRKSEEIEGWT  498

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEII+DFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKFD++LKG+
Sbjct  499  GFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFDVELKGS  558

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LVTGATIHTKNGLWCKL+KR
Sbjct  559  PESVELVTGATIHTKNGLWCKLRKR  583



>ref|XP_008451892.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic 
[Cucumis melo]
Length=580

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGYNGDK+GYAIPAGTDIFISVYNLHRSPYFW+ P EFEPERFQV++ SE IEGW
Sbjct  431  PDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQVKRASEGIEGW  490

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
             GFDPSRSPGALYPNEI+SDF+FLPFGGGPRKCVGDQFALMES IALA LLQKFD++L+G
Sbjct  491  DGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALAXLLQKFDVELRG  550

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  551  SPESVELVTGATIHTKSGLWCKLRRRSQV  579



>gb|KJB10650.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=498

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 137/143 (96%), Gaps = 1/143 (1%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWAGF  551
            LPGGY GDKDGY IPAGTDIFISVYNLHRSPYFWD+P++F PERF+V+KESE IE WAGF
Sbjct  352  LPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFRVQKESEGIEEWAGF  411

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKFD++L+G+PE
Sbjct  412  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFDVELRGSPE  471

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
            SV+LVTGATIHTKNGLWCKLK+R
Sbjct  472  SVELVTGATIHTKNGLWCKLKRR  494



>ref|XP_010680161.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGY G KDGY IP GTDIFISVYNLHRSPY WDKP+EFEPERF V ++SE IEGW
Sbjct  425  PDLLPGGYKGQKDGYQIPTGTDIFISVYNLHRSPYLWDKPHEFEPERFLVERKSEDIEGW  484

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
             GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD+ LKG
Sbjct  485  NGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVTLKG  544

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +P+SV+LVTGATIHTKNGLWCKL+KR +V
Sbjct  545  SPDSVELVTGATIHTKNGLWCKLRKRANV  573



>gb|KEH27406.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=426

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LPGG+ GDKDGY IPAGTD+FISVYNLHRSPYFWD+P++FEPERF V  K  EIEGWA
Sbjct  278  DVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVENKNEEIEGWA  337

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ FD++LKGT
Sbjct  338  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNFDVELKGT  397

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LVTGATIHTKNGLWC L+KR
Sbjct  398  PESVELVTGATIHTKNGLWCNLRKR  422



>gb|KJB10648.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=579

 Score =   270 bits (690),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 137/143 (96%), Gaps = 1/143 (1%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWAGF  551
            LPGGY GDKDGY IPAGTDIFISVYNLHRSPYFWD+P++F PERF+V+KESE IE WAGF
Sbjct  433  LPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFRVQKESEGIEEWAGF  492

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKFD++L+G+PE
Sbjct  493  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFDVELRGSPE  552

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
            SV+LVTGATIHTKNGLWCKLK+R
Sbjct  553  SVELVTGATIHTKNGLWCKLKRR  575



>ref|XP_011002376.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Populus euphratica]
Length=585

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGY GDKDGYAI AGTDIF+SVYNLHRSPYFWD PNEFEPERF V + S+ IEGW
Sbjct  436  PDVLPGGYKGDKDGYAIRAGTDIFVSVYNLHRSPYFWDNPNEFEPERFLVTRNSDGIEGW  495

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES  AL +LLQKFD++L+G
Sbjct  496  SGFDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTTALTLLLQKFDVELRG  555

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +PE V+LVTGATIHTKNGLWC+LKKR DV
Sbjct  556  SPEEVELVTGATIHTKNGLWCRLKKRSDV  584



>ref|XP_010044825.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Eucalyptus grandis]
 gb|KCW88536.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88537.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88538.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
Length=584

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            DQLPGGY GDK+GYAIPAGTDIFISVYNLHRSPYFWD+P++FEPERF  +++SE +EGWA
Sbjct  434  DQLPGGYRGDKNGYAIPAGTDIFISVYNLHRSPYFWDRPSDFEPERFLTQRKSEGVEGWA  493

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEI+SDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKFD++LKG+
Sbjct  494  GFDPSRSPGALYPNEIVSDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFDVELKGS  553

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLD  296
             +SV+LVTGATIHTKNGLWC ++KR D
Sbjct  554  ADSVELVTGATIHTKNGLWCNIRKRSD  580



>ref|XP_010313051.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic-like 
[Solanum lycopersicum]
Length=585

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 1/148 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D LPGGYNGDK+GY IPAGTD+F+SVYNLHRSPYFWDKPNEFEP RF V+KES  IEGW 
Sbjct  438  DILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPXRFLVQKESRGIEGWG  497

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRS GALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD++LKG+
Sbjct  498  GFDPSRSRGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELKGS  557

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  558  PEDVELVTGATIHTKTGLWCKLKKRSNI  585



>ref|XP_003610974.1| Cytochrome P450 [Medicago truncatula]
 gb|AES93932.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=574

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LPGG+ GDKDGY IPAGTD+FISVYNLHRSPYFWD+P++FEPERF V  K  EIEGWA
Sbjct  426  DVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVENKNEEIEGWA  485

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ FD++LKGT
Sbjct  486  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNFDVELKGT  545

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LVTGATIHTKNGLWC L+KR
Sbjct  546  PESVELVTGATIHTKNGLWCNLRKR  570



>gb|KHN35086.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=576

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LPGG+ G+KDGYAIPAGTD+FISVYNLHRSPYFWD+P++FEPERF V+ K  EIEGWA
Sbjct  428  DVLPGGHKGEKDGYAIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVQNKNEEIEGWA  487

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            G DPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ FD++LKGT
Sbjct  488  GLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNFDVELKGT  547

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LVTGATIHTKNG+WC+LKKR
Sbjct  548  PESVELVTGATIHTKNGMWCRLKKR  572



>ref|NP_001235534.1| cytochrome P450 97B2, chloroplastic [Glycine max]
 sp|O48921.1|C97B2_SOYBN RecName: Full=Cytochrome P450 97B2, chloroplastic; Flags: Precursor 
[Glycine max]
 gb|AAB94586.1| CYP97B2p [Glycine max]
Length=576

 Score =   267 bits (683),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LPGG+ G+KDGYAIPAGTD+FISVYNLHRSPYFWD+P++FEPERF V+ K  EIEGWA
Sbjct  428  DVLPGGHKGEKDGYAIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVQNKNEEIEGWA  487

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            G DPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ FD++LKGT
Sbjct  488  GLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNFDVELKGT  547

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LVTGATIHTKNG+WC+LKKR
Sbjct  548  PESVELVTGATIHTKNGMWCRLKKR  572



>ref|XP_007049043.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
 gb|EOX93200.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
Length=622

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D +PGGY GDKDGY IPAGTDIF+SVYNLHRSPYFWD+P++F PERF V K+SE IEGWA
Sbjct  474  DVIPGGYKGDKDGYKIPAGTDIFLSVYNLHRSPYFWDQPHDFVPERFLVEKKSEGIEGWA  533

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++LKG+
Sbjct  534  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELKGS  593

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LVTGATIHTKNG+WCKL+KR
Sbjct  594  PESVELVTGATIHTKNGMWCKLRKR  618



>ref|XP_002266883.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Vitis vinifera]
 emb|CBI34117.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGY G KDG++IPAGTDIF+SVYNLHRSPYFWD+P+EFEPERF V + S+IEGW+G
Sbjct  425  DALPGGYKGKKDGHSIPAGTDIFLSVYNLHRSPYFWDRPHEFEPERFLVPRNSDIEGWSG  484

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSRSPGALYPNEI++DFAFLPFGGGPRKCVGDQFALMES IAL MLLQKFD++LKG P
Sbjct  485  FDPSRSPGALYPNEIVADFAFLPFGGGPRKCVGDQFALMESTIALTMLLQKFDVELKGGP  544

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDV  293
            ESV+LVTGATIHTKNGLWC++ KR D+
Sbjct  545  ESVELVTGATIHTKNGLWCRMMKRSDL  571



>gb|KDO64373.1| hypothetical protein CISIN_1g014372mg [Citrus sinensis]
Length=426

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKESEIEGW  560
            PD LPGGY GDKDGY +PAGTDIF+S+YNLHRSPYFWD+P+EFEPERF + RK+  IEGW
Sbjct  277  PDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKDVGIEGW  336

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDPSRSPGALYPNEI+SD+AFL FGGGPRKCVGDQFA+MES + LAMLLQKFDI+LKG
Sbjct  337  SGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKFDIELKG  396

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LVTGATIHTKNGLWCKL++R
Sbjct  397  SPESVELVTGATIHTKNGLWCKLRER  422



>ref|XP_006429774.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43014.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=426

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKESEIEGW  560
            PD LPGGY GDKDGY +PAGTDIF+S+YNLHRSPYFWD+P+EFEPERF + RK+  IEGW
Sbjct  277  PDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKDVGIEGW  336

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDPSRSPGALYPNEI+SD+AFL FGGGPRKCVGDQFA+MES + LAMLLQKFDI+LKG
Sbjct  337  SGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKFDIELKG  396

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LVTGATIHTKNGLWCKL++R
Sbjct  397  SPESVELVTGATIHTKNGLWCKLRER  422



>dbj|BAJ97821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+  IEGW
Sbjct  426  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKKDENIEGW  485

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  486  AGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  545

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  546  SPDEVEMVTGATIHTKNGLWCRLRKR  571



>ref|XP_010914244.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Elaeis guineensis]
Length=574

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD+LPGGY GD++GY IPAGTDIF+SVYNLHRSPYFW++PNEFEPERF V K+SE I+GW
Sbjct  424  PDKLPGGYKGDENGYKIPAGTDIFLSVYNLHRSPYFWERPNEFEPERFLVTKKSEGIDGW  483

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES IALAMLLQK+DI+LKG
Sbjct  484  AGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTIALAMLLQKYDIELKG  543

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V+ VTGATIHTKNGLWCKLK+R
Sbjct  544  SPDEVEPVTGATIHTKNGLWCKLKRR  569



>ref|XP_010260624.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=481

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 137/151 (91%), Gaps = 2/151 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGY GDK+GY IPAGTD+F+SVYNLHRSPYFWD+P+EFEPERF V ++SE IEGW
Sbjct  325  PDVLPGGYKGDKEGYPIPAGTDLFVSVYNLHRSPYFWDRPHEFEPERFLVPRKSEGIEGW  384

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RS GALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL +LLQKF ++LKG
Sbjct  385  AGFDPCRSAGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALVLLLQKFTVELKG  444

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLD-VC  290
            +PESV+LVTGATIHTK+GLWCKL+KR   VC
Sbjct  445  SPESVELVTGATIHTKSGLWCKLRKRASTVC  475



>dbj|BAJ87287.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+  IEGW
Sbjct  426  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKKDENIEGW  485

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  486  AGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  545

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  546  SPDEVEMVTGATIHTKNGLWCRLRKR  571



>ref|XP_007049044.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
 gb|EOX93201.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
Length=582

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 137/146 (94%), Gaps = 2/146 (1%)
 Frame = -1

Query  733  DQLP-GGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            D +P GGY GDKDGY IPAGTDIF+SVYNLHRSPYFWD+P++F PERF V K+SE IEGW
Sbjct  433  DVIPAGGYKGDKDGYKIPAGTDIFLSVYNLHRSPYFWDQPHDFVPERFLVEKKSEGIEGW  492

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++LKG
Sbjct  493  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELKG  552

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LVTGATIHTKNG+WCKL+KR
Sbjct  553  SPESVELVTGATIHTKNGMWCKLRKR  578



>gb|EMS51606.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=571

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+  IEGW
Sbjct  425  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKKDENIEGW  484

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  485  AGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  544

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P  V++VTGATIHTKNGLWC+L+KR
Sbjct  545  SPNEVEMVTGATIHTKNGLWCRLRKR  570



>dbj|BAG90081.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+P+EFEPERF V +K+  IEGW
Sbjct  245  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSVPKKDESIEGW  304

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEI++DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  305  AGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  364

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTK+GLWC++++R
Sbjct  365  SPDEVEMVTGATIHTKSGLWCRVRRR  390



>ref|XP_002451628.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
 gb|EES04604.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
Length=573

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+  IEGW
Sbjct  427  PDKLPGGYNGAKEGYEIPAGTDIFVSIYNLHRSPYFWDRPNEFEPERFSVPKKDESIEGW  486

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LL+KFD++L+G
Sbjct  487  SGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKFDVELRG  546

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  547  SPDEVEMVTGATIHTKNGLWCRLRKR  572



>ref|XP_010233882.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=422

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V K  E IEGW
Sbjct  276  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKMDENIEGW  335

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALAMLL KFD++L+G
Sbjct  336  SGFDPGRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAMLLGKFDVELRG  395

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTKNGLWC+L KR
Sbjct  396  SPDEVEMVTGATIHTKNGLWCRLMKR  421



>emb|CDP16026.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D+LPGG+ GD +GYAIPAGTDIF+SVYN+HRSPY WD PN+FEPERF V++ S+ IEGWA
Sbjct  449  DKLPGGHKGDNNGYAIPAGTDIFLSVYNVHRSPYLWDNPNDFEPERFLVKRVSQGIEGWA  508

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEI+SDFAFLPFGGGPRKCVGDQFA MES IALAMLLQ+FDI+LKG+
Sbjct  509  GFDPSRSPGALYPNEIMSDFAFLPFGGGPRKCVGDQFAFMESTIALAMLLQEFDIELKGS  568

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PESV++VTGATIHTKNGLWC+L KR D+
Sbjct  569  PESVEIVTGATIHTKNGLWCRLMKRQDI  596



>ref|XP_004951757.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Setaria 
italica]
Length=568

 Score =   262 bits (669),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+  IEGW
Sbjct  421  PDKLPGGYNGAKEGYEIPAGTDIFVSIYNLHRSPYFWDRPNEFEPERFSVPKKDESIEGW  480

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LL+KFD++L+G
Sbjct  481  SGFDPERSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKFDVELRG  540

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTKNGLWC+L++R
Sbjct  541  SPDEVEMVTGATIHTKNGLWCRLRRR  566



>ref|XP_010440341.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Camelina sativa]
Length=578

 Score =   262 bits (669),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGGY G+K GY +P GTDIFISVYNLHRSPYFWD P+EFEPERF   KES  IEGW
Sbjct  431  PETLPGGYKGEKSGYQVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLRTKESNGIEGW  490

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+G
Sbjct  491  AGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRG  550

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LV+GATIH KNG+WCKLKKR
Sbjct  551  SPESVELVSGATIHAKNGMWCKLKKR  576



>ref|XP_006429775.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43015.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=582

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKESEIEGW  560
            PD LPGGY GDKDGY +PAGTDIF+S+YNLHRSPYFWD+P+EFEPERF + RK+  IEGW
Sbjct  433  PDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKDVGIEGW  492

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDPSRSPGALYPNEI+SD+AFL FGGGPRKCVGDQFA+MES + LAMLLQKFDI+LKG
Sbjct  493  SGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKFDIELKG  552

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LVTGATIHTKNGLWCKL++R
Sbjct  553  SPESVELVTGATIHTKNGLWCKLRER  578



>ref|XP_010260623.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=587

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 137/151 (91%), Gaps = 2/151 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGY GDK+GY IPAGTD+F+SVYNLHRSPYFWD+P+EFEPERF V ++SE IEGW
Sbjct  431  PDVLPGGYKGDKEGYPIPAGTDLFVSVYNLHRSPYFWDRPHEFEPERFLVPRKSEGIEGW  490

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RS GALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL +LLQKF ++LKG
Sbjct  491  AGFDPCRSAGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALVLLLQKFTVELKG  550

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLD-VC  290
            +PESV+LVTGATIHTK+GLWCKL+KR   VC
Sbjct  551  SPESVELVTGATIHTKSGLWCKLRKRASTVC  581



>ref|XP_006481375.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Citrus sinensis]
Length=619

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKESEIEGW  560
            PD LPGGY GDKDGY +PAGTDIF+S+YNLHRSPYFWD+P+EFEPERF + RK+  IEGW
Sbjct  470  PDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKDVGIEGW  529

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDPSRSPGALYPNEI+SD+AFL FGGGPRKCVGDQFA+MES + LAMLLQKFDI+LKG
Sbjct  530  SGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKFDIELKG  589

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LVTGATIHTKNGLWCKL++R
Sbjct  590  SPESVELVTGATIHTKNGLWCKLRER  615



>ref|XP_008809593.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Phoenix dactylifera]
Length=572

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD+LPGGY GD++GY IPAGTDIF+SVYNLHRSP+FWD+PNEFEPERF V K+SE IEGW
Sbjct  422  PDKLPGGYKGDENGYKIPAGTDIFLSVYNLHRSPHFWDRPNEFEPERFLVPKKSEDIEGW  481

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RS GA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALAMLLQK+DI+LKG
Sbjct  482  AGFDPDRSAGAIYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAMLLQKYDIELKG  541

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V+ VTGATIHTKNGLWCKLK+R
Sbjct  542  SPDDVEPVTGATIHTKNGLWCKLKRR  567



>emb|CDY22733.1| BnaA08g05630D [Brassica napus]
Length=566

 Score =   259 bits (661),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P EFEPERF  +KES  IEGW
Sbjct  419  PETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLRKKESNGIEGW  478

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+G
Sbjct  479  AGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRG  538

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
             PESV+LV+GATIH KNG+WCKLK+R
Sbjct  539  PPESVELVSGATIHAKNGMWCKLKRR  564



>ref|XP_008679919.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Zea mays]
 gb|ADL28271.1| carotene beta-ring hydroxylase [Zea mays]
 gb|AFP28222.1| beta-carotene hydroxylase [synthetic construct]
 gb|AFW66346.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=572

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGG NG K+GY IPAGTDIF+SVYNLHRSPYFWD+PNEFEPERF V +K+  IEGW
Sbjct  426  PDKLPGGCNGAKEGYEIPAGTDIFVSVYNLHRSPYFWDRPNEFEPERFSVPKKDESIEGW  485

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LL+KFD++L+G
Sbjct  486  SGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKFDVELRG  545

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTKNGLWC+L++R
Sbjct  546  SPDEVEMVTGATIHTKNGLWCRLRRR  571



>ref|XP_006648355.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Oryza brachyantha]
Length=543

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V K  E IEGW
Sbjct  397  PDKLPGGYNGAKEGYDIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFSVPKMDESIEGW  456

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  457  AGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  516

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P  V++VTGATIHTK+GLWC++++R
Sbjct  517  SPNEVEMVTGATIHTKSGLWCRVRRR  542



>ref|XP_010435019.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGGY G+K G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES  IEGW
Sbjct  432  PETLPGGYKGEKSGHQVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKESNGIEGW  491

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+G
Sbjct  492  AGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRG  551

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LV+GATIH KNG+WCKLKKR
Sbjct  552  SPESVELVSGATIHAKNGMWCKLKKR  577



>ref|XP_009107829.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Brassica rapa]
Length=578

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P EFEPERF  +KES  IEGW
Sbjct  431  PETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLRKKESNGIEGW  490

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+G
Sbjct  491  AGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRG  550

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
             PESV+LV+GATIH KNG+WCKLK+R
Sbjct  551  PPESVELVSGATIHAKNGMWCKLKRR  576



>emb|CDY09057.1| BnaC08g10110D [Brassica napus]
Length=565

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P EFEPERF   KES  IEGW
Sbjct  418  PETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLRTKESNGIEGW  477

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+G
Sbjct  478  AGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRG  537

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
             PESV+LV+GATIH KNG+WCKLK+R
Sbjct  538  PPESVELVSGATIHAKNGMWCKLKRR  563



>ref|XP_003570274.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=569

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V K  E IEGW
Sbjct  423  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKMDENIEGW  482

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            +GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALAMLL KFD++L+G
Sbjct  483  SGFDPGRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAMLLGKFDVELRG  542

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTKNGLWC+L KR
Sbjct  543  SPDEVEMVTGATIHTKNGLWCRLMKR  568



>gb|KFK33561.1| hypothetical protein AALP_AA5G029500 [Arabis alpina]
Length=577

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P+EFEPERF   KES  IEGW
Sbjct  430  PETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLRTKESNGIEGW  489

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEI+SDFAFLPFGGGPRKC+GDQFALMES +ALAML QKFD++L+G
Sbjct  490  AGFDPSRSPGALYPNEIVSDFAFLPFGGGPRKCIGDQFALMESTVALAMLFQKFDVELRG  549

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LV+GATIH KNG+WCKLK+R
Sbjct  550  SPESVELVSGATIHAKNGMWCKLKRR  575



>gb|EAZ21913.1| hypothetical protein OsJ_05566 [Oryza sativa Japonica Group]
Length=557

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+P+EFEPERF V +K+  IEGW
Sbjct  411  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSVPKKDESIEGW  470

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEI++DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  471  AGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  530

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTK+GLWC++++R
Sbjct  531  SPDEVEMVTGATIHTKSGLWCRVRRR  556



>ref|XP_006414564.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
 gb|ESQ56017.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
Length=581

 Score =   257 bits (657),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            + LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P+EFEPERF   KES  IEGWA
Sbjct  435  ETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPDEFEPERFLRTKESNGIEGWA  494

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+G+
Sbjct  495  GFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRGS  554

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LV+GATIH KNG+WCKLK+R
Sbjct  555  PESVELVSGATIHAKNGMWCKLKRR  579



>dbj|BAD26183.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=571

 Score =   256 bits (655),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+P+EFEPERF V +K+  IEGW
Sbjct  425  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSVPKKDESIEGW  484

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEI++DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  485  AGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  544

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTK+GLWC++++R
Sbjct  545  SPDEVEMVTGATIHTKSGLWCRVRRR  570



>gb|EAY84668.1| hypothetical protein OsI_06039 [Oryza sativa Indica Group]
Length=571

 Score =   256 bits (655),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+P+EFEPERF V +K+  IEGW
Sbjct  425  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSVPKKDESIEGW  484

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEI++DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  485  AGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  544

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V++VTGATIHTK+GLWC++++R
Sbjct  545  SPDEVEMVTGATIHTKSGLWCRVRRR  570



>ref|XP_010532498.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Tarenaya hassleriana]
Length=585

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGGYNG+K+G+ IP GTDIFISVYNLHRSPYFWD P++FEPERF  ++ES+ IEGW
Sbjct  437  PDILPGGYNGEKEGHRIPRGTDIFISVYNLHRSPYFWDSPDDFEPERFLRKRESDGIEGW  496

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNE+ISDFA LPFGGGPRKC+GDQFALMES  ALA+LLQKFD++L+G
Sbjct  497  AGFDPSRSPGALYPNEVISDFALLPFGGGPRKCIGDQFALMESTAALALLLQKFDVELRG  556

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
             PESV+LV+GATIH KNGLWCKLK+R
Sbjct  557  PPESVELVSGATIHAKNGLWCKLKRR  582



>ref|XP_006285060.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
 gb|EOA17958.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
Length=576

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            + LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES  IEGWA
Sbjct  430  ETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKESNGIEGWA  489

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEIISDFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+GT
Sbjct  490  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRGT  549

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LV+GATIH K+G+WCKLK+R
Sbjct  550  PESVELVSGATIHAKDGMWCKLKRR  574



>ref|XP_010495892.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            + LPGGY G+K G+ +P GTDIFISVYNLHRSPYFWD P+EFEPERF   KES  IEGWA
Sbjct  433  ETLPGGYKGEKSGHQVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLRTKESNGIEGWA  492

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+G 
Sbjct  493  GFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRGP  552

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PESV+LV+GATIH KNG+WCKLKKR
Sbjct  553  PESVELVSGATIHAKNGMWCKLKKR  577



>emb|CAB10290.1| cytochrome P450 like protein [Arabidopsis thaliana]
 emb|CAB78553.1| cytochrome P450 like protein [Arabidopsis thaliana]
Length=576

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGG+ G+K+G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES  IEGW
Sbjct  429  PETLPGGHKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKESNGIEGW  488

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAML QKFD++L+G
Sbjct  489  AGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLFQKFDVELRG  548

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            TPESV+LV+GATIH KNG+WCKLK+R
Sbjct  549  TPESVELVSGATIHAKNGMWCKLKRR  574



>ref|NP_193247.2| cytochrome P450 97B3 [Arabidopsis thaliana]
 sp|O23365.2|C97B3_ARATH RecName: Full=Cytochrome P450 97B3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32753.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO00942.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AEE83557.1| cytochrome P450 97B3 [Arabidopsis thaliana]
Length=580

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGG+ G+K+G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES  IEGW
Sbjct  433  PETLPGGHKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKESNGIEGW  492

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAML QKFD++L+G
Sbjct  493  AGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLFQKFDVELRG  552

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            TPESV+LV+GATIH KNG+WCKLK+R
Sbjct  553  TPESVELVSGATIHAKNGMWCKLKRR  578



>ref|XP_009412060.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D+LPGGY G  DGYAIPAG DIFISV+NLHRSPYFWD+PNEFEPERF   K SE I GWA
Sbjct  277  DKLPGGYMGCDDGYAIPAGADIFISVFNLHRSPYFWDRPNEFEPERFLAPKPSEGIAGWA  336

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            G+DP RSPGA+YPNEI SDFAF+PFGGGPRKCVGDQFAL+ES IALA+LLQKFD+ L+G+
Sbjct  337  GYDPGRSPGAMYPNEITSDFAFIPFGGGPRKCVGDQFALLESTIALALLLQKFDVLLRGS  396

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            P+ V+LVTGATIHTKNGLWCKLKKR
Sbjct  397  PDEVELVTGATIHTKNGLWCKLKKR  421



>ref|XP_002868224.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44483.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES  IEGW
Sbjct  424  PETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKESNGIEGW  483

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDPS S GALYPNEIISDFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKFD++L+G
Sbjct  484  AGFDPSCSLGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKFDVELRG  543

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +PESV+LV+GATIH KNG+WCKLK+R
Sbjct  544  SPESVELVSGATIHAKNGMWCKLKRR  569



>ref|XP_006854622.1| hypothetical protein AMTR_s00030p00167800 [Amborella trichopoda]
 gb|ERN16089.1| hypothetical protein AMTR_s00030p00167800 [Amborella trichopoda]
Length=440

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPGG  GDK+GY+IPAGT+I +SVYNLHR  YFWD+P+EFEPERF   K+SE+EGWA
Sbjct  289  PDILPGGLTGDKNGYSIPAGTEICLSVYNLHRCHYFWDRPHEFEPERFLRPKKSEVEGWA  348

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDP RSPGALYPNEIISDFAFLPFGGGPRKC+GDQFALMES IALA+LL +FD++L+  
Sbjct  349  GFDPQRSPGALYPNEIISDFAFLPFGGGPRKCLGDQFALMESTIALALLLHRFDVELRDP  408

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PES++ VTGATIHTK+GLWCKL+KR
Sbjct  409  PESMEAVTGATIHTKDGLWCKLRKR  433



>ref|XP_009412059.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=574

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D+LPGGY G  DGYAIPAG DIFISV+NLHRSPYFWD+PNEFEPERF   K SE I GWA
Sbjct  429  DKLPGGYMGCDDGYAIPAGADIFISVFNLHRSPYFWDRPNEFEPERFLAPKPSEGIAGWA  488

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            G+DP RSPGA+YPNEI SDFAF+PFGGGPRKCVGDQFAL+ES IALA+LLQKFD+ L+G+
Sbjct  489  GYDPGRSPGAMYPNEITSDFAFIPFGGGPRKCVGDQFALLESTIALALLLQKFDVLLRGS  548

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            P+ V+LVTGATIHTKNGLWCKLKKR
Sbjct  549  PDEVELVTGATIHTKNGLWCKLKKR  573



>ref|XP_004303949.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011467680.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=572

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPGGY G+K GY IPAGTDIFISVYNLHRSPY+WD+PN FEPERF V+K SEIEGWA
Sbjct  424  PDTLPGGYKGEKGGYKIPAGTDIFISVYNLHRSPYYWDRPNVFEPERFSVQKNSEIEGWA  483

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGA YPNEI++DF+FLPFGGGPRKCVGDQFAL+ES ++LAMLLQKF+++L+G+
Sbjct  484  GFDPSRSPGAYYPNEIMADFSFLPFGGGPRKCVGDQFALLESTVSLAMLLQKFNVELRGS  543

Query  376  PESVKLVTGATIHTKNGLWCKLKKRLDV  293
            PESV LVTGATIHTKNG+WCKL KR DV
Sbjct  544  PESVGLVTGATIHTKNGMWCKLSKRSDV  571



>ref|XP_008229650.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Prunus mume]
Length=577

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGYN        PAGTDIF+SVYNLHRSPYFWD PNEFEPERF V K+SE+EGWAG
Sbjct  432  DTLPGGYNXXXXXS--PAGTDIFLSVYNLHRSPYFWDNPNEFEPERFLVPKKSEVEGWAG  489

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
            FDPSR PGALYP EI +DFAFLPFGGGPRKCVGDQFALMES + LAMLLQKF ++LKG+P
Sbjct  490  FDPSRIPGALYPGEITADFAFLPFGGGPRKCVGDQFALMESTVTLAMLLQKFTVELKGSP  549

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDV  293
            ESV+ VTGATIHTKNGLWCKL+KR DV
Sbjct  550  ESVEQVTGATIHTKNGLWCKLRKRSDV  576



>gb|AAT28222.1| putative 97B2-like cytochrome P450 [Ginkgo biloba]
Length=586

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D +PGGY GDKDGY IP GTDIFISVYNLHRSPYFWD+P+EF PERF + K+++ IEGWA
Sbjct  434  DTIPGGYRGDKDGYLIPKGTDIFISVYNLHRSPYFWDQPHEFRPERFLIPKDNKGIEGWA  493

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDP RS GALYPNE+++DFAFLPFGGGPRKCVGDQFALMES + LAMLLQKF+++LK  
Sbjct  494  GFDPYRSQGALYPNEVLADFAFLPFGGGPRKCVGDQFALMESTVGLAMLLQKFEVELKDP  553

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            PES+++VTGATIHT+NGLWCK+K+R
Sbjct  554  PESLRIVTGATIHTQNGLWCKIKRR  578



>ref|XP_006841947.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
 gb|ERN03622.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
Length=589

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQ-VRKESEIEGWA  557
            D LPGG+ GDKDGYAIPAGTDIFISVYNLHRSPYFW++P+EFEPERF   RK   IEGWA
Sbjct  434  DTLPGGFKGDKDGYAIPAGTDIFISVYNLHRSPYFWEQPHEFEPERFLGPRKGEGIEGWA  493

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GFDPSRSPGALY NEI++DFAFLPFGGGPRKCVGDQFALMES +ALAMLL+KF+++L+  
Sbjct  494  GFDPSRSPGALYSNEIVADFAFLPFGGGPRKCVGDQFALMESTVALAMLLRKFNVELRDP  553

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
            P+ V+LVTGATIHTK GLWC LK R
Sbjct  554  PDQVELVTGATIHTKAGLWCNLKFR  578



>ref|XP_001769554.1| predicted protein [Physcomitrella patens]
 gb|EDQ65715.1| predicted protein [Physcomitrella patens]
Length=586

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 1/150 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGG+ GD +GY+IP G D+FISVYNLHRSPYFWD+P +F PERF   K S+ IEGW
Sbjct  434  PDTLPGGHKGDPNGYSIPKGVDLFISVYNLHRSPYFWDEPEKFNPERFLKAKLSDGIEGW  493

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP R  GALYPNE+++DFAFLPFGGG RKCVGDQFALMES +ALAMLLQKF+++L+G
Sbjct  494  AGFDPKRGQGALYPNEVMADFAFLPFGGGARKCVGDQFALMESTVALAMLLQKFEVELRG  553

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLDVC  290
            +PE V+LVTGATIHTK+GLWCKL +R  + 
Sbjct  554  SPEDVELVTGATIHTKDGLWCKLSRRKSIT  583



>ref|XP_002976141.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
 gb|EFJ23046.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
Length=541

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRK-ESEIEGW  560
            PD+LPGG+ GD DGY+IP GTDIFISV+NLHRSPYFW+ P  F+PERF  R+ +S I GW
Sbjct  395  PDKLPGGHKGDPDGYSIPKGTDIFISVFNLHRSPYFWENPESFDPERFLRRRVDSSIPGW  454

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AG DP++  G LYPNEI++DFAFLPFGGGPRKCVGDQFA ME+ I LA+LL+KF ++L+G
Sbjct  455  AGIDPTKLQG-LYPNEIMADFAFLPFGGGPRKCVGDQFAFMEATIGLAVLLRKFSVELRG  513

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V+LVTGAT+HTKNGLWCKL KR
Sbjct  514  SPQEVELVTGATLHTKNGLWCKLSKR  539



>ref|XP_002968239.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
 gb|EFJ30493.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
Length=563

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRK-ESEIEGW  560
            PD+LPGG+ GD DGY+IP GTDIFISV+NLHRSPYFW+ P  F+PERF  R+ +S I GW
Sbjct  419  PDKLPGGHKGDPDGYSIPKGTDIFISVFNLHRSPYFWENPESFDPERFLRRRVDSSIPGW  478

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AG DP++  G LYPNEI++DFAFLPFGGGPRKCVGDQFA ME+ I LA+LL+KF ++L+G
Sbjct  479  AGIDPTKLQG-LYPNEIMADFAFLPFGGGPRKCVGDQFAFMEATIGLAVLLRKFSVELRG  537

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V+LVTGAT+HTKNGLWCKL KR
Sbjct  538  SPQEVELVTGATLHTKNGLWCKLSKR  563



>gb|EMT03024.1| Cytochrome P450 97B2 [Aegilops tauschii]
Length=605

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKESEIEGW  560
            PD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD PNEFEPERF V +K+  IEGW
Sbjct  406  PDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDSPNEFEPERFTVPKKDENIEGW  465

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKFD++L+G
Sbjct  466  AGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRG  525

Query  379  TPESVKLV  356
            +P+ V+++
Sbjct  526  SPDEVEMI  533



>gb|KHN25634.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=353

 Score =   209 bits (532),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LPGG+ GDKDGYAIPAGTD+FISVYNLHRSPYFWD+P++FEPERF V+ K  EIEGW 
Sbjct  233  DVLPGGHKGDKDGYAIPAGTDVFISVYNLHRSPYFWDRPHDFEPERFLVQNKNEEIEGWG  292

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDL  386
            G DPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES +AL +LLQ FD++L
Sbjct  293  GLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTLLLQNFDVEL  349



>sp|Q43078.1|C97B1_PEA RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome 
P450 97A2; Flags: Precursor [Pisum sativum]
 emb|CAA89260.1| cytochrome P450 [Pisum sativum]
Length=552

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 99/108 (92%), Gaps = 1/108 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            PD LPGG+ GDKDGY IPAGTD+FISVYNLHRSPYFWD+PN+FEPERF V+  +E +EGW
Sbjct  436  PDVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPNDFEPERFLVQNNNEEVEGW  495

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALA  416
            AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL 
Sbjct  496  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALV  543



>ref|XP_011399626.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26688.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
Length=205

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 105/146 (72%), Gaps = 4/146 (3%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEI-EGW  560
            PD LPGG  GD  GY I  G D+FIS +NLHRSP+ WD P +F+PER+  ++ S I E W
Sbjct  43   PDVLPGGLYGDAAGYPIGKGADLFISTWNLHRSPHLWDDPEDFKPERWSAKRASPIPEKW  102

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AG+ P ++  ALYPNE+ SDFAF+PFGGG RKCVGDQFA++E+ +ALAM L+++   L  
Sbjct  103  AGYAPLQAASALYPNEVASDFAFIPFGGGARKCVGDQFAMLEATVALAMTLRRYSFSLAA  162

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
             P    L +GATIHT +GL C +++R
Sbjct  163  DP---GLASGATIHTAHGLRCSVQRR  185



>gb|AFR36909.1| chloroplast CYP97B, partial [Haematococcus pluvialis]
Length=539

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 101/150 (67%), Gaps = 2/150 (1%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEG--  563
            PD LP G  GD  GY I  G D FISV+NLHRSP+ W  P+ F PERF     +   G  
Sbjct  372  PDTLPPGLKGDPAGYPIGKGADPFISVWNLHRSPHLWKDPDTFRPERFSEPHSNPAFGSA  431

Query  562  WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLK  383
            WAG+ P  SPGALYPNE+ SDFAF+PFGGG RKC+GDQFAL E+ +ALA+LL+ F   L 
Sbjct  432  WAGYRPDASPGALYPNEVTSDFAFIPFGGGARKCIGDQFALFEATVALALLLRDFTFKLA  491

Query  382  GTPESVKLVTGATIHTKNGLWCKLKKRLDV  293
             +PE V + TGATIHT NGL  K+  R  V
Sbjct  492  VSPEQVGMATGATIHTANGLPMKITIRRAV  521



>gb|AGK38423.1| CYP97B1 [Parachlorella kessleri]
Length=607

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES-EIEG-W  560
            D LP G NGD +GY I  G D+FIS +NLHRSP+ W  P+ F PERF  R E+   EG W
Sbjct  445  DVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAERFENPAFEGRW  504

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AG+DP     +LYPNE+ SDFA LPFGGG RKCVGDQFA+ME+ +AL MLL++F   L G
Sbjct  505  AGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTMLLRRFRFRLAG  564

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            + + V + TGATIHT NGL   +++R
Sbjct  565  SAKDVGMATGATIHTANGLKVTVQRR  590



>emb|CBJ27249.1| Cytochrome P450 [Ectocarpus siliculosus]
Length=574

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWA  557
            D+LP G +GD     I  G D+F+++YNLHRS  FW+ PN+F+PERF+   +++ +EGWA
Sbjct  401  DELPPG-SGDGHRPKITRGVDLFLAIYNLHRSEDFWENPNKFDPERFERPFQNKGVEGWA  459

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            GF+P    G LYPNEI SDFA+LPFGGG RKCVGDQFA+MES ++LAML ++F+ +L   
Sbjct  460  GFNPDLLEGKLYPNEIASDFAYLPFGGGQRKCVGDQFAMMESVVSLAMLTRRFEFELMIK  519

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
            PE V   TGATIHT+NGL  ++KKR+
Sbjct  520  PEEVGFYTGATIHTRNGLPMRVKKRV  545



>gb|KIY95180.1| hypothetical protein MNEG_12781 [Monoraphidium neglectum]
Length=168

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQ-VRKESEIEG-WAGFDPSRSPGAL  524
            GY I  G D+FISV+NLHRSP+ W  P+ F PER++ V    +  G WAG+ P    GAL
Sbjct  16   GYPIGKGADLFISVWNLHRSPHLWKDPDTFRPERYEEVHTNPQYGGKWAGYQPEAGRGAL  75

Query  523  YPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGAT  344
            YPNE+ SDFAF+PFGGG RKC+GDQFAL E+ +A AMLL+++   L  TP+ + + TGAT
Sbjct  76   YPNEVASDFAFIPFGGGARKCIGDQFALFEATVAFAMLLRRYTFRLAATPQEIGMATGAT  135

Query  343  IHTKNGLWCKLKKR  302
            IHT NG+   + +R
Sbjct  136  IHTANGMMVSVSRR  149



>gb|AGK38421.1| CYP97B1 [Parachlorella kessleri]
Length=607

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES-EIEGW-  560
            D LP G NGD +GY I  G D+FIS +NLHRSP+ W  P+ F PERF  R E+   EG  
Sbjct  445  DVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAERFENPAFEGRR  504

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AG+DP     +LYPNE+ SDFA LPFGGG RKCVGDQFA+ME+ +AL MLL++F   L G
Sbjct  505  AGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTMLLRRFRFRLAG  564

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            + + V + TGATIHT NGL   +++R
Sbjct  565  SAKDVGMATGATIHTANGLKVTVRRR  590



>ref|XP_002955478.1| hypothetical protein VOLCADRAFT_65884 [Volvox carteri f. nagariensis]
 gb|EFJ43549.1| hypothetical protein VOLCADRAFT_65884 [Volvox carteri f. nagariensis]
Length=641

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 101/146 (69%), Gaps = 2/146 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKESEIEG-W  560
            D LPGG  GD  GY I  G D+FISV+NLHRSPY W  P+ F P+RF +     + EG W
Sbjct  470  DVLPGGLRGDPAGYPIGTGADLFISVWNLHRSPYLWKDPDTFRPDRFFESYSNPDFEGKW  529

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AG        ALYPNE+ SDFAF+PFGGG RKCVGDQFA+ E+ +ALA+LL++F   L+G
Sbjct  530  AGAYAVSGGAALYPNEVGSDFAFIPFGGGARKCVGDQFAMFEATVALAVLLRRFSFALEG  589

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
             PE V + TGATIHT NGL  ++ +R
Sbjct  590  PPEKVGMATGATIHTANGLMVRVSRR  615



>emb|CDY09055.1| BnaC08g10090D [Brassica napus]
Length=214

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 12/115 (10%)
 Frame = -1

Query  610  FEPERF-QVRKESEIEGWAGFDPSRSPGALYPNEII-----------SDFAFLPFGGGPR  467
            FEPERF + +K + IEGWAGFDPSRSPGALYPNE+            S     PFGGGPR
Sbjct  98   FEPERFLRTKKSNTIEGWAGFDPSRSPGALYPNEVKMKTCKYNISYHSRLCIFPFGGGPR  157

Query  466  KCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  302
             C+GDQFALMES +ALA+LLQKFD++++ +PESV+LV+GATI+ KNG+WCKLK+R
Sbjct  158  NCIGDQFALMESTVALAILLQKFDVEVRESPESVELVSGATINAKNGMWCKLKRR  212



>ref|XP_002292287.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90262.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=736

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 105/146 (72%), Gaps = 2/146 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LP G +G   G  +  GTDIFIS +NLHR+P +W+ P +++P R++ R K   ++GW 
Sbjct  537  DNLPAGGSGLSGGVKVLRGTDIFISTWNLHRAPEYWENPEKYDPTRWERRFKNPGVKGWN  596

Query  556  GFDPSR-SPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            G+DP + S  +LYPNEI +D+AFLPFG G RKC+GDQFA++E+++ LAM++ KFD  L G
Sbjct  597  GYDPEKQSESSLYPNEITADYAFLPFGAGKRKCIGDQFAMLEASVTLAMIINKFDFTLVG  656

Query  379  TPESVKLVTGATIHTKNGLWCKLKKR  302
            +P+ V + TGATIHT NGL   + +R
Sbjct  657  SPKDVGMKTGATIHTMNGLNLVVSRR  682



>ref|XP_005845008.1| hypothetical protein CHLNCDRAFT_138471 [Chlorella variabilis]
 gb|EFN52906.1| hypothetical protein CHLNCDRAFT_138471 [Chlorella variabilis]
Length=614

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 100/151 (66%), Gaps = 7/151 (5%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEG---  563
            D LP G  GD +GY I  G D+FIS++NLHRSP+ W  P+ F PERF  +          
Sbjct  452  DVLPAGLGGDPNGYPIGKGADLFISLWNLHRSPHLWKDPDTFRPERFTGQLGERFVNAAF  511

Query  562  ---WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDI  392
               WAG+ P     +LYPNE+ SDFAFLPFGGG RKC+GDQFA+ E+A+ L MLL++F  
Sbjct  512  GGKWAGYTPGGEGSSLYPNEVSSDFAFLPFGGGARKCIGDQFAVTEAALILVMLLRRFRF  571

Query  391  DLKGTPESVKLVTGATIHTKNGLWCKLKKRL  299
             L+  P+ V + TGATIHT NGL C +++R+
Sbjct  572  RLQ-DPQGVGMATGATIHTANGLKCTVERRV  601



>emb|CBJ27248.1| Cytochrome P450 [Ectocarpus siliculosus]
Length=774

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = -1

Query  712  NGDKDG-YAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWAGFDPSR  539
             G  DG   +  GTD+FIS +NLHRS   WD+P E+ PERF     +E + GW GF P  
Sbjct  550  QGGADGPVKLVKGTDVFISTWNLHRSKELWDRPAEYMPERFLSEFRNEGVVGWKGFTPKM  609

Query  538  SPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKL  359
              G LYP+EI +DFAFLPFGGG RKCVGDQFA+ME+ ++LAM+L+K D  L GTPE V +
Sbjct  610  GAG-LYPSEIDADFAFLPFGGGTRKCVGDQFAMMEATVSLAMMLKKLDFTLVGTPEDVGM  668

Query  358  VTGATIHTKNGL  323
            VTGATIHTKNGL
Sbjct  669  VTGATIHTKNGL  680



>gb|EJK63850.1| hypothetical protein THAOC_15469 [Thalassiosira oceanica]
Length=714

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LP G +G K G  +  GTDIFIS +NLHR+P +WD+P +++P R++      +I+ W 
Sbjct  534  DTLPAGGSGLKGGIKVLRGTDIFISTWNLHRAPEYWDEPEKYDPTRWERPFSNPDIKDWL  593

Query  556  GFDPSR-SPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            G++P + S   LYPNEI +DFAFLPFG G RKC+GDQFA++E+++ LAML+ KFD+ L G
Sbjct  594  GYNPEKISSQFLYPNEIAADFAFLPFGAGKRKCIGDQFAMLEASVTLAMLMNKFDLTLVG  653

Query  379  TPESVKLVTGATIHTKNGLWCKL  311
             PE V + TGATIHT NGL  K+
Sbjct  654  KPEDVGMKTGATIHTMNGLNMKV  676



>gb|EWM30289.1| cytochrome p450 [Nannochloropsis gaditana]
Length=623

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 94/132 (71%), Gaps = 5/132 (4%)
 Frame = -1

Query  688  IPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQ---VRKESEIEGWAGFDPSRSPGALYP  518
            I  G DIFIS+YNLHR P  W  PN F+PER+    + KE   E WAGFDP++  G LYP
Sbjct  474  IIRGCDIFISIYNLHRDPDLWPNPNSFDPERYLRPFINKEKYPE-WAGFDPAQVTG-LYP  531

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIH  338
            NEI SDFA LPFGGG RKCVGDQFA +E+ + LAMLL++FD D  G PE V + TGATIH
Sbjct  532  NEIASDFAMLPFGGGARKCVGDQFATLEATVTLAMLLRRFDFDFVGKPEDVGMFTGATIH  591

Query  337  TKNGLWCKLKKR  302
            T+NGL    ++R
Sbjct  592  TRNGLRMTPRRR  603



>ref|XP_005650550.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
 gb|EIE26006.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
Length=533

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 96/153 (63%), Gaps = 9/153 (6%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFIS-------VYNLHRSPYFWDKPNEFEPERF-QVRKE  578
            D LP    GD  GY I  G DIFIS         +LHRSP+ W  P+ F PERF +    
Sbjct  363  DVLPAPLGGDSSGYPIGKGADIFISSSSGTIMFQSLHRSPHLWKDPDTFRPERFSETNSN  422

Query  577  SEIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  401
                G WAG+ P     + YPNE+ SDFAF+PFGGG RKCVGDQFAL+E+ +AL MLL++
Sbjct  423  PAFNGAWAGYRPEAQGSSFYPNEVASDFAFIPFGGGARKCVGDQFALLEATVALTMLLRR  482

Query  400  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  302
            F  D    PESV + TGATIHT NGL  ++++R
Sbjct  483  FTFDFVEGPESVGMATGATIHTANGLQVRVQRR  515



>gb|AAL73435.1|AF459441_1 cytochrome P450 [Skeletonema costatum]
Length=659

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 100/139 (72%), Gaps = 2/139 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWA  557
            D LP G  G   G  +  GTDIFIS +NLHR+P +W+  ++++P R++   K   ++GW 
Sbjct  468  DTLPPGGTGLSGGVKVLRGTDIFISTWNLHRAPEYWENADKYDPTRWERPFKNPGVKGWN  527

Query  556  GFDPSR-SPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            G+DP + S  +LYPNEI SD+AFLPFG G RKC+GDQFA++E+++ L+M++ KFD  L G
Sbjct  528  GYDPEKQSSQSLYPNEITSDYAFLPFGAGKRKCIGDQFAMLEASVTLSMIMNKFDFTLVG  587

Query  379  TPESVKLVTGATIHTKNGL  323
            TPE V + TGATIHT NGL
Sbjct  588  TPEDVGMKTGATIHTMNGL  606



>ref|XP_001421212.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99505.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=560

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 4/143 (3%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES-EIEGWAGF  551
            LP G NG +    + AGTD FI+V+NLHRSP  W+ P +F+P RF  R E+  IEGW G 
Sbjct  421  LPRGGNGKE--ITLKAGTDCFIAVWNLHRSPDLWEDPEKFDPSRFSRRFENPAIEGWGGL  478

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            +P    G LYPNE  +DF+++PFGGG R+C GDQFA++E+  AL++LL+KF  +L   P 
Sbjct  479  NPELMTG-LYPNEQCTDFSYVPFGGGQRRCAGDQFAMLEAVTALSVLLKKFKFELACEPG  537

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
             V+++TGATIHTK GL  KLK+R
Sbjct  538  EVEMITGATIHTKKGLPMKLKRR  560



>emb|CEG01697.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=568

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 4/143 (3%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWAGF  551
            LP G NG +    + AGTD FI+V+NLHRSP  W+ P +F+P RF  R  +E IEGW G 
Sbjct  428  LPRGGNGKE--ITLKAGTDCFIAVWNLHRSPDLWENPEKFDPSRFSRRFTNEAIEGWGGL  485

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            +P    G LYPNE  +DF+++PFGGG R+C GDQFA++E+  +L++LL+KF  +L   P 
Sbjct  486  NPDLMTG-LYPNEQSTDFSYVPFGGGQRRCAGDQFAMLEAVTSLSVLLKKFKFELDCPPN  544

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
             V+++TGATIHTK GL  K+K+R
Sbjct  545  DVEMITGATIHTKKGLPMKIKRR  567



>gb|ACF83994.1| unknown [Zea mays]
Length=76

 Score =   139 bits (350),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = -1

Query  526  LYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGA  347
            +YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LL+KFD++L+G+P+ V++VTGA
Sbjct  1    MYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKFDVELRGSPDEVEMVTGA  60

Query  346  TIHTKNGLWCKLKKR  302
            TIHTKNGLWC+L++R
Sbjct  61   TIHTKNGLWCRLRRR  75



>ref|XP_005827896.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX40916.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=491

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 97/135 (72%), Gaps = 5/135 (4%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEG---WAGFDPSRSPGA  527
            G +I  G +IFISV+NLHR+P  WD P+ F+P R+ +R +    G   WAG+ P +  G 
Sbjct  357  GVSISPGANIFISVWNLHRNPKLWDNPDSFDPSRW-LRPQPATNGHSSWAGYTPRKDMG-  414

Query  526  LYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGA  347
            LYPNE  +++ ++PFGGG RKCVGDQFA+ E+ + L+ L Q+FDI+L G+PE V + TGA
Sbjct  415  LYPNENDANYGYIPFGGGQRKCVGDQFAMQEAVVILSKLFQRFDIELAGSPEEVGMSTGA  474

Query  346  TIHTKNGLWCKLKKR  302
            TIH+KNGL  +LKKR
Sbjct  475  TIHSKNGLMIRLKKR  489



>gb|AHA51695.1| P450-type beta-carotene hydroxylase CYP97B29 [Porphyra umbilicalis]
Length=658

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 102/148 (69%), Gaps = 8/148 (5%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPER-FQVRKESEIEGWA  557
            D LPGG  G      +  GTD+FI VY++HRSP  W++P+ F P+R  +      +EGW+
Sbjct  499  DTLPGGEIGKPTN--LKRGTDVFICVYSMHRSPALWEEPDVFNPDRWLKPFSNPGVEGWS  556

Query  556  GF---DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDL  386
            G+   DP+R+  +LYPNE+ +DFAFLPFGGG RKCVGDQFA++ES +A A L+++FD  L
Sbjct  557  GYNPPDPNRA--SLYPNEVNADFAFLPFGGGSRKCVGDQFAMLESTVAFATLVRRFDFSL  614

Query  385  KGTPESVKLVTGATIHTKNGLWCKLKKR  302
               P  V + TGATIHTK G+  +++KR
Sbjct  615  GCAPSEVGVDTGATIHTKGGMPIRVRKR  642



>ref|XP_003074608.1| cytochrome P450 (ISS) [Ostreococcus tauri]
 emb|CAL50459.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=576

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 101/143 (71%), Gaps = 4/143 (3%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWAGF  551
            LP G  GD +   I  G DIFISV+NLHRSP  W+ P EF+P RF+       ++ WAG+
Sbjct  426  LPKG-AGDAEVTLI-KGMDIFISVWNLHRSPECWENPEEFDPFRFKRPFANPGVKDWAGY  483

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            +P    G LYPNE+ SDFAF+PFG G RKC+GDQFA++E+ IA+AM+L+++D +L   P+
Sbjct  484  NPELFTG-LYPNEVASDFAFIPFGAGARKCIGDQFAMLEATIAMAMVLRRYDFELTTDPK  542

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
             + +  GATIHT+ GL C++++R
Sbjct  543  DIGMTMGATIHTEKGLPCRVRRR  565



>ref|XP_009032928.1| hypothetical protein AURANDRAFT_19592 [Aureococcus anophagefferens]
 gb|EGB11800.1| hypothetical protein AURANDRAFT_19592 [Aureococcus anophagefferens]
Length=527

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 96/138 (70%), Gaps = 9/138 (7%)
 Frame = -1

Query  688  IPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIE-GWAGFDPSR-----SPGA  527
            +P   D+FI++Y+LHR+P +W  P+ F+P+R+  +  +  E  WAG+DP++       G+
Sbjct  388  VPRACDMFIAIYSLHRNPRYWKNPDSFDPKRWLEKYANPDEPTWAGYDPAKWKAGDGMGS  447

Query  526  LYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG---TPESVKLV  356
            LYP E  +DFA+LPFGGG RKCVGDQFA+ME+ +ALA  LQ+FD D  G   TP+ V   
Sbjct  448  LYPTETSADFAYLPFGGGARKCVGDQFAMMEATVALAGFLQRFDFDFAGPTDTPDKVGTN  507

Query  355  TGATIHTKNGLWCKLKKR  302
            TGATIHT+NGLW  + +R
Sbjct  508  TGATIHTRNGLWMTVTER  525



>ref|XP_007509002.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20088.1| predicted protein [Bathycoccus prasinos]
Length=584

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 4/143 (3%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWAGF  551
            LP G  GD+D   I  G D+FISV+NLHRSP  W+ P+E++PERF+   K   ++ WAG+
Sbjct  443  LPRG-AGDRDITLI-KGMDVFISVWNLHRSPECWENPDEYDPERFKKPFKNPGVKDWAGY  500

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            +P    G LYPNEI SD+AF+PFG G RKC+GDQFA +E+ I+L M L+KF  +L+  P 
Sbjct  501  NPDLLTG-LYPNEIASDYAFIPFGAGARKCIGDQFATLEATISLVMTLRKFTFNLQKDPN  559

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
             + +  GATIHT  GL C LK R
Sbjct  560  EIGMEMGATIHTAGGLPCTLKLR  582



>ref|XP_005715216.1| cytochrome P450 family 97G-CYP97G1 [Chondrus crispus]
 emb|CDF35397.1| cytochrome P450 family 97G-CYP97G1 [Chondrus crispus]
Length=591

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 98/139 (71%), Gaps = 6/139 (4%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWAGF  551
            LP G  G  +   +P G+DIFI+VY+LHRSP  WD P  ++P+R+   K +  +EGWAG+
Sbjct  424  LPKG--GSPEVTNLPRGSDIFINVYSLHRSPALWDDPEIYDPDRWLKPKSNPGVEGWAGY  481

Query  550  DPS---RSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
             P+        LYPNE+ +DFAFLPFGGG RKCVGD FA++ES +ALAM++++FD  +  
Sbjct  482  KPASGLEEGTPLYPNEVNADFAFLPFGGGSRKCVGDHFAVLESVVALAMVIRQFDFVMVD  541

Query  379  TPESVKLVTGATIHTKNGL  323
              + V++ TGATIHTKNGL
Sbjct  542  PSKDVEMTTGATIHTKNGL  560



>ref|XP_002178724.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC49422.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
Length=769

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKESEIEGWA  557
            D LP G +  K G  +  GTD+FIS +NLHRSP  W+ P  F+P R+ +    + I GW+
Sbjct  563  DNLPAGSSDLKSGVKVLRGTDMFISTWNLHRSPDLWENPEVFDPTRWDRPFNNAGIPGWS  622

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
            G++P +  G LYP+E  +DFAFLPFGGG RKCVGDQFA+ME+ + +A++++K+D D    
Sbjct  623  GYNPDKVSG-LYPSENAADFAFLPFGGGQRKCVGDQFAMMEATVTMALMIKKYDFDFAIP  681

Query  376  PESVKLVTGATIHTKNGLWCKLKK  305
             E V + TGATIHT NGL  + ++
Sbjct  682  AEDVGMKTGATIHTMNGLMMRARQ  705



>ref|XP_002185035.1| lut1-1 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43482.1| lut1-1 [Phaeodactylum tricornutum CCAP 1055/1]
Length=538

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 100/161 (62%), Gaps = 19/161 (12%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKESEIEGW  560
            PD+LP G   +     +  G DIF++VYN+HR   FW  P+ F+P RF +     ++ GW
Sbjct  377  PDELPQGAGREA---KVIRGMDIFMAVYNIHRDERFWPSPDTFDPLRFTRSHSNPDVPGW  433

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDL--  386
            AGFDP +  G LYPNE+ SDFAFLPFGGG RKCVGD+FA++E+ + LAM+L++F+     
Sbjct  434  AGFDPKKWEGKLYPNEVASDFAFLPFGGGARKCVGDEFAILEATVTLAMVLRRFEFSFDE  493

Query  385  -------------KGTPESVKLVTGATIHTKNGLWCKLKKR  302
                         +G    V + TGATIHT+NGL   ++KR
Sbjct  494  SKFEGKDDILSSAQGLNHPVGMRTGATIHTRNGLHLVVEKR  534



>ref|XP_002185034.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC43481.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
Length=644

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 100/161 (62%), Gaps = 19/161 (12%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKESEIEGW  560
            PD+LP G   +     +  G DIF++VYN+HR   FW  P+ F+P RF +     ++ GW
Sbjct  483  PDELPQGAGREA---KVIRGMDIFMAVYNIHRDERFWPSPDTFDPLRFTRSHSNPDVPGW  539

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDL--  386
            AGFDP +  G LYPNE+ SDFAFLPFGGG RKCVGD+FA++E+ + LAM+L++F+     
Sbjct  540  AGFDPKKWEGKLYPNEVASDFAFLPFGGGARKCVGDEFAILEATVTLAMVLRRFEFSFDE  599

Query  385  -------------KGTPESVKLVTGATIHTKNGLWCKLKKR  302
                         +G    V + TGATIHT+NGL   ++KR
Sbjct  600  SKFEGKDDILSSAQGLNHPVGMRTGATIHTRNGLHLVVEKR  640



>ref|XP_005830096.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX43116.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=498

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 97/149 (65%), Gaps = 5/149 (3%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFW-DKPNEFEPER-FQVRKESEIEGW  560
            D LP  + G++    +  GTDIF+ V+NLHRSP  W D  + F P+R    R   ++ GW
Sbjct  350  DVLPLAW-GNEKQVKVFRGTDIFMLVWNLHRSPVLWGDDADAFRPDRWLSSRSNPDVPGW  408

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
             G+ P+     LYPNE+ SDFAF PFG GPRKC+GDQFA +ES + L+ +LQ+FDI L  
Sbjct  409  EGYKPNMK--NLYPNEVSSDFAFCPFGAGPRKCIGDQFAFLESVVILSRVLQEFDIQLAT  466

Query  379  TPESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +PE V + TGATIHT+ GL   L+ R +V
Sbjct  467  SPEEVGMTTGATIHTEKGLKVSLRARKNV  495



>ref|XP_002506798.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68056.1| predicted protein [Micromonas sp. RCC299]
Length=573

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 98/143 (69%), Gaps = 4/143 (3%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWAGF  551
            LP G  G +    +  GTD F++V+NLHRSP  WD+P+ F+P RF+   K  +IEGW G 
Sbjct  431  LPAGGMGRE--ITLKKGTDCFVAVWNLHRSPDLWDRPDVFDPARFKREFKNPKIEGWNGL  488

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
             P    G LYPNE  +DFA++PFGGG R+C GD FA+ME+ +AL++LL++F+ +L     
Sbjct  489  SPELVTG-LYPNEQSTDFAYVPFGGGQRRCAGDMFAMMEATVALSVLLKRFEFELGCDES  547

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
             V+++TGATIHTK G+  KL+ R
Sbjct  548  EVEMITGATIHTKAGMPVKLRSR  570



>ref|XP_001415984.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94276.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=563

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = -1

Query  679  GTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWAGFDPSRSPGALYPNEIIS  503
            G DIFISV+NLHRSP  W+ P+EF+P RF+   K   ++ WAG++P    G LYPNE+ S
Sbjct  434  GMDIFISVWNLHRSPECWENPDEFDPFRFKRPFKNPGVKDWAGYNPDLLTG-LYPNEVAS  492

Query  502  DFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGL  323
            DFAF+PFG G RKC+GDQFA++E+ IA+AM L+++D +L+  P+ + +  GATIHT  GL
Sbjct  493  DFAFIPFGAGARKCIGDQFAMLEATIAMAMTLRRYDFELQKDPKDIGMEMGATIHTAGGL  552

Query  322  WCKLKKR  302
              K+K+R
Sbjct  553  PMKIKRR  559



>ref|XP_003061074.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54724.1| predicted protein [Micromonas pusilla CCMP1545]
Length=557

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 97/143 (68%), Gaps = 4/143 (3%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWAGF  551
            LP G  G      +  GTD F++V+NLHRSP  W+ P +F+P RF+   +   +EGW G 
Sbjct  417  LPRGGMGK--AITLKKGTDCFVAVWNLHRSPDLWENPEKFDPSRFKRPFQNPAVEGWRGL  474

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
             P  + G LYPNE  +DFA++PFGGG R+C GD FA+ME+ +AL++L+++FD++L    E
Sbjct  475  QPELATG-LYPNETSTDFAYVPFGGGQRRCAGDMFAMMEATVALSVLMKRFDVELACEKE  533

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
             V+++TGATIHTK G+  KL  R
Sbjct  534  DVEMITGATIHTKAGMPVKLTPR  556



>ref|XP_007514506.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14746.1| predicted protein [Bathycoccus prasinos]
Length=591

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 98/143 (69%), Gaps = 4/143 (3%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KESEIEGWAGF  551
            LP G  G      +  GTD FI+V+NLHRSP  W+ P+ F+P R+  +    +IEGW G+
Sbjct  449  LPKGGMGK--SIQLKKGTDCFIAVWNLHRSPDHWENPDLFDPSRWDRKFTNPKIEGWNGY  506

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            DP    G LYPNE+ +D+A++PFGGG R+C GD FA+ME+ +AL++LL+KF  +L    +
Sbjct  507  DPELVTG-LYPNEVATDYAYVPFGGGQRRCAGDVFAMMEATVALSVLLKKFSFELACDEK  565

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
             V+++TGATIHTK GL  + K+R
Sbjct  566  DVQMITGATIHTKKGLPVRAKRR  588



>ref|XP_009034650.1| hypothetical protein AURANDRAFT_21944, partial [Aureococcus anophagefferens]
 gb|EGB11100.1| hypothetical protein AURANDRAFT_21944, partial [Aureococcus anophagefferens]
Length=279

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 102/163 (63%), Gaps = 20/163 (12%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKE---SEIEG  563
            D+LP  Y  D+D   I  GTD+F+S ++LH++P  WD+P  F+P R++ +KE       G
Sbjct  114  DELPQPY-ADEDRVKIARGTDVFMSTWSLHKNPALWDEPESFDPTRWERKKEPGPDAPAG  172

Query  562  WAGFDPSRSPG-ALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDID-  389
            W G+DP++ P  ALYP E  +D+AFLPFG G R+CVGDQFA++E+ + L  L+++FD + 
Sbjct  173  WRGYDPAKIPAQALYPTEQSADYAFLPFGAGNRRCVGDQFAILEATVMLTTLIREFDFEF  232

Query  388  -------------LKGTPES-VKLVTGATIHTKNGLWCKLKKR  302
                         L G P + V + TGATIHT++GLW   K R
Sbjct  233  ALDDPSTLAPKTGLGGLPVADVGMRTGATIHTEHGLWMTAKPR  275



>ref|XP_007145289.1| hypothetical protein PHAVU_007G2265000g, partial [Phaseolus vulgaris]
 gb|ESW17283.1| hypothetical protein PHAVU_007G2265000g, partial [Phaseolus vulgaris]
Length=129

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 90/146 (62%), Gaps = 26/146 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPG Y        + AG DI ISVYN+HRS   WD+  EF PERF      +++G  
Sbjct  9    PDELPGSYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFMPERF------DLDGPV  55

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ +Q  + +L   
Sbjct  56   ------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFIQHMNFELV-P  102

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
             +++ + TGATIHT NGL+ KL +RL
Sbjct  103  DQNISMTTGATIHTTNGLYMKLSQRL  128



>emb|CDY61653.1| BnaCnng38160D [Brassica napus]
Length=260

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 83/118 (70%), Gaps = 16/118 (14%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGW  560
            P+ L GGY G+++G+ +P  TDIFISV               FEP+RF   KES  IEGW
Sbjct  158  PETLNGGYKGEEEGHKVPKRTDIFISV---------------FEPDRFLRTKESNGIEGW  202

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDL  386
            AGFDPSRSPGALYPNEII+DF  LPFGGGPRKC+G+QFALMES +ALA +  +  + +
Sbjct  203  AGFDPSRSPGALYPNEIIADFQSLPFGGGPRKCIGEQFALMESTVALANVWNRLSLRI  260



>ref|XP_002293604.1| cytochrome P450 [Thalassiosira pseudonana CCMP1335]
 gb|EED89340.1| cytochrome P450 [Thalassiosira pseudonana CCMP1335]
Length=546

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 105/162 (65%), Gaps = 21/162 (13%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRK-ESEIEGWA  557
            ++LP G  G ++   I  G DIF+S+YNLH    FW +PNEF+PER++ +    E+  WA
Sbjct  386  NKLPKG--GGREATVI-RGMDIFLSLYNLHHDERFWPEPNEFKPERWESKYINPEVPEWA  442

Query  556  GFDPSRSPGA-LYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD-----  395
            G+DP++     LYPNE+ SDFA+LPFGGG RKCVGD+FA +E+ + LAMLL++F+     
Sbjct  443  GYDPAKWINTNLYPNEVASDFAYLPFGGGARKCVGDEFATLEATVTLAMLLRRFEFEFDS  502

Query  394  -------IDLKGTPE----SVKLVTGATIHTKNGLWCKLKKR  302
                   ID+   PE    +V + TGATIHT+ GL   ++KR
Sbjct  503  AKLAASKIDIMDHPEDLEHAVGMRTGATIHTRKGLHMVIRKR  544



>ref|XP_005648231.1| CYP97C3 [Coccomyxa subellipsoidea C-169]
 gb|EIE23687.1| CYP97C3 [Coccomyxa subellipsoidea C-169]
Length=540

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 92/144 (64%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGY+       +P G D+ ISVYN+HRSP  WD PN+F PERF             
Sbjct  397  DTLPGGYS-------VPVGQDVMISVYNIHRSPAVWDDPNDFRPERF-------------  436

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
              P   P    P+E  +D+ F+PF GGPRKCVGDQFALME+ +ALA+LL++FD +L    
Sbjct  437  --PLDEP---VPSEQTTDYRFIPFSGGPRKCVGDQFALMEAVVALAVLLKRFDFELV-PD  490

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT+NGL+  +++R
Sbjct  491  QDIGMTTGATIHTQNGLFMTVRER  514



>ref|XP_006391881.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
 gb|ESQ29167.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
Length=315

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 91/146 (62%), Gaps = 28/146 (19%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        + +G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  197  PDILPGNYK-------VNSGQDIMISVYNVHRSSAVWEKAEEFLPERF------ELEGA-  242

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  243  -----------IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVEL--V  289

Query  376  P-ESVKLVTGATIHTKNGLWCKLKKR  302
            P +++ + TGATIHT NGL+ K+ +R
Sbjct  290  PDQTISMTTGATIHTTNGLYMKVSRR  315



>ref|XP_011397501.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
 gb|AHA86562.1| cytochrome P450 like protein [Auxenochlorella protothecoides]
 gb|KFM24613.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
Length=567

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 18/132 (14%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            G+ +P G+DIFISV+NLHRSP  WD+P  F+P+RF +         AG  P+       P
Sbjct  429  GFRLPKGSDIFISVWNLHRSPAHWDRPEAFDPDRFDL---------AG--PT-------P  470

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIH  338
            NEI + FA+LPFGGG RKC+GDQFALMES +ALA+L ++FD+ +      V + TGATIH
Sbjct  471  NEITTGFAYLPFGGGRRKCIGDQFALMESVVALAVLARRFDVAVPPDAPEVGMTTGATIH  530

Query  337  TKNGLWCKLKKR  302
            T NGLW  ++ R
Sbjct  531  TANGLWLNVRPR  542



>gb|AGK38422.1| CYP97B2 [Parachlorella kessleri]
Length=576

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES-EIEG-W  560
            D LP G NGD +GY I  G D+FIS +NLHRSP+ W  P+ F PERF  R E+   EG W
Sbjct  445  DVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAERFENPAFEGRW  504

Query  559  AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKG  380
            AG+DP     +LYPNE+ SDFA LPFGGG RKCVGDQFA+ME+ +AL MLL++  +   G
Sbjct  505  AGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTMLLRRRRLRADG  564

Query  379  TPE  371
             P+
Sbjct  565  RPQ  567



>ref|XP_001700492.1| cytochrome P450, carotenoid hydroxylase [Chlamydomonas reinhardtii]
 gb|ABQ59244.1| CYP97A5 [Chlamydomonas reinhardtii]
 gb|EDO98047.1| cytochrome P450, carotenoid hydroxylase [Chlamydomonas reinhardtii]
Length=652

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 17/133 (13%)
 Frame = -1

Query  700  DGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALY  521
            D + +PAG+D+FISV+NLHRSP  WD+P++F+PERF               P  SP    
Sbjct  464  DQFTVPAGSDLFISVWNLHRSPKLWDEPDKFKPERF--------------GPLDSP---I  506

Query  520  PNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATI  341
            PNE+  +FA+LPFGGG RKC+GDQFAL E+ +ALAML+++++ +L  +  +V + TGATI
Sbjct  507  PNEVTENFAYLPFGGGRRKCIGDQFALFEAVVALAMLMRRYEFNLDESKGTVGMTTGATI  566

Query  340  HTKNGLWCKLKKR  302
            HT NGL   +++R
Sbjct  567  HTTNGLNMFVRRR  579



>dbj|BAD94136.1| Cytochrom P450 -like protein [Arabidopsis thaliana]
Length=301

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 90/146 (62%), Gaps = 28/146 (19%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF +          
Sbjct  183  PDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI----------  225

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                    GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  226  -------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVEL--V  275

Query  376  P-ESVKLVTGATIHTKNGLWCKLKKR  302
            P +++ + TGATIHT NGL+ K+ +R
Sbjct  276  PDQTISMTTGATIHTTNGLYMKVSQR  301



>ref|XP_003542540.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Glycine max]
Length=534

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 91/146 (62%), Gaps = 26/146 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPGGY  D       AG DI ISVYN+HRS   WD+  EF PERF      +++G  
Sbjct  414  PDELPGGYKLD-------AGQDIMISVYNIHRSSEVWDRAEEFVPERF------DLDGPV  460

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ  + +L   
Sbjct  461  ------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFLQHMNFELVPD  508

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
             +++ + TGATIHT NGL+ KL +RL
Sbjct  509  -QNISMTTGATIHTTNGLYMKLSRRL  533



>ref|XP_003537025.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Glycine 
max]
Length=537

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 91/146 (62%), Gaps = 26/146 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPGGY        + AG DI ISVYN+HRS   WD+  EF PERF      +++G  
Sbjct  417  PDELPGGYK-------LNAGQDIMISVYNIHRSSEVWDRAEEFAPERF------DLDGPV  463

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ  + +L   
Sbjct  464  ------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFLQHMNFELVPD  511

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
             ++V + TGATIHT NGL+ KL +RL
Sbjct  512  -QNVSMTTGATIHTTNGLYMKLSRRL  536



>gb|KFK34549.1| hypothetical protein AALP_AA5G160700 [Arabis alpina]
Length=542

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 90/145 (62%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  424  PDILPGNYK-------VNTGQDIMISVYNIHRSSVVWEKAEEFLPERF------ELEG--  468

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNEI +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  469  ----------AIPNEINTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  518

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  519  -QTISMTTGATIHTTNGLYMKVSQR  542



>ref|XP_002876190.1| hypothetical protein ARALYDRAFT_485688 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52449.1| hypothetical protein ARALYDRAFT_485688 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 91/146 (62%), Gaps = 28/146 (19%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG YN       +  G DI ISVYN+HRS   W+K  EF PERF +          
Sbjct  414  PDILPGNYN-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDIE---------  457

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                    GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  458  --------GAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVEL--V  506

Query  376  P-ESVKLVTGATIHTKNGLWCKLKKR  302
            P +++ + TGATIHT NGL+ K+ +R
Sbjct  507  PDQTISMTTGATIHTTNGLYMKVSQR  532



>ref|XP_006391882.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
 gb|ESQ29168.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
Length=422

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 91/146 (62%), Gaps = 28/146 (19%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        + +G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  304  PDILPGNYK-------VNSGQDIMISVYNVHRSSAVWEKAEEFLPERF------ELEGA-  349

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  350  -----------IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVEL--V  396

Query  376  P-ESVKLVTGATIHTKNGLWCKLKKR  302
            P +++ + TGATIHT NGL+ K+ +R
Sbjct  397  PDQTISMTTGATIHTTNGLYMKVSRR  422



>ref|XP_002958826.1| hypothetical protein VOLCADRAFT_100143 [Volvox carteri f. nagariensis]
 gb|EFJ40130.1| hypothetical protein VOLCADRAFT_100143 [Volvox carteri f. nagariensis]
Length=671

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 88/133 (66%), Gaps = 17/133 (13%)
 Frame = -1

Query  700  DGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALY  521
            D Y +PAG+D+FISV+NLHRSP  WD+P++F+PERF               P   P    
Sbjct  464  DQYVVPAGSDLFISVWNLHRSPELWDEPDKFKPERF--------------GPLDGP---I  506

Query  520  PNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATI  341
            PNE+  +F +LPFGGG RKC+GDQFAL E+ +ALAML++++D  L  +   V + TGATI
Sbjct  507  PNEVTENFGYLPFGGGRRKCIGDQFALFEALVALAMLVRRYDFVLDTSKPPVGMTTGATI  566

Query  340  HTKNGLWCKLKKR  302
            HT  GL+  +KKR
Sbjct  567  HTTGGLYMHVKKR  579



>gb|KHN36453.1| Carotene epsilon-monooxygenase, chloroplastic [Glycine soja]
Length=674

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 91/146 (62%), Gaps = 26/146 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPGGY        + AG DI ISVYN+HRS   WD+  EF PERF      +++G  
Sbjct  554  PDELPGGYK-------LNAGQDIMISVYNIHRSSEVWDRAEEFAPERF------DLDGPV  600

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ  + +L   
Sbjct  601  ------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFLQHMNFELVPD  648

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
             ++V + TGATIHT NGL+ KL +RL
Sbjct  649  -QNVSMTTGATIHTTNGLYMKLSRRL  673



>ref|XP_005761340.1| hypothetical protein EMIHUDRAFT_471046 [Emiliania huxleyi CCMP1516]
 gb|EOD08911.1| hypothetical protein EMIHUDRAFT_471046 [Emiliania huxleyi CCMP1516]
Length=211

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 106/173 (61%), Gaps = 28/173 (16%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES-EIEGWA  557
            DQ P G  G + G+A+    D+FIS YN+ RSP  W++P+ F+P+R+    ++  ++GWA
Sbjct  8    DQWPEGGTGVEGGFALARANDLFISTYNMGRSPQLWEEPDVFDPQRWDRPFDNPNVKGWA  67

Query  556  GFDPSRSPGA--LYPN--------EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLL  407
            G+DP++  G   + P         EI SD A +PFG G RKCVGDQFAL+E+A+++ MLL
Sbjct  68   GYDPAKRTGTGKMKPEGGLWVANLEIASDHAMIPFGAGERKCVGDQFALLEAAVSVVMLL  127

Query  406  QKFDIDL----------KGTPE-------SVKLVTGATIHTKNGLWCKLKKRL  299
            ++F+ DL          K  P+       +V +V+ ATIHT  GL+C++K+R 
Sbjct  128  RRFEFDLEMPDGPVNPAKLDPDNPDKSIGTVGMVSAATIHTATGLFCRVKERF  180



>ref|XP_004516959.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=537

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 90/146 (62%), Gaps = 26/146 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPG Y        + AG DI ISVYN+HRS   WD+  EF PERF      E++G  
Sbjct  417  PDELPGAYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFLPERF------ELDGPV  463

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L   
Sbjct  464  ------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFLQNMNFELVPN  511

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
             +++ + TGATIHT NGL+ KL +RL
Sbjct  512  -QNISMTTGATIHTTNGLYMKLNRRL  536



>ref|XP_001420992.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99285.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=495

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 87/135 (64%), Gaps = 21/135 (16%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            GY I AGTD FISV+NLHR+P  WD+P+ F+PERF               P  +P    P
Sbjct  344  GYNIDAGTDFFISVWNLHRNPRIWDEPDAFKPERF---------------PIDAP---MP  385

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE---SVKLVTGA  347
            NE   ++A+LPFGGG RKCVGDQFA+ ES ++LAML+++FD +L  +        + TGA
Sbjct  386  NEYTEEYAYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFDFELDESKHPDGECGMTTGA  445

Query  346  TIHTKNGLWCKLKKR  302
            TIHT NGL  KLK+R
Sbjct  446  TIHTTNGLHVKLKRR  460



>ref|XP_010504071.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Camelina sativa]
Length=545

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  427  PDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF------ELEG--  471

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  472  ----------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  521

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  522  -QTISMTTGATIHTTNGLYMKVSRR  545



>ref|XP_010426945.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Camelina 
sativa]
Length=544

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  426  PDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF------ELEG--  470

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  471  ----------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  520

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  521  -QTISMTTGATIHTTNGLYMKVSRR  544



>ref|XP_001422903.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP01262.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=461

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 87/135 (64%), Gaps = 21/135 (16%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            GY I AGTD FISV+NLHR+P  WD+P+ F+PERF               P  +P    P
Sbjct  345  GYNIDAGTDFFISVWNLHRNPRIWDEPDAFKPERF---------------PIDAP---MP  386

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE---SVKLVTGA  347
            NE   ++A+LPFGGG RKCVGDQFA+ ES ++LAML+++FD +L  +        + TGA
Sbjct  387  NEYTEEYAYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFDFELDESKHPDGECGMTTGA  446

Query  346  TIHTKNGLWCKLKKR  302
            TIHT NGL  KLK+R
Sbjct  447  TIHTTNGLHVKLKRR  461



>ref|XP_003058421.1| cytochrome P450 superfamily protein [Micromonas pusilla CCMP1545]
 gb|EEH56876.1| cytochrome P450 superfamily protein [Micromonas pusilla CCMP1545]
Length=702

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 88/136 (65%), Gaps = 21/136 (15%)
 Frame = -1

Query  700  DGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALY  521
            DGY I AGTD FISV+NLHR+P  W+ P++F+P+RF + ++                   
Sbjct  466  DGYKIDAGTDFFISVWNLHRNPRLWENPDKFDPDRFPIDQK------------------M  507

Query  520  PNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD--IDLKGTPE-SVKLVTG  350
            PNEI  +FA+LPFGGG RKCVGDQFAL ES I LAM+ ++FD  +D K  P+    + TG
Sbjct  508  PNEITENFAYLPFGGGQRKCVGDQFALFESIITLAMVCRRFDFELDAKFHPDGECGMTTG  567

Query  349  ATIHTKNGLWCKLKKR  302
            ATIHT  GL  KLK+R
Sbjct  568  ATIHTTGGLHVKLKRR  583



>ref|XP_005826161.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX39181.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=637

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 98/168 (58%), Gaps = 26/168 (15%)
 Frame = -1

Query  733  DQLPGGYNGDK----DGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQ--------  590
            D LP   N D     +   I  G+D F+SV+NLHRSP  WDKP+EF+P+R++        
Sbjct  470  DVLPKASNLDGSVQGNAVKIIKGSDFFLSVWNLHRSPLLWDKPDEFDPDRWRRPTPPELV  529

Query  589  -----VRKESEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAI  425
                  R+   +  W G+ P      LYPNE+ +D+AFLPFG GPRKC+GDQFALMES +
Sbjct  530  EKYNAQRRAEGLPEWQGYVPDLK--TLYPNEVHADYAFLPFGAGPRKCLGDQFALMESVV  587

Query  424  ALAMLLQKFDIDLKGTPE-------SVKLVTGATIHTKNGLWCKLKKR  302
             L  + Q++  +L G  +        V ++ GATIHT NGL  ++K+R
Sbjct  588  MLTKIFQRYSFELVGNHDPKVPNESDVGMMFGATIHTANGLNVRVKRR  635



>ref|XP_010515801.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Camelina sativa]
Length=545

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  427  PDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF------ELEG--  471

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  472  ----------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  521

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  522  -QTISMTTGATIHTTNGLYMKVSRR  545



>ref|XP_003574294.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Brachypodium 
distachyon]
Length=550

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      ++EG   
Sbjct  419  DVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFVPERF------DLEGPV-  464

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQK DI L    
Sbjct  465  -----------PNESNTDFRFVPFSGGPRKCVGDQFALLEAIVALAVVLQKIDIQLVADQ  513

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            E + + TGATIHT NGL+  +  R
Sbjct  514  E-INMTTGATIHTTNGLYMNVSLR  536



>gb|AGN27239.1| CYP97A1 [Parachlorella kessleri]
Length=647

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 84/135 (62%), Gaps = 17/135 (13%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            G+ I  G DIFI+ +NLHRSP  WD+P+EF+P+RF       +EG A            P
Sbjct  465  GFEIQEGQDIFIATWNLHRSPQLWDRPDEFDPDRF-----GPLEGPA------------P  507

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIH  338
            NE+  DF +LPFGGG RKC+GDQFA+ ES  ALAML+++FD         V + TGATIH
Sbjct  508  NEVTEDFKYLPFGGGKRKCIGDQFAIFESVTALAMLVRRFDFAFAPDAPPVSMTTGATIH  567

Query  337  TKNGLWCKLKKRLDV  293
            T NGLW   K R D+
Sbjct  568  TTNGLWLCPKPRADL  582



>ref|XP_009125249.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Brassica 
rapa]
Length=533

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  415  PDVLPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF------ELEG--  459

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  460  ----------PIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  509

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  510  -QTISMTTGATIHTTNGLYMKVSQR  533



>gb|EJK46027.1| hypothetical protein THAOC_35331 [Thalassiosira oceanica]
Length=472

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 90/147 (61%), Gaps = 21/147 (14%)
 Frame = -1

Query  679  GTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES---EIEGWAGFDPSR--SPGALYPN  515
            G D+FIS+YNLHR   FW +P+EF PER++ +      ++  W G+DP R  +   LYPN
Sbjct  324  GMDMFISLYNLHRDERFWPQPDEFIPERWETKYRYVNPDVPEWGGYDPDRWMNTNFLYPN  383

Query  514  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDL----------------K  383
            E+ SDFA+LPFGGG RKCVGD+FA +E+ + LAM+L++F  D                 K
Sbjct  384  EVASDFAYLPFGGGARKCVGDEFATLEATVTLAMVLRRFSFDFDQAKLAETSMSVHEHPK  443

Query  382  GTPESVKLVTGATIHTKNGLWCKLKKR  302
                 V + TGATIHT+ GL   +KKR
Sbjct  444  NLEHPVGMKTGATIHTRKGLHMIVKKR  470



>gb|ACO53105.1| epsilon carotene hydroxylase [Actinidia chinensis]
Length=208

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        + AG DI ISVYN+H S   W++  EF PERF +          
Sbjct  78   PDVLPGNYK-------VNAGQDIMISVYNIHHSAQVWERAEEFVPERFDLD---------  121

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
              DP        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ  + +L   
Sbjct  122  --DP-------VPNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFLQHMNFELVPD  172

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  173  -QNISMTTGATIHTTNGLYMKVSQR  196



>ref|NP_190881.2| carotene epsilon-monooxygenase [Arabidopsis thaliana]
 sp|Q6TBX7.1|LUT1_ARATH RecName: Full=Carotene epsilon-monooxygenase, chloroplastic; 
AltName: Full=Cytochrome P450 97C1; AltName: Full=Protein LUTEIN 
DEFICIENT 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAR83120.1| chloroplast carotenoid epsilon-ring hydroxylase [Arabidopsis 
thaliana]
 gb|AEE79040.1| carotene epsilon-monooxygenase [Arabidopsis thaliana]
Length=539

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF +          
Sbjct  421  PDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI----------  463

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                    GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  464  -------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  515

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  516  -QTISMTTGATIHTTNGLYMKVSQR  539



>gb|AAM13903.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=552

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 90/146 (62%), Gaps = 28/146 (19%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF +          
Sbjct  434  PDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI----------  476

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                    GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  477  -------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVEL--V  526

Query  376  P-ESVKLVTGATIHTKNGLWCKLKKR  302
            P +++ + TGATIHT NGL+ K+ +R
Sbjct  527  PDQTISMTTGATIHTTNGLYMKVSQR  552



>emb|CDY13314.1| BnaC06g14430D [Brassica napus]
Length=533

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  415  PDILPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF------ELEG--  459

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  460  ----------PIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  509

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  510  -QTISMTTGATIHTTNGLYMKVSQR  533



>emb|CDX67558.1| BnaA07g15980D [Brassica napus]
Length=546

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  428  PDILPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF------ELEG--  472

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  473  ----------PIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  522

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  523  -QTISMTTGATIHTTNGLYMKVSQR  546



>emb|CDP15310.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 26/146 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPGGY        +  G D+ ISVYN+H SP  W++  +F PERF      E+EG  
Sbjct  355  PDVLPGGYK-------VNTGQDVMISVYNIHHSPQVWERAEDFVPERF------ELEGPV  401

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQ  + +L   
Sbjct  402  ------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVILQHLNFELI-P  448

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
             +++ + TGATIHT NGL+ K+ +RL
Sbjct  449  DQNISMTTGATIHTTNGLYMKVSQRL  474



>gb|AID51468.1| epsilon-ring carotene hydroxylase [Cucumis melo var. makuwa]
Length=148

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  18   DTLPGNYK-------VNAGQDIMISVYNIHRSLQVWEQAEEFIPERF------DLEGPV-  63

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L    
Sbjct  64   -----------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHLNFELVPN-  111

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  112  QTIGMTTGATIHTTNGLYMKLSQR  135



>emb|CAB64216.1| Cytochrom P450-like protein [Arabidopsis thaliana]
Length=566

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF +          
Sbjct  448  PDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI----------  490

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                    GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++L   
Sbjct  491  -------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPD  542

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  543  -QTISMTTGATIHTTNGLYMKVSQR  566



>gb|AFP65826.1| carotene epsilon-ring hydroxylase, partial [Eriobotrya japonica]
Length=246

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  113  DVLPGNYK-------VNAGPDIMISVYNIHRSSKVWERAEEFVPERF------DLEGSV-  158

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  + +L    
Sbjct  159  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFIQNLNFELV-LD  206

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ KL +R
Sbjct  207  QKISMTTGATIHTTNGLYMKLSQR  230



>emb|CEG00185.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=534

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 85/135 (63%), Gaps = 21/135 (16%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            GY I AGTD FISV+NLHR+P  W +P+ F+PERF               P   P    P
Sbjct  347  GYNIDAGTDFFISVWNLHRNPRIWPEPDAFKPERF---------------PIEGP---MP  388

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE---SVKLVTGA  347
            NE   D+A+LPFGGG RKCVGDQFA+ ES ++LAML+++FD +L  +        + TGA
Sbjct  389  NEYTEDYAYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFDFELDESKHPDGECGMTTGA  448

Query  346  TIHTKNGLWCKLKKR  302
            TIHT NGL  +LK+R
Sbjct  449  TIHTTNGLHVRLKRR  463



>gb|AGI61105.1| carotenoid hydroxylase [Parachlorella kessleri]
Length=647

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 83/135 (61%), Gaps = 17/135 (13%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            G+ I  G DIFI+ +NLHRSP  WD+P+EF+P+RF       +EG A            P
Sbjct  465  GFEIQEGQDIFIATWNLHRSPQLWDRPDEFDPDRF-----GPLEGPA------------P  507

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIH  338
            NE+  DF  LPFGGG RKC+GDQFA+ ES  ALAML+++FD         V + TGATIH
Sbjct  508  NEVTEDFKCLPFGGGKRKCIGDQFAIFESVTALAMLVRRFDFAFAPDAPPVSMTTGATIH  567

Query  337  TKNGLWCKLKKRLDV  293
            T NGLW   K R D+
Sbjct  568  TTNGLWLCPKPRADL  582



>ref|XP_002506759.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68017.1| predicted protein [Micromonas sp. RCC299]
Length=538

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 95/143 (66%), Gaps = 4/143 (3%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWAGF  551
            LP G  GD +   I  G D+FISV+NLHR P  W++P +F+P RF+   ++  ++ WAG+
Sbjct  399  LPKG-AGDANVTLI-KGMDVFISVWNLHRHPDCWEEPLKFDPTRFKRPFQNPGVKDWAGY  456

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE  371
            +P    G LYPNE+ SDFAF+PFG G RKC+GDQFA++E+   LAM L+++D ++     
Sbjct  457  NPDLISG-LYPNEVTSDFAFIPFGAGARKCIGDQFAMLEATSCLAMTLRRYDFEMTKDAS  515

Query  370  SVKLVTGATIHTKNGLWCKLKKR  302
             V +  GATIHT  GL  K+ +R
Sbjct  516  EVGMEMGATIHTAGGLPMKVTRR  538



>ref|XP_004983762.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Setaria italica]
Length=550

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      ++EG   
Sbjct  421  DVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF------DLEGPV-  466

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQK DI L    
Sbjct  467  -----------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVLQKMDIQLVPD-  514

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  +  R
Sbjct  515  QKINMTTGATIHTTNGLYMNVSLR  538



>ref|XP_004983761.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Setaria italica]
Length=553

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      ++EG   
Sbjct  421  DVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF------DLEGPV-  466

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQK DI L    
Sbjct  467  -----------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVLQKMDIQLVPD-  514

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  +  R
Sbjct  515  QKINMTTGATIHTTNGLYMNVSLR  538



>ref|XP_003082726.1| probable cytochrome P450 (ISS) [Ostreococcus tauri]
Length=643

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 85/135 (63%), Gaps = 21/135 (16%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            GY I AGTD FISV+NLHR+P  W +P+ F+PERF               P   P    P
Sbjct  456  GYNIDAGTDFFISVWNLHRNPRIWPEPDAFKPERF---------------PIEGP---MP  497

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPE---SVKLVTGA  347
            NE   D+A+LPFGGG RKCVGDQFA+ ES ++LAML+++FD +L  +        + TGA
Sbjct  498  NEYTEDYAYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFDFELDESKHPDGECGMTTGA  557

Query  346  TIHTKNGLWCKLKKR  302
            TIHT NGL  +LK+R
Sbjct  558  TIHTTNGLHVRLKRR  572



>ref|XP_005779653.1| hypothetical protein EMIHUDRAFT_463287 [Emiliania huxleyi CCMP1516]
 gb|EOD27224.1| hypothetical protein EMIHUDRAFT_463287 [Emiliania huxleyi CCMP1516]
Length=617

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 107/173 (62%), Gaps = 28/173 (16%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES-EIEGWA  557
            DQ P G  G + G+A+    D+FIS YN+ RSP  W++P+ F+P+R+    ++ +++GWA
Sbjct  414  DQWPEGGTGVEGGFALARANDLFISTYNMGRSPQLWEEPDVFDPQRWDRPFDNPDVKGWA  473

Query  556  GFDPSRSPGA--LYPN--------EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLL  407
            G+DP++  G   + P         EI SD A +PFG G RKCVGDQFAL+E+A+++ MLL
Sbjct  474  GYDPAKRTGTGKMKPEGGLWVANLEIASDHAMIPFGAGERKCVGDQFALLEAAVSVVMLL  533

Query  406  QKFDIDL----------KGTPE-------SVKLVTGATIHTKNGLWCKLKKRL  299
            ++F+ DL          K  P+       +V +V+ ATIHT  GL+C++K+R 
Sbjct  534  RRFEFDLEMPDGPVNPAKLDPDNPDKSIGTVGMVSAATIHTATGLFCRVKERF  586



>ref|XP_006403722.1| hypothetical protein EUTSA_v10010267mg [Eutrema salsugineum]
 gb|ESQ45175.1| hypothetical protein EUTSA_v10010267mg [Eutrema salsugineum]
Length=546

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      E+EG  
Sbjct  427  PDILPGNYK-------VNPGQDIMISVYNVHRSSAVWEKAEEFLPERF------ELEG--  471

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFA+ME+ +ALA+ LQ+ +++L   
Sbjct  472  ----------PIPNETNTDFKFIPFSGGPRKCVGDQFAMMEAIVALAVFLQRLNVELVPD  521

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ K+ +R
Sbjct  522  -QTISMTTGATIHTTNGLYMKVSQR  545



>ref|XP_006339098.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=388

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   WD+  EF+PERF      ++EG   
Sbjct  261  DVLPGNYK-------VNAGQDIMISVYNIHHSSEVWDRAEEFDPERF------DLEGPV-  306

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ I LA+ +Q F  +L    
Sbjct  307  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATITLAIFVQNFSFELIP-D  354

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ K+K+R
Sbjct  355  QTISMTTGATIHTTNGLYMKVKQR  378



>gb|EMS57747.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=528

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+HRSP  WD+ +EF PERF      ++EG   
Sbjct  374  DVLPGNYK-------VKTGQDIMISVYNIHRSPEVWDRADEFIPERF------DLEG---  417

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+++QK DI L    
Sbjct  418  ------P---IPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVIQKVDIQLVA-D  467

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  +  R
Sbjct  468  QKISMTTGATIHTTNGLYMNVSLR  491



>ref|XP_003590442.1| Cytochrome P450 monooxygenase CYP97C10 [Medicago truncatula]
 gb|AES60693.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=541

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 89/146 (61%), Gaps = 26/146 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPG Y  D       AG DI ISVYN+H S   WD+  EF PERF      +++G  
Sbjct  421  PDELPGDYKID-------AGQDIMISVYNIHHSSKVWDRAEEFLPERF------DLDGPV  467

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L   
Sbjct  468  ------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFLQHMNFELVPD  515

Query  376  PESVKLVTGATIHTKNGLWCKLKKRL  299
             +++ + TGATIHT NGL+ KL +RL
Sbjct  516  -QNIGMTTGATIHTTNGLYMKLSQRL  540



>ref|XP_006662027.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Oryza brachyantha]
Length=565

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 89/144 (62%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        I AG DI ISVYN+HRSP  WD+ +EF PERF      ++EG   
Sbjct  434  DVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADEFIPERF------DLEGPV-  479

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +++ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK DI+L    
Sbjct  480  -----------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAIVLQKIDIELVPD-  527

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  +  R
Sbjct  528  QKINMTTGATIHTTNGLYMNVGLR  551



>ref|XP_010241652.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=555

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  427  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFVPERF------DLEGPV-  472

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ FD DL    
Sbjct  473  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHFDFDLVPD-  520

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ KL +R
Sbjct  521  QKISMTTGATIHTTNGLYMKLSQR  544



>dbj|BAJ87296.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+HRSP  WD+ +EF PERF      ++EG   
Sbjct  414  DVLPGNYK-------VKTGQDIMISVYNIHRSPEVWDRADEFIPERF------DLEGP--  458

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+++QK D+ L    
Sbjct  459  ----------IPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVIQKMDVQLVAD-  507

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  +  R
Sbjct  508  QKISMTTGATIHTTNGLYMNVSLR  531



>ref|XP_005849069.1| hypothetical protein CHLNCDRAFT_51247 [Chlorella variabilis]
 gb|EFN56967.1| hypothetical protein CHLNCDRAFT_51247 [Chlorella variabilis]
Length=577

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 90/145 (62%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPGG         +P G D+ ISVYN+HRSP  WD+P++F PERF            
Sbjct  435  PDELPGGLT-------VPQGQDVMISVYNIHRSPAVWDRPDDFLPERF------------  475

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
               P   P    PNE  +D+ ++PF GGPRKCVGDQFALME+ +ALA+++++FD   +  
Sbjct  476  ---PLDGP---VPNEQNTDYKYIPFSGGPRKCVGDQFALMEAVVALAVMIREFDFAPQPG  529

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +   + TGATIHTKNGL+  + KR
Sbjct  530  HDP-GMTTGATIHTKNGLYMTVAKR  553



>ref|XP_002503315.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64573.1| predicted protein [Micromonas sp. RCC299]
Length=693

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 85/136 (63%), Gaps = 21/136 (15%)
 Frame = -1

Query  700  DGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALY  521
            DGY I  GTD FISV+NLHR+P  W +P++F PERF + ++                   
Sbjct  467  DGYKIETGTDFFISVWNLHRNPRLWPEPDKFIPERFPLDQK------------------M  508

Query  520  PNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT--PE-SVKLVTG  350
            PNE+  +FA+LPFGGG RKCVGDQFAL ES I LAM+ ++FDIDL     P+    + TG
Sbjct  509  PNEVTENFAYLPFGGGQRKCVGDQFALFESIITLAMVCRRFDIDLDPAFHPDGECGMTTG  568

Query  349  ATIHTKNGLWCKLKKR  302
            ATIHT  GL  KL +R
Sbjct  569  ATIHTTGGLHVKLTRR  584



>ref|XP_009623194.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=386

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF             
Sbjct  261  DVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERFD------------  301

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
               S  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ F  +L    
Sbjct  302  ---SEGP---VPNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNFSFELIP-D  354

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ K+K+R
Sbjct  355  QNISMTTGATIHTTNGLYMKVKQR  378



>ref|NP_001065217.1| Os10g0546600 [Oryza sativa Japonica Group]
 gb|ABB47954.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27131.1| Os10g0546600 [Oryza sativa Japonica Group]
 dbj|BAG89623.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51348.1| hypothetical protein OsJ_32354 [Oryza sativa Japonica Group]
Length=561

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 89/144 (62%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        I AG DI ISVYN+HRSP  WD+ ++F PERF      ++EG   
Sbjct  430  DVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADDFIPERF------DLEGPV-  475

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +++ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK DI+L    
Sbjct  476  -----------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMDIELVPD-  523

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  +  R
Sbjct  524  QKINMTTGATIHTTNGLYMNVSLR  547



>ref|XP_008462512.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Cucumis 
melo]
Length=558

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  W++  EF PERF      ++EG   
Sbjct  428  DTLPGNYK-------VNAGQDIMISVYNIHRSPQVWEQAEEFIPERF------DLEGPV-  473

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L    
Sbjct  474  -----------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHLNFELVPN-  521

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  522  QTIGMTTGATIHTTNGLYMKLSQR  545



>ref|XP_010241651.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=580

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  427  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFVPERF------DLEGPV-  472

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ FD DL    
Sbjct  473  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHFDFDLVPD-  520

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ KL +R
Sbjct  521  QKISMTTGATIHTTNGLYMKLSQR  544



>ref|XP_008807069.1| PREDICTED: LOW QUALITY PROTEIN: carotene epsilon-monooxygenase, 
chloroplastic [Phoenix dactylifera]
Length=552

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 88/145 (61%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  WD+  EF PERF      ++EG   
Sbjct  426  DILPGDYK-------VNAGQDIMISVYNIHRSPQVWDRAEEFLPERF------DLEGPV-  471

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  D+D +  P
Sbjct  472  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQ--DMDFRLVP  518

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+  L  R
Sbjct  519  DQNITMTTGATIHTVNGLYMTLSPR  543



>ref|NP_001234058.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
 gb|ACJ25967.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
 gb|ACJ25968.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
Length=547

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 88/147 (60%), Gaps = 26/147 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+H S   WD+  EF+PERF      ++EG   
Sbjct  420  DVLPGNYK-------VNVGQDIMISVYNIHHSSEVWDRAEEFDPERF------DLEGPV-  465

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ IALA+ +Q F  +L    
Sbjct  466  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATIALAIFVQNFSFELIPD-  513

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +++ + TGATIHT NGL+ K+K+R  V
Sbjct  514  QTISMTTGATIHTTNGLYMKVKQREKV  540



>ref|XP_006339097.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=551

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 88/147 (60%), Gaps = 26/147 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   WD+  EF+PERF      ++EG   
Sbjct  424  DVLPGNYK-------VNAGQDIMISVYNIHHSSEVWDRAEEFDPERF------DLEGPV-  469

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ I LA+ +Q F  +L    
Sbjct  470  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATITLAIFVQNFSFELIPD-  517

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDV  293
            +++ + TGATIHT NGL+ K+K+R  V
Sbjct  518  QTISMTTGATIHTTNGLYMKVKQREKV  544



>ref|XP_011094564.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Sesamum 
indicum]
 ref|XP_011094565.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Sesamum 
indicum]
Length=542

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++ +EF PERF      ++EG   
Sbjct  414  DVLPGNYK-------VNAGQDIMISVYNIHHSAQVWERADEFVPERF------DLEGPV-  459

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  SD+ F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ    DL    
Sbjct  460  -----------PNETNSDYRFIPFSGGPRKCVGDQFALLEAIVALAVLLQHLSFDLVPN-  507

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  508  QNISMTTGATIHTTNGLYMKLTER  531



>ref|XP_006491796.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=498

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  370  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------DLEG---  413

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  + +L   P
Sbjct  414  ------P---MPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFEL--VP  462

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL++R
Sbjct  463  DQNINMTTGATIHTTNGLYMKLRQR  487



>ref|XP_008658121.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Zea 
mays]
 gb|ADD14593.1| carotene epsilon-ring hydroxylase [Zea mays subsp. mays]
 gb|AFP28223.1| carotene epsilon-ring hydroxylase [synthetic construct]
Length=556

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      ++EG   
Sbjct  425  DVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF------DLEGPV-  470

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D+ L    
Sbjct  471  -----------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMDMQLV-PD  518

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT +GL+  +  R
Sbjct  519  QKINMTTGATIHTTSGLYMNVSLR  542



>gb|AIX87504.1| P450 carotenoid epsilon-ring hydroxylase [Lycium barbarum]
Length=547

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF      ++EG   
Sbjct  420  DVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF------DLEGPV-  465

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ F  +L    
Sbjct  466  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNFSFELIPD-  513

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ K+K+R
Sbjct  514  QNISMTTGATIHTTNGLYMKVKQR  537



>gb|AIX87528.1| P450 carotenoid epsilon-ring hydroxylase [Lycium ruthenicum]
Length=546

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF      ++EG   
Sbjct  419  DVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF------DLEGPV-  464

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ F  +L    
Sbjct  465  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNFSFELIPD-  512

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ K+K+R
Sbjct  513  QNISMTTGATIHTTNGLYMKVKQR  536



>ref|XP_006428525.1| hypothetical protein CICLE_v10011420mg [Citrus clementina]
 ref|XP_006491795.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR41765.1| hypothetical protein CICLE_v10011420mg [Citrus clementina]
Length=545

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  417  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------DLEG---  460

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  + +L   P
Sbjct  461  ------P---MPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFEL--VP  509

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL++R
Sbjct  510  DQNINMTTGATIHTTNGLYMKLRQR  534



>ref|XP_010098846.1| Carotene epsilon-monooxygenase [Morus notabilis]
 gb|EXB75934.1| Carotene epsilon-monooxygenase [Morus notabilis]
Length=634

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 88/145 (61%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  426  DKLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF------DMEGPV-  471

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+ES +ALA+ LQ F  +L   P
Sbjct  472  -----------PNESNTDFRFIPFSGGPRKCVGDQFALLESIVALAIFLQHFTFEL--VP  518

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL  R
Sbjct  519  DQNIGMTTGATIHTTNGLYMKLSSR  543



>gb|KDO54336.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=498

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  370  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------DLEG---  413

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  + +L   P
Sbjct  414  ------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFEL--VP  462

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL++R
Sbjct  463  DQNINMTTGATIHTTNGLYMKLRQR  487



>gb|ABQ59243.1| CYP97C3 [Chlamydomonas reinhardtii]
Length=576

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (60%), Gaps = 25/144 (17%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPGG+        +P G D+ ISVYN+H SP  WD P  F PERF             
Sbjct  439  DELPGGFK-------VPVGQDVMISVYNIHHSPAVWDDPEAFIPERF-------------  478

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
              P   P    PNE  +DF ++PF GGPRKCVGDQFALME+ +AL +LL+++D  +    
Sbjct  479  -GPLDGP---VPNEQNTDFRYIPFSGGPRKCVGDQFALMEAVVALTVLLRQYDFQMVPN-  533

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  +K+R
Sbjct  534  QQIGMTTGATIHTTNGLYMYVKER  557



>ref|XP_009623193.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=544

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF             
Sbjct  419  DVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERFD------------  459

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
               S  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ F  +L    
Sbjct  460  ---SEGP---VPNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNFSFELIPD-  512

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ K+K+R
Sbjct  513  QNISMTTGATIHTTNGLYMKVKQR  536



>gb|AAK20054.1|AC025783_14 putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
Length=584

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 89/142 (63%), Gaps = 28/142 (20%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        I AG DI ISVYN+HRSP  WD+ ++F PERF      ++EG   
Sbjct  430  DVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADDFIPERF------DLEGPV-  475

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +++ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK DI+L   P
Sbjct  476  -----------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMDIEL--VP  522

Query  373  -ESVKLVTGATIHTKNGLWCKL  311
             + + + TGATIHT NGL+  +
Sbjct  523  DQKINMTTGATIHTTNGLYMNV  544



>gb|ACU20919.1| unknown [Glycine max]
Length=105

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 19/123 (15%)
 Frame = -1

Query  667  FISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYPNEIISDFAFL  488
             ISVYN+HRS   WD+  EF PERF      +++G              PNE  +DF F+
Sbjct  1    MISVYNIHRSSEVWDRAEEFAPERF------DLDGPV------------PNETNTDFRFI  42

Query  487  PFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLK  308
            PF GGPRKCVGDQFALME+ +ALA+ LQ  + +L    ++V + TGATIHT NGL+ KL 
Sbjct  43   PFSGGPRKCVGDQFALMEAIVALAIFLQHMNFELV-PDQNVSMTTGATIHTTNGLYMKLS  101

Query  307  KRL  299
            +RL
Sbjct  102  RRL  104



>gb|KDO54337.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=511

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  383  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------DLEGP--  427

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  + +L    
Sbjct  428  ----------MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFELVPD-  476

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL++R
Sbjct  477  QNINMTTGATIHTTNGLYMKLRQR  500



>gb|KDO54334.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=561

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  433  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------DLEG---  476

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  + +L   P
Sbjct  477  ------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFEL--VP  525

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL++R
Sbjct  526  DQNINMTTGATIHTTNGLYMKLRQR  550



>gb|KDO54333.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=544

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  416  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------DLEG---  459

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  + +L   P
Sbjct  460  ------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFEL--VP  508

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL++R
Sbjct  509  DQNINMTTGATIHTTNGLYMKLRQR  533



>gb|KDO54335.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=545

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  417  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------DLEG---  460

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  + +L   P
Sbjct  461  ------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFEL--VP  509

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL++R
Sbjct  510  DQNINMTTGATIHTTNGLYMKLRQR  534



>gb|EEC67393.1| hypothetical protein OsI_34547 [Oryza sativa Indica Group]
Length=557

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 88/144 (61%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        I AG DI ISVYN+HRS   WD+ ++F PERF      ++EG   
Sbjct  426  DVLPGNYK-------IKAGQDIMISVYNIHRSSEVWDRADDFIPERF------DLEGPV-  471

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +++ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK DI+L    
Sbjct  472  -----------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMDIELV-PD  519

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  +  R
Sbjct  520  QKINMTTGATIHTTNGLYMNVSLR  543



>ref|XP_009382395.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=561

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  W+K  EF PERF       +EG   
Sbjct  430  DVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN------LEGP--  474

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L    
Sbjct  475  ----------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMEFELVAD-  523

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  L  R
Sbjct  524  QKISMTTGATIHTTNGLYMTLSPR  547



>ref|XP_009382396.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=561

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  W+K  EF PERF       +EG   
Sbjct  430  DVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN------LEGP--  474

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L    
Sbjct  475  ----------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMEFELVAD-  523

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  L  R
Sbjct  524  QKISMTTGATIHTTNGLYMTLSPR  547



>ref|XP_009382394.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=563

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  W+K  EF PERF       +EG   
Sbjct  430  DVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN------LEGP--  474

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L    
Sbjct  475  ----------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMEFELVAD-  523

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+  L  R
Sbjct  524  QKISMTTGATIHTTNGLYMTLSPR  547



>gb|KHG23674.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=510

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 89/146 (61%), Gaps = 28/146 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +  ES +     
Sbjct  383  DVLPGDYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDL--ESSV-----  428

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ+ + +L   P
Sbjct  429  -----------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFLQRLNFEL--VP  475

Query  373  -ESVKLVTGATIHTKNGLWCKLKKRL  299
             +++ + TGATIHT NGL+ KL +R+
Sbjct  476  DQNISMTTGATIHTTNGLYMKLSQRM  501



>ref|XP_009375781.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009375782.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=545

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 86/145 (59%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  416  DVLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF------DLEGSV-  461

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +AL + +Q  + +L   P
Sbjct  462  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALTIFIQNLNFEL--VP  508

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             + + + TGATIHT NGL+ KL +R
Sbjct  509  DQKISMTTGATIHTTNGLYMKLSQR  533



>ref|XP_002519427.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF42841.1| cytochrome P450, putative [Ricinus communis]
Length=552

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 85/144 (59%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   WD+  EF PERF      ++EG   
Sbjct  423  DVLPGNYK-------VNAGQDIMISVYNIHHSSKVWDRAEEFVPERF------DLEGPV-  468

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L    
Sbjct  469  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQNMNFELVPD-  516

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ KL KR
Sbjct  517  QKISMTTGATIHTTNGLYMKLGKR  540



>gb|KJB46498.1| hypothetical protein B456_007G372200 [Gossypium raimondii]
Length=548

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 89/146 (61%), Gaps = 28/146 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +  ES +     
Sbjct  421  DVLPGDYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDL--ESSV-----  466

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ+ + +L   P
Sbjct  467  -----------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFLQRLNFEL--VP  513

Query  373  -ESVKLVTGATIHTKNGLWCKLKKRL  299
             +++ + TGATIHT NGL+ KL +R+
Sbjct  514  DQNISMTTGATIHTTNGLYMKLSQRM  539



>ref|XP_009757367.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Nicotiana 
sylvestris]
Length=544

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF      ++EG   
Sbjct  419  DVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF------DLEGPV-  464

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ    +L    
Sbjct  465  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNLSFELIPD-  512

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ K+K+R
Sbjct  513  QNISMTTGATIHTTNGLYMKVKQR  536



>ref|XP_002467549.1| hypothetical protein SORBIDRAFT_01g030050 [Sorghum bicolor]
 gb|EER94547.1| hypothetical protein SORBIDRAFT_01g030050 [Sorghum bicolor]
Length=538

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 85/137 (62%), Gaps = 26/137 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      ++EG   
Sbjct  424  DVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF------DLEGPV-  469

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK DI L    
Sbjct  470  -----------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKIDIQLVPD-  517

Query  373  ESVKLVTGATIHTKNGL  323
            + + + TGATIHT NG+
Sbjct  518  QKINMTTGATIHTTNGI  534



>ref|XP_007027524.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY08026.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
Length=369

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 85/144 (59%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +           
Sbjct  239  DILPGNYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDLE----------  281

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                 SP    PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ+ + +L    
Sbjct  282  -----SP---VPNETNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFLQRLNFEL-VPD  332

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NG++ KL +R
Sbjct  333  QDISMTTGATIHTTNGMYMKLSER  356



>ref|XP_008392557.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Malus 
domestica]
Length=549

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 85/144 (59%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  416  DVLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF------DLEGSV-  461

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +AL + +Q  + +L    
Sbjct  462  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALTIFIQNLNFELVPD-  509

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ KL +R
Sbjct  510  QKISMTTGATIHTTNGLYMKLSQR  533



>ref|XP_010907646.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X4 [Elaeis guineensis]
Length=483

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + A  DI ISVYN+HRSP  WD+  EF PERF      ++EG   
Sbjct  357  DILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF------DLEGPV-  402

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  D  L    
Sbjct  403  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMDFRLVPD-  450

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+  L  R
Sbjct  451  QNIAMTTGATIHTMNGLYMTLSPR  474



>ref|XP_004156328.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Cucumis sativus]
Length=512

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  382  DILPGDYK-------VNAGQDIMISVYNIHRSSQVWEQAEEFIPERF------DLEGPV-  427

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L    
Sbjct  428  -----------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMNFELVPN-  475

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  476  QTIGMTTGATIHTTNGLYMKLSQR  499



>ref|XP_010907645.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X3 [Elaeis guineensis]
Length=542

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + A  DI ISVYN+HRSP  WD+  EF PERF      ++EG   
Sbjct  416  DILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF------DLEGPV-  461

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  D  L    
Sbjct  462  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMDFRLVPD-  509

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+  L  R
Sbjct  510  QNIAMTTGATIHTMNGLYMTLSPR  533



>ref|XP_006833028.1| hypothetical protein AMTR_s00094p00105890 [Amborella trichopoda]
 gb|ERM98306.1| hypothetical protein AMTR_s00094p00105890 [Amborella trichopoda]
Length=80

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -1

Query  514  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  335
            +IISDFAFLPFGGGPRKC+GDQFALMES IALA+LL +FD +L+  PE ++ VT ATIHT
Sbjct  3    QIISDFAFLPFGGGPRKCLGDQFALMESTIALALLLHRFDAELRYPPEYMEAVTEATIHT  62

Query  334  KNGLWCKLKKR  302
            K+GLWCKL+KR
Sbjct  63   KDGLWCKLRKR  73



>ref|XP_010907643.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=549

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + A  DI ISVYN+HRSP  WD+  EF PERF      ++EG   
Sbjct  423  DILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF------DLEGPV-  468

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  D  L    
Sbjct  469  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMDFRLVPD-  516

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+  L  R
Sbjct  517  QNIAMTTGATIHTMNGLYMTLSPR  540



>ref|XP_004143287.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48212.1| hypothetical protein Csa_6G448700 [Cucumis sativus]
Length=559

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  429  DILPGDYK-------VNAGQDIMISVYNIHRSSQVWEQAEEFIPERF------DLEGPV-  474

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L    
Sbjct  475  -----------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMNFELVPN-  522

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  523  QTIGMTTGATIHTTNGLYMKLSQR  546



>gb|EYU41579.1| hypothetical protein MIMGU_mgv1a004062mg [Erythranthe guttata]
Length=546

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G D+ ISVYN+H S   WD+ +EF PERF      ++EG   
Sbjct  418  DVLPGDYK-------VNPGQDVMISVYNVHHSAQVWDRADEFVPERF------DLEGAV-  463

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + DL    
Sbjct  464  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVFLQHLNFDLV-PD  511

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  512  QNIGMTTGATIHTANGLYMKLSQR  535



>ref|XP_010546517.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=543

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 86/145 (59%), Gaps = 26/145 (18%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD LPG Y        +  G DI ISVYN+HRS   W+  NEF PERF ++         
Sbjct  423  PDVLPGNYK-------VNTGQDIMISVYNIHRSSEVWESANEFVPERFDLQ---------  466

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                    G + PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ + +L   
Sbjct  467  --------GPI-PNESNTDFKFIPFSGGPRKCVGDQFALMEAIVALAIFLQRLNFELVPD  517

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+  +  R
Sbjct  518  -QNIGMTTGATIHTTNGLYMTVSPR  541



>ref|XP_011468004.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Fragaria vesca subsp. vesca]
Length=445

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  317  DVLPGNYR-------VNPGQDIMISVYNIHRSSEVWERAEEFSPERF------DMEG---  360

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  + +L    
Sbjct  361  ---------PIPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFIQHLNFELVPD-  410

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  411  QNISMTTGATIHTTNGLYMKLSQR  434



>ref|XP_011396817.1| Cytochrome P450 97B3, chloroplastic [Auxenochlorella protothecoides]
 gb|AHA86563.1| cytochrome P450 like protein [Auxenochlorella protothecoides]
 gb|KFM23939.1| Cytochrome P450 97B3, chloroplastic [Auxenochlorella protothecoides]
Length=547

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 88/145 (61%), Gaps = 19/145 (13%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPG +   + GY +P G D+ ISVYN+H SP  WD+P  F P+RF            
Sbjct  420  PDELPGTWLAGECGYKVPKGQDVMISVYNIHHSPAVWDEPEAFRPDRF------------  467

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
               P  +P    P E  +D+ ++PF GGPRKCVGDQFA+ME+  ALA++L++F    K  
Sbjct  468  ---PLDAPP---PTEQNTDYRYIPFSGGPRKCVGDQFAMMEAVSALAVVLRRFTFYPKPG  521

Query  376  PESVKLVTGATIHTKNGLWCKLKKR  302
             E V + TGATIHT+NGL+  +  R
Sbjct  522  HE-VGMTTGATIHTQNGLYMGVGLR  545



>ref|XP_002955547.1| hypothetical protein VOLCADRAFT_83281 [Volvox carteri f. nagariensis]
 gb|EFJ43400.1| hypothetical protein VOLCADRAFT_83281 [Volvox carteri f. nagariensis]
Length=575

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 86/144 (60%), Gaps = 25/144 (17%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPGGY        +P G D+ ISVYN+H S   WD P  F PERF             
Sbjct  440  DELPGGYK-------VPVGQDVMISVYNIHHSEAVWDNPEAFIPERF-------------  479

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
              P   P    P+E  +DF ++PF GGPRKCVGDQFALME+ +ALA+LL++FD  L    
Sbjct  480  -GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVALAVLLRQFDFSLVPN-  534

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT +GL+  +K+R
Sbjct  535  QKIGMTTGATIHTTDGLYMYVKER  558



>ref|XP_008241353.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Prunus 
mume]
Length=556

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +  ES +     
Sbjct  425  DVLPGNYK-------VNAGQDIMISVYNIHHSSEVWERAEEFLPERFDL--ESSV-----  470

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  + +L    
Sbjct  471  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFIQHLNFELVPD-  518

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  519  QNISMTTGATIHTTNGLFMKLSQR  542



>ref|XP_004306170.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=544

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+HRS   W++  EF PERF      ++EG   
Sbjct  416  DVLPGNYR-------VNPGQDIMISVYNIHRSSEVWERAEEFSPERF------DMEGP--  460

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  + +L    
Sbjct  461  ----------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFIQHLNFELVPD-  509

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  510  QNISMTTGATIHTTNGLYMKLSQR  533



>gb|AFQ31612.1| CYP97C [Haematococcus pluvialis]
Length=571

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 90/156 (58%), Gaps = 28/156 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGY   K       G D+ ISVYN+HRS   WD P  F PERF             
Sbjct  441  DTLPGGYKVVK-------GQDVMISVYNIHRSKAVWDSPEAFLPERF-------------  480

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
              P   P    P+E  +DF ++PF GGPRKCVGDQFALME+ ++LA+LL++FD+ L    
Sbjct  481  -GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVSLAVLLREFDLSLVPN-  535

Query  373  ESVKLVTGATIHTKNGLWCKLKKRLDVC*I*KSIVL  266
            +++ + TGATIHT NGL+   + R+      KS+ L
Sbjct  536  QTIGMTTGATIHTTNGLYMYARARIAAA---KSVAL  568



>ref|XP_011018827.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Populus euphratica]
Length=544

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 87/145 (60%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF            G
Sbjct  414  DVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF------------G  454

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
             D         PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQK + +L   P
Sbjct  455  LDGP------VPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQKINFEL--VP  506

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++++ TGATIHT +GL+ KL +R
Sbjct  507  DQNIRMTTGATIHTTDGLYMKLSQR  531



>ref|XP_007027523.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY08025.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
Length=550

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 85/144 (59%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +           
Sbjct  420  DILPGNYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDLE----------  462

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                 SP    PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ+ + +L    
Sbjct  463  -----SP---VPNETNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFLQRLNFELVPD-  513

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NG++ KL +R
Sbjct  514  QDISMTTGATIHTTNGMYMKLSER  537



>ref|XP_006381359.1| hypothetical protein POPTR_0006s12150g [Populus trichocarpa]
 gb|ERP59156.1| hypothetical protein POPTR_0006s12150g [Populus trichocarpa]
Length=545

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 87/145 (60%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF            G
Sbjct  426  DVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF------------G  466

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
             D         PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQK + +L   P
Sbjct  467  LDGP------VPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQKINFEL--VP  518

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++++ TGATIHT +GL+ KL +R
Sbjct  519  DQNIRMTTGATIHTTDGLYMKLSQR  543



>ref|XP_011018826.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Populus euphratica]
Length=548

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 87/145 (60%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF            G
Sbjct  414  DVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF------------G  454

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
             D         PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQK + +L   P
Sbjct  455  LDGP------VPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQKINFEL--VP  506

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++++ TGATIHT +GL+ KL +R
Sbjct  507  DQNIRMTTGATIHTTDGLYMKLSQR  531



>gb|AGT63110.1| plastid carotenoid epsilon-ring hydroxylase [Haematococcus pluvialis]
Length=571

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 86/145 (59%), Gaps = 25/145 (17%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGY   K       G D+ ISVYN+HRS   WD P  F PERF             
Sbjct  441  DTLPGGYKVVK-------GQDVMISVYNIHRSKAVWDSPEAFLPERF-------------  480

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
              P   P    P+E  +DF ++PF GGPRKCVGDQFALME+ ++LA+LL++FD+ L    
Sbjct  481  -GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVSLAVLLREFDLSLVPN-  535

Query  373  ESVKLVTGATIHTKNGLWCKLKKRL  299
            +++ + TGATIHT NGL+   + R+
Sbjct  536  QTIGMTTGATIHTTNGLYMYARARI  560



>emb|CBI30186.3| unnamed protein product [Vitis vinifera]
 gb|AIO11761.1| cytochrome p450 [Croton stellatopilosus]
 emb|CDM63951.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=471

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 87/145 (60%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  +F PERF      ++EG   
Sbjct  342  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF------DLEGPV-  387

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  + +L   P
Sbjct  388  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFVQHMNFEL--VP  434

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL +R
Sbjct  435  DQNISMTTGATIHTTNGLYMKLTQR  459



>ref|XP_003062894.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52833.1| predicted protein [Micromonas pusilla CCMP1545]
Length=529

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 94/155 (61%), Gaps = 16/155 (10%)
 Frame = -1

Query  727  LPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESE-IEGWAGF  551
            LP G  GD D   I  G D+FISV+NLHR P  W++P +F+P RF+    +  ++ WAG+
Sbjct  377  LPKG-AGDADVTLI-KGMDVFISVWNLHRHPDCWEEPLKFDPFRFKKPYSNPGVKDWAGY  434

Query  550  DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQ------------FALMESAIALAMLL  407
            +P    G +YPNE+ SDFAF+PFG G RKC+GDQ            FA++E+   LAM L
Sbjct  435  NPDLISG-MYPNEVTSDFAFVPFGAGARKCIGDQARSCLHWSPYDRFAMLEATSCLAMTL  493

Query  406  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  302
            Q++D +L      V +  GATIHT  GL  ++ +R
Sbjct  494  QRYDFELDKDAAEVGMEMGATIHTAGGLPMRVTRR  528



>ref|XP_007204192.1| hypothetical protein PRUPE_ppa003701mg [Prunus persica]
 gb|EMJ05391.1| hypothetical protein PRUPE_ppa003701mg [Prunus persica]
Length=555

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 86/145 (59%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  424  DVLPGNYK-------VNAGQDIMISVYNIHHSSEVWERAEEFLPERF------DLEGSV-  469

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +AL + +Q  + +L   P
Sbjct  470  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALVIFIQHLNFEL--VP  516

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             +++ + TGATIHT NGL+ KL +R
Sbjct  517  DQNISMTTGATIHTTNGLFMKLSQR  541



>gb|EPS64627.1| hypothetical protein M569_10150 [Genlisea aurea]
Length=624

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 83/145 (57%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+HRS   WD+  EF P+RF V           
Sbjct  405  DTLPGNYK-------VEPGQDIMISVYNIHRSSQVWDRAEEFVPDRFDV-----------  446

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ + LA++LQ+ D +L   P
Sbjct  447  -------AGPVPNETNTDFKFIPFSGGPRKCVGDQFALLEATVGLAVVLQRLDFEL--VP  497

Query  373  ES-VKLVTGATIHTKNGLWCKLKKR  302
            +  + + TGATIHT NGL+ K+  R
Sbjct  498  DQIIGMTTGATIHTTNGLFMKVSPR  522



>gb|ADK60778.1| putative mitochondrial cytochrome P450 monooxygenase [Arachis 
diogoi]
Length=197

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 79/132 (60%), Gaps = 18/132 (14%)
 Frame = -1

Query  694  YAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYPN  515
            Y I  G DIFISV+NLHRSP  WD  ++F+PER+               P   P    PN
Sbjct  49   YTIKRGEDIFISVWNLHRSPNLWDDADKFQPERW---------------PVDGPN---PN  90

Query  514  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  335
            E   +F +LPFGGGPRKCVGD FA  E+ +ALAML+++F+  +      V++ TGATIHT
Sbjct  91   ETNQNFKYLPFGGGPRKCVGDLFASYETIVALAMLVRRFNFQVAVGAPPVEMTTGATIHT  150

Query  334  KNGLWCKLKKRL  299
              GL   + +R+
Sbjct  151  TQGLKMTVTRRI  162



>emb|CAN65775.1| hypothetical protein VITISV_030413 [Vitis vinifera]
Length=521

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  +F PERF      ++EG   
Sbjct  392  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF------DLEGPV-  437

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  + +L    
Sbjct  438  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFVQHMNFELV-PD  485

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  486  QNISMTTGATIHTTNGLYMKLTQR  509



>ref|XP_010683980.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683981.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683982.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=543

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+H S   W++  EF PERF +           
Sbjct  418  DTLPGDYK-------VNPGQDIMISVYNIHHSSQVWERAEEFIPERFDLE----------  460

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                 SP    PNE  +D+ ++PF GGPRKCVGDQFAL+E+ +ALA+LLQ  D +L    
Sbjct  461  -----SP---VPNESNTDYRYIPFSGGPRKCVGDQFALLEAIVALAILLQNMDFELVPD-  511

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ KL +R
Sbjct  512  QDITMTTGATIHTTNGLYMKLSER  535



>ref|XP_004516958.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=545

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 82/136 (60%), Gaps = 26/136 (19%)
 Frame = -1

Query  736  PDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWA  557
            PD+LPG Y        + AG DI ISVYN+HRS   WD+  EF PERF      E++G  
Sbjct  417  PDELPGAYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFLPERF------ELDGPV  463

Query  556  GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGT  377
                        PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  + +L   
Sbjct  464  ------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFLQNMNFELVPN  511

Query  376  PESVKLVTGATIHTKN  329
             +++ + TGATIHT N
Sbjct  512  -QNISMTTGATIHTTN  526



>ref|XP_002265015.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Vitis 
vinifera]
Length=546

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        + AG DI ISVYN+H S   W++  +F PERF      ++EG   
Sbjct  417  DVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF------DLEGPV-  462

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  + +L    
Sbjct  463  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFVQHMNFELVPD-  510

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  511  QNISMTTGATIHTTNGLYMKLTQR  534



>gb|AJB84623.1| carotene epsilon-monooxygenase [Camellia sinensis]
Length=557

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+H SP  WD+   F PERF      +++G   
Sbjct  426  DVLPGNYK-------VNPGQDIMISVYNIHHSPQVWDRAEVFVPERF------DLDG---  469

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKC+GDQFAL+E+ +ALA+ +Q  D +L    
Sbjct  470  ---------PMPNETNTDFRFIPFSGGPRKCIGDQFALLEAIVALAIFVQHMDFELVPD-  519

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT+NGL+ K+ +R
Sbjct  520  QNISMTTGATIHTENGLYMKVSQR  543



>ref|XP_002992972.1| hypothetical protein SELMODRAFT_187123 [Selaginella moellendorffii]
 gb|EFJ05918.1| hypothetical protein SELMODRAFT_187123 [Selaginella moellendorffii]
Length=525

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 86/145 (59%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGY  ++       G ++ ISVYN+H SP  W++  +F PERF             
Sbjct  408  DTLPGGYKLER-------GQNVMISVYNIHHSPALWERAEDFVPERF-------------  447

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF ++PF GG RKCVGDQFA++E+ + LAMLLQ+F+++L   P
Sbjct  448  -----DPDGPIPNESNTDFRYIPFSGGARKCVGDQFAMLEALVTLAMLLQRFELEL--VP  500

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             + + + TGATIHT  GL+  +K+R
Sbjct  501  GQDIGMTTGATIHTTKGLFMTVKRR  525



>ref|XP_002991812.1| hypothetical protein SELMODRAFT_186370 [Selaginella moellendorffii]
 gb|EFJ07074.1| hypothetical protein SELMODRAFT_186370 [Selaginella moellendorffii]
Length=525

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 86/145 (59%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPGGY  ++       G ++ ISVYN+H SP  W++  +F PERF             
Sbjct  408  DTLPGGYKLER-------GQNVMISVYNIHHSPALWERAEDFVPERF-------------  447

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                  P    PNE  +DF ++PF GG RKCVGDQFA++E+ + LAMLLQ+F+++L   P
Sbjct  448  -----DPDGPIPNESNTDFRYIPFSGGARKCVGDQFAMLEALVTLAMLLQRFELEL--VP  500

Query  373  -ESVKLVTGATIHTKNGLWCKLKKR  302
             + + + TGATIHT  GL+  +K+R
Sbjct  501  GQDIGMTTGATIHTTKGLFMTVKRR  525



>ref|XP_002971637.1| hypothetical protein SELMODRAFT_231778 [Selaginella moellendorffii]
 gb|EFJ27386.1| hypothetical protein SELMODRAFT_231778 [Selaginella moellendorffii]
Length=399

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 78/133 (59%), Gaps = 18/133 (14%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            GY +  G DIFIS++NLHRSP  W+  +EF PER+               P   P    P
Sbjct  272  GYPLKRGEDIFISLWNLHRSPSLWEHSHEFRPERW---------------PLDGPD---P  313

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIH  338
            NE+  +F +LPFGGGPRKCVGD FA  E+  A+AML+++FD  L      V + TGATIH
Sbjct  314  NEVTENFKYLPFGGGPRKCVGDMFATFETVTAVAMLVRRFDFKLAQGAPPVGMTTGATIH  373

Query  337  TKNGLWCKLKKRL  299
            T  GL   + KR+
Sbjct  374  TTAGLHVAVTKRI  386



>gb|KCW89308.1| hypothetical protein EUGRSUZ_A01599 [Eucalyptus grandis]
Length=529

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y  D        G DI ISVYN+H SP  W++  EF PERF             
Sbjct  400  DVLPGNYKVDP-------GQDIMISVYNIHHSPQVWERAEEFVPERFY------------  440

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                 + G L PNE  +DF F+PF GGPRKCVGDQFA++ES +ALA+ L++ +  L    
Sbjct  441  -----TEGPL-PNETNTDFRFIPFSGGPRKCVGDQFAMLESIVALAVFLERMNFVLVPD-  493

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ ++ +R
Sbjct  494  QKISMTTGATIHTTNGLYMRVSRR  517



>ref|XP_010050328.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Eucalyptus 
grandis]
Length=559

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y  D        G DI ISVYN+H SP  W++  EF PERF             
Sbjct  430  DVLPGNYKVDP-------GQDIMISVYNIHHSPQVWERAEEFVPERFY------------  470

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                 + G L PNE  +DF F+PF GGPRKCVGDQFA++ES +ALA+ L++ +  L    
Sbjct  471  -----TEGPL-PNETNTDFRFIPFSGGPRKCVGDQFAMLESIVALAVFLERMNFVLVPD-  523

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ ++ +R
Sbjct  524  QKISMTTGATIHTTNGLYMRVSRR  547



>ref|XP_010674674.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=628

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 79/131 (60%), Gaps = 18/131 (14%)
 Frame = -1

Query  694  YAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYPN  515
            Y I  G DIFIS++NLHRSP  W+  ++F PER+               P   P    PN
Sbjct  477  YPIRKGEDIFISIWNLHRSPSLWEDADKFNPERW---------------PLDGPA---PN  518

Query  514  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  335
            E    F +LPFGGG RKC+GD FA  E+ +ALAML+Q+FD +L      VK+ TGATIHT
Sbjct  519  ETNQSFRYLPFGGGQRKCIGDMFASYENVVALAMLVQRFDFELDPEAPPVKMTTGATIHT  578

Query  334  KNGLWCKLKKR  302
             NGL  K+++R
Sbjct  579  TNGLMMKVRQR  589



>ref|XP_006833025.1| hypothetical protein AMTR_s00094p00091950 [Amborella trichopoda]
 gb|ERM98303.1| hypothetical protein AMTR_s00094p00091950 [Amborella trichopoda]
Length=89

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  526  LYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGA  347
            L+ ++I+ DFAFLPFGG PRKCVGDQFALMES +ALAMLL+KF+++L+  P  V+LV GA
Sbjct  3    LHGHQIVVDFAFLPFGGEPRKCVGDQFALMESTVALAMLLRKFNVELRDPPGQVELVMGA  62

Query  346  TIHTKNGLWCKLK  308
            TIHTK GLWC LK
Sbjct  63   TIHTKAGLWCNLK  75



>gb|AJD25226.1| cytochrome P450 CYP97A41 [Salvia miltiorrhiza]
Length=612

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 81/131 (62%), Gaps = 18/131 (14%)
 Frame = -1

Query  694  YAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYPN  515
            Y I  G DIFISV+NLHRSP+ W++ ++F PER+               P   P    PN
Sbjct  464  YPIKKGEDIFISVWNLHRSPHHWEEADKFNPERW---------------PLDGPN---PN  505

Query  514  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  335
            E   +F++LPFGGGPRKC+GD FA  E+ +A+AML+++FD  L  +   VK+ TGATIHT
Sbjct  506  ETNQNFSYLPFGGGPRKCIGDMFATFETVVAVAMLVRRFDFQLAISAPPVKMTTGATIHT  565

Query  334  KNGLWCKLKKR  302
              GL   + +R
Sbjct  566  TEGLKMTVTRR  576



>gb|ABD97103.1| cytochrome P450 monooxygenase CYP97C10 [Glycine max]
Length=425

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 79/132 (60%), Gaps = 18/132 (14%)
 Frame = -1

Query  694  YAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYPN  515
            Y I  G DIFISV+NLHRSP  WD  ++F+PER           WA   PS       PN
Sbjct  272  YPIKRGEDIFISVWNLHRSPKLWDDADKFKPER-----------WALDGPS-------PN  313

Query  514  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  335
            E   +F +LPFGGGPRKCVGD FA  E+ +ALAML+++F+  +      V++ TGATIHT
Sbjct  314  ETNQNFKYLPFGGGPRKCVGDLFASYETVVALAMLMRRFNFQIAVGAPPVEMTTGATIHT  373

Query  334  KNGLWCKLKKRL  299
              GL   +  R+
Sbjct  374  TQGLKMTVTHRI  385



>ref|XP_002965693.1| hypothetical protein SELMODRAFT_407294 [Selaginella moellendorffii]
 gb|EFJ33113.1| hypothetical protein SELMODRAFT_407294 [Selaginella moellendorffii]
Length=553

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 78/133 (59%), Gaps = 18/133 (14%)
 Frame = -1

Query  697  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYP  518
            GY +  G DIFIS++NLHRSP  W+  +EF PER+               P   P    P
Sbjct  426  GYPLKRGEDIFISLWNLHRSPSLWEHSHEFRPERW---------------PLDGPD---P  467

Query  517  NEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIH  338
            NE+  +F +LPFGGGPRKCVGD FA  E+  A+AML+++FD  L      V + TGATIH
Sbjct  468  NEVTENFKYLPFGGGPRKCVGDMFATFETVTAVAMLVRRFDFKLAQGAPPVGMTTGATIH  527

Query  337  TKNGLWCKLKKRL  299
            T  GL   + KR+
Sbjct  528  TTAGLHVAVTKRI  540



>gb|KDP29211.1| hypothetical protein JCGZ_16600 [Jatropha curcas]
Length=573

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 84/144 (58%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+H S   W++  EF PERF      ++EG   
Sbjct  420  DVLPGNYK-------VNPGQDIMISVYNIHHSSKVWERAEEFVPERF------DLEGPV-  465

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +DF F+PF GGPRKCVGDQFAL+E+ ++LA+ LQ  + +L    
Sbjct  466  -----------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVSLAIFLQNMNFELVPD-  513

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            + + + TGATIHT NGL+ KL +R
Sbjct  514  QKINMTTGATIHTTNGLYMKLSQR  537



>gb|AJD25228.1| cytochrome P450 CYP97C28 [Salvia miltiorrhiza]
Length=542

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 86/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D LPG Y        +  G DI ISVYN+HRS   W++ ++F PERF +           
Sbjct  414  DLLPGNYK-------VSPGQDIMISVYNIHRSAEVWERADDFVPERFDLD----------  456

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                 SP    PNE  +D+ ++PF GGPRKCVGDQFAL+E+ +ALA+LLQ    +L    
Sbjct  457  -----SP---VPNEANTDYRYIPFSGGPRKCVGDQFALLEAIVALAVLLQHASFELIPD-  507

Query  373  ESVKLVTGATIHTKNGLWCKLKKR  302
            +++ + TGATIHT NGL+ KL +R
Sbjct  508  QTIGMTTGATIHTTNGLYMKLSQR  531



>gb|ABB52076.1| putative epsilon-ring carotene hydroxylase [Daucus carota subsp. 
sativus]
Length=548

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 85/145 (59%), Gaps = 28/145 (19%)
 Frame = -1

Query  733  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAG  554
            D+LPG Y        +  G DI ISVYN+H S   WD+  EF PERF      +++G   
Sbjct  419  DELPGSYK-------VNPGQDIMISVYNIHHSSKVWDRAEEFIPERF------DLDGPV-  464

Query  553  FDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTP  374
                       PNE  +D+ F+PF GGPRKCVGDQFAL+E+ ++LA+ LQ    +L   P
Sbjct  465  -----------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVSLAIFLQHLSFEL--IP  511

Query  373  ESV-KLVTGATIHTKNGLWCKLKKR  302
            + V  + TGATIHT NGL+ K+ KR
Sbjct  512  DQVINMTTGATIHTTNGLYMKVSKR  536



>ref|XP_004170273.1| PREDICTED: LOW QUALITY PROTEIN: protein LUTEIN DEFICIENT 5, chloroplastic-like 
[Cucumis sativus]
Length=624

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 79/132 (60%), Gaps = 18/132 (14%)
 Frame = -1

Query  694  YAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYPN  515
            Y I  G DIFISV+NLHRSP  WD  ++F PER+               P   P    PN
Sbjct  478  YPIKKGEDIFISVWNLHRSPEHWDDADKFNPERW---------------PLDGPN---PN  519

Query  514  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  335
            E   +F +LPFGGGPRKCVGD FA  E+ +ALAML+++FD  +      VK+ TGATIHT
Sbjct  520  ETNQNFRYLPFGGGPRKCVGDMFASYETVVALAMLVRRFDFQMALGAPPVKMTTGATIHT  579

Query  334  KNGLWCKLKKRL  299
             +GL   + +R+
Sbjct  580  TDGLQMTVARRM  591



>ref|XP_004133753.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56324.1| hypothetical protein Csa_3G115620 [Cucumis sativus]
Length=624

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 79/132 (60%), Gaps = 18/132 (14%)
 Frame = -1

Query  694  YAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYPN  515
            Y I  G DIFISV+NLHRSP  WD  ++F PER+               P   P    PN
Sbjct  478  YPIKKGEDIFISVWNLHRSPEHWDDADKFNPERW---------------PLDGPN---PN  519

Query  514  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  335
            E   +F +LPFGGGPRKCVGD FA  E+ +ALAML+++FD  +      VK+ TGATIHT
Sbjct  520  ETNQNFRYLPFGGGPRKCVGDMFASYETVVALAMLVRRFDFQMALGAPPVKMTTGATIHT  579

Query  334  KNGLWCKLKKRL  299
             +GL   + +R+
Sbjct  580  TDGLQMTVARRM  591



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500