BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002H24

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796725.1|  PREDICTED: uncharacterized protein LOC104243262    137   2e-36   Nicotiana sylvestris
ref|XP_009587088.1|  PREDICTED: uncharacterized protein LOC104084...    135   1e-35   Nicotiana tomentosiformis
ref|XP_004240896.1|  PREDICTED: uncharacterized protein LOC101265648    133   8e-35   Solanum lycopersicum
emb|CDP13949.1|  unnamed protein product                                131   3e-34   Coffea canephora [robusta coffee]
ref|XP_006353405.1|  PREDICTED: uncharacterized protein LOC102603...    130   5e-34   Solanum tuberosum [potatoes]
ref|XP_009761007.1|  PREDICTED: uncharacterized protein LOC104213009    129   1e-33   Nicotiana sylvestris
ref|XP_002265642.1|  PREDICTED: uncharacterized protein LOC100243...    125   9e-33   Vitis vinifera
ref|XP_006828167.1|  hypothetical protein AMTR_s00023p00110940          125   1e-32   
ref|XP_004156634.1|  PREDICTED: uncharacterized LOC101206121            124   1e-32   
ref|XP_003633434.1|  PREDICTED: uncharacterized protein LOC100253518    126   1e-32   Vitis vinifera
ref|XP_010264502.1|  PREDICTED: uncharacterized protein LOC104602492    124   2e-32   
gb|KHG28253.1|  Putative sel1-like repeat-containing protein L18        125   2e-32   Gossypium arboreum [tree cotton]
ref|XP_008442362.1|  PREDICTED: uncharacterized protein LOC103486254    124   3e-32   Cucumis melo [Oriental melon]
ref|XP_010039279.1|  PREDICTED: uncharacterized protein LOC104427...    123   6e-32   Eucalyptus grandis [rose gum]
ref|XP_009587086.1|  PREDICTED: uncharacterized protein LOC104084...    125   7e-32   Nicotiana tomentosiformis
ref|XP_010256999.1|  PREDICTED: uncharacterized protein LOC104597244    124   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010039170.1|  PREDICTED: uncharacterized protein LOC104427...    123   1e-31   Eucalyptus grandis [rose gum]
ref|XP_010091064.1|  hypothetical protein L484_021946                   128   2e-31   
gb|KCW88248.1|  hypothetical protein EUGRSUZ_A00636                     124   2e-31   Eucalyptus grandis [rose gum]
gb|KJB77082.1|  hypothetical protein B456_012G119700                    122   4e-31   Gossypium raimondii
gb|EYU20083.1|  hypothetical protein MIMGU_mgv1a015205mg                122   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_006429512.1|  hypothetical protein CICLE_v10013155mg             120   7e-31   Citrus clementina [clementine]
ref|XP_007026543.1|  Uncharacterized protein TCM_021578                 122   7e-31   
ref|XP_007207508.1|  hypothetical protein PRUPE_ppa013808mg             120   9e-31   Prunus persica
ref|XP_007218537.1|  hypothetical protein PRUPE_ppa012708mg             121   1e-30   Prunus persica
ref|XP_008233834.1|  PREDICTED: uncharacterized protein LOC103332...    121   1e-30   Prunus mume [ume]
gb|KDP22810.1|  hypothetical protein JCGZ_00397                         121   1e-30   Jatropha curcas
ref|XP_007134617.1|  hypothetical protein PHAVU_010G062000g             119   2e-30   Phaseolus vulgaris [French bean]
ref|XP_002520815.1|  conserved hypothetical protein                     121   2e-30   Ricinus communis
gb|EYU41977.1|  hypothetical protein MIMGU_mgv1a016033mg                120   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_011077502.1|  PREDICTED: uncharacterized protein LOC105161501    119   2e-30   Sesamum indicum [beniseed]
ref|XP_010543693.1|  PREDICTED: uncharacterized protein LOC104816524    118   2e-29   Tarenaya hassleriana [spider flower]
ref|XP_006289188.1|  hypothetical protein CARUB_v10002629mg             117   6e-29   Capsella rubella
gb|EPS60291.1|  hypothetical protein M569_14514                         117   6e-29   Genlisea aurea
ref|XP_011095090.1|  PREDICTED: uncharacterized protein LOC105174627    116   6e-29   Sesamum indicum [beniseed]
ref|XP_010031141.1|  PREDICTED: uncharacterized protein LOC104421024    117   7e-29   Eucalyptus grandis [rose gum]
ref|NP_001238121.1|  uncharacterized protein LOC100527831               114   9e-29   Glycine max [soybeans]
ref|XP_008782586.1|  PREDICTED: uncharacterized protein LOC103702077    116   1e-28   Phoenix dactylifera
ref|XP_008370217.1|  PREDICTED: uncharacterized protein LOC103433...    114   1e-28   Malus domestica [apple tree]
ref|XP_003623468.1|  hypothetical protein MTR_7g071210                  114   1e-28   Medicago truncatula
ref|XP_010921063.1|  PREDICTED: uncharacterized protein LOC105044761    116   1e-28   Elaeis guineensis
ref|XP_008370215.1|  PREDICTED: uncharacterized protein LOC103433...    116   1e-28   Malus domestica [apple tree]
ref|XP_009369229.1|  PREDICTED: uncharacterized protein LOC103958662    115   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_008355547.1|  PREDICTED: uncharacterized protein LOC103419212    115   2e-28   Malus domestica [apple tree]
gb|AAO42324.1|  unknown protein                                         115   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24957.1|  hypothetical protein AALP_AA8G047700                    115   2e-28   Arabis alpina [alpine rockcress]
ref|XP_009350684.1|  PREDICTED: uncharacterized protein LOC103942213    115   2e-28   Pyrus x bretschneideri [bai li]
emb|CDX98838.1|  BnaC09g49970D                                          115   2e-28   
ref|NP_196155.2|  uncharacterized protein                               115   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008388305.1|  PREDICTED: uncharacterized protein LOC103450710    114   2e-28   
ref|XP_003522147.1|  PREDICTED: uncharacterized protein LOC100794...    113   3e-28   Glycine max [soybeans]
ref|XP_006398999.1|  hypothetical protein EUTSA_v10014886mg             115   3e-28   Eutrema salsugineum [saltwater cress]
emb|CDX70156.1|  BnaA10g25050D                                          115   3e-28   
ref|XP_009122145.1|  PREDICTED: uncharacterized protein LOC103846889    115   3e-28   Brassica rapa
ref|XP_002315124.1|  hypothetical protein POPTR_0010s18960g             114   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008233835.1|  PREDICTED: uncharacterized protein LOC103332...    114   6e-28   
ref|XP_010491070.1|  PREDICTED: uncharacterized protein LOC104768733    114   8e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009373106.1|  PREDICTED: uncharacterized protein LOC103962...    112   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_008355552.1|  PREDICTED: uncharacterized protein LOC103419214    113   1e-27   Malus domestica [apple tree]
ref|XP_009373105.1|  PREDICTED: uncharacterized protein LOC103962...    113   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_010452441.1|  PREDICTED: uncharacterized protein LOC104734539    113   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009373104.1|  PREDICTED: uncharacterized protein LOC103962...    113   2e-27   
ref|XP_010423476.1|  PREDICTED: uncharacterized protein LOC104708579    113   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_011076630.1|  PREDICTED: uncharacterized protein LOC105160829    112   3e-27   Sesamum indicum [beniseed]
ref|XP_011015169.1|  PREDICTED: uncharacterized protein LOC105118821    112   4e-27   Populus euphratica
ref|XP_010529121.1|  PREDICTED: uncharacterized protein LOC104806101    111   5e-27   Tarenaya hassleriana [spider flower]
ref|XP_010695454.1|  PREDICTED: uncharacterized protein LOC104908080    112   5e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683583.1|  PREDICTED: uncharacterized protein LOC104898233    110   5e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK26779.1|  unknown                                                 111   5e-27   Picea sitchensis
ref|XP_004492521.1|  PREDICTED: uncharacterized protein LOC101512...    109   9e-27   Cicer arietinum [garbanzo]
ref|XP_006435843.1|  hypothetical protein CICLE_v10033159mg             109   9e-27   
dbj|BAJ91570.1|  predicted protein                                      111   9e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007008833.1|  Uncharacterized protein TCM_042415                 110   1e-26   
gb|KGN65322.1|  hypothetical protein Csa_1G324870                       108   2e-26   Cucumis sativus [cucumbers]
ref|XP_009402772.1|  PREDICTED: uncharacterized protein LOC103986477    110   2e-26   
ref|XP_008809978.1|  PREDICTED: uncharacterized protein LOC103721508    110   2e-26   
ref|XP_006486231.1|  PREDICTED: uncharacterized protein LOC102630...    110   2e-26   
ref|XP_009416310.1|  PREDICTED: uncharacterized protein LOC103996957    110   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC28759.2|  expressed protein                                       108   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001144203.1|  uncharacterized protein LOC100277064               110   4e-26   Zea mays [maize]
ref|XP_002879746.1|  hypothetical protein ARALYDRAFT_345628             108   6e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_010509118.1|  PREDICTED: uncharacterized protein LOC104785576    108   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009421405.1|  PREDICTED: uncharacterized protein LOC104000960    107   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003558119.1|  PREDICTED: uncharacterized protein LOC100845835    108   7e-26   Brachypodium distachyon [annual false brome]
gb|KHN31321.1|  hypothetical protein glysoja_022975                     108   8e-26   Glycine soja [wild soybean]
ref|XP_003552182.1|  PREDICTED: uncharacterized protein LOC100779520    108   8e-26   Glycine max [soybeans]
ref|NP_565889.2|  uncharacterized protein                               108   8e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36738.1|  hypothetical protein AALP_AA4G163100                    107   1e-25   Arabis alpina [alpine rockcress]
ref|XP_006295208.1|  hypothetical protein CARUB_v10024290mg             108   1e-25   Capsella rubella
ref|XP_004307701.1|  PREDICTED: uncharacterized protein LOC101294508    108   1e-25   Fragaria vesca subsp. vesca
ref|XP_010505467.1|  PREDICTED: uncharacterized protein LOC104782284    107   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007163593.1|  hypothetical protein PHAVU_001G247500g             108   2e-25   Phaseolus vulgaris [French bean]
ref|XP_002265673.1|  PREDICTED: uncharacterized protein LOC100243...    106   2e-25   Vitis vinifera
ref|XP_009421407.1|  PREDICTED: uncharacterized protein LOC104000963    107   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010517139.1|  PREDICTED: uncharacterized protein LOC104792...    107   2e-25   Camelina sativa [gold-of-pleasure]
gb|KHN04800.1|  hypothetical protein glysoja_031900                     107   2e-25   Glycine soja [wild soybean]
gb|AAM62527.1|  unknown                                                 106   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406892.1|  PREDICTED: uncharacterized protein LOC103989686    107   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007140174.1|  hypothetical protein PHAVU_008G090100g             104   6e-25   Phaseolus vulgaris [French bean]
gb|AFK39264.1|  unknown                                                 104   7e-25   Lotus japonicus
gb|ACU23149.1|  unknown                                                 106   8e-25   Glycine max [soybeans]
gb|KJB67482.1|  hypothetical protein B456_010G193200                    105   1e-24   Gossypium raimondii
ref|XP_002312191.1|  hypothetical protein POPTR_0008s07490g             103   2e-24   Populus trichocarpa [western balsam poplar]
emb|CDY07730.1|  BnaA03g17810D                                          103   5e-24   Brassica napus [oilseed rape]
ref|XP_006481131.1|  PREDICTED: uncharacterized protein LOC102610...    102   5e-24   Citrus sinensis [apfelsine]
ref|XP_006654273.1|  PREDICTED: uncharacterized protein LOC102714375    102   5e-24   Oryza brachyantha
ref|XP_009133257.1|  PREDICTED: uncharacterized protein LOC103857...    103   6e-24   Brassica rapa
ref|XP_011005568.1|  PREDICTED: uncharacterized protein LOC105111778    102   6e-24   Populus euphratica
ref|XP_004137693.1|  PREDICTED: uncharacterized protein LOC101206121    101   6e-24   
ref|XP_006374033.1|  hypothetical protein POPTR_0016s13640g             103   8e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011032587.1|  PREDICTED: uncharacterized protein LOC105131358    103   9e-24   Populus euphratica
gb|KJB77084.1|  hypothetical protein B456_012G119700                    102   1e-23   Gossypium raimondii
ref|NP_001238136.1|  uncharacterized protein LOC100527576               101   1e-23   Glycine max [soybeans]
gb|KDP21698.1|  hypothetical protein JCGZ_03369                         102   2e-23   Jatropha curcas
ref|XP_004146456.1|  PREDICTED: uncharacterized protein LOC101213...    102   2e-23   Cucumis sativus [cucumbers]
ref|NP_974733.1|  uncharacterized protein                               102   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984894.1|  PREDICTED: myc-associated zinc finger protei...    102   3e-23   Setaria italica
ref|NP_001055251.1|  Os05g0342900                                       100   4e-23   
ref|XP_004500530.1|  PREDICTED: uncharacterized protein LOC101512...    100   7e-23   
ref|XP_002465405.1|  hypothetical protein SORBIDRAFT_01g038090          101   1e-22   
ref|XP_004962417.1|  PREDICTED: uncharacterized protein LOC101777...  97.8    3e-22   Setaria italica
ref|NP_001049844.1|  Os03g0298600                                     99.4    4e-22   
ref|XP_008456900.1|  PREDICTED: uncharacterized protein LOC103496...  98.2    7e-22   Cucumis melo [Oriental melon]
gb|EEE58888.1|  hypothetical protein OsJ_10507                        98.6    8e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006411058.1|  hypothetical protein EUTSA_v10017381mg           97.8    9e-22   Eutrema salsugineum [saltwater cress]
ref|XP_003601009.1|  hypothetical protein MTR_3g072010                97.8    1e-21   Medicago truncatula
ref|XP_006282317.1|  hypothetical protein CARUB_v10028606mg           95.1    5e-21   
ref|XP_006289773.1|  hypothetical protein CARUB_v10003374mg           94.7    9e-21   
ref|XP_002871153.1|  hypothetical protein ARALYDRAFT_325170           93.2    9e-20   
ref|XP_004146455.1|  PREDICTED: uncharacterized protein LOC101213...  93.2    1e-19   Cucumis sativus [cucumbers]
ref|XP_010497949.1|  PREDICTED: uncharacterized protein LOC104775718  90.1    1e-19   
dbj|BAB09979.1|  unnamed protein product                              93.2    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KJB67484.1|  hypothetical protein B456_010G193200                  91.3    5e-19   Gossypium raimondii
ref|XP_008456899.1|  PREDICTED: uncharacterized protein LOC103496...  90.9    7e-19   
gb|KHN29550.1|  hypothetical protein glysoja_005274                   89.7    2e-18   Glycine soja [wild soybean]
gb|EMT09012.1|  hypothetical protein F775_27191                       88.2    4e-18   
gb|EMS50296.1|  hypothetical protein TRIUR3_29514                     89.7    7e-18   Triticum urartu
dbj|BAK02754.1|  predicted protein                                    85.5    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010517140.1|  PREDICTED: uncharacterized protein LOC104792...  85.1    3e-17   Camelina sativa [gold-of-pleasure]
ref|NP_001143861.1|  uncharacterized protein LOC100276657             84.7    5e-17   
ref|XP_008647657.1|  PREDICTED: uncharacterized protein LOC100276...  83.2    9e-17   
ref|NP_001142513.1|  hypothetical protein                             83.2    1e-16   Zea mays [maize]
ref|XP_008654668.1|  PREDICTED: uncharacterized protein LOC100274...  82.8    1e-16   Zea mays [maize]
ref|XP_010529921.1|  PREDICTED: uncharacterized protein LOC104806634  84.7    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_002439596.1|  hypothetical protein SORBIDRAFT_09g015880        82.4    2e-16   Sorghum bicolor [broomcorn]
gb|KDO44850.1|  hypothetical protein CISIN_1g032635mg                 83.2    2e-16   Citrus sinensis [apfelsine]
ref|XP_009133258.1|  PREDICTED: uncharacterized protein LOC103857...  82.0    4e-16   Brassica rapa
gb|ACG31011.1|  hypothetical protein                                  81.3    4e-16   Zea mays [maize]
emb|CBI25405.3|  unnamed protein product                              71.6    5e-13   Vitis vinifera
emb|CBI18085.3|  unnamed protein product                              71.2    6e-13   Vitis vinifera
ref|XP_001778215.1|  predicted protein                                69.7    1e-11   
ref|XP_002526705.1|  hypothetical protein RCOM_0850070                66.6    6e-11   
ref|XP_005650064.1|  hypothetical protein COCSUDRAFT_32673            64.7    4e-10   Coccomyxa subellipsoidea C-169
gb|EEE63318.1|  hypothetical protein OsJ_18129                        63.2    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001692982.1|  predicted protein                                64.3    8e-10   Chlamydomonas reinhardtii
ref|XP_002950802.1|  hypothetical protein VOLCADRAFT_120924           63.2    2e-09   Volvox carteri f. nagariensis
gb|KIY93418.1|  hypothetical protein MNEG_14545                       54.3    2e-06   Monoraphidium neglectum
ref|XP_009590059.1|  PREDICTED: uncharacterized protein LOC104087340  52.4    4e-06   
ref|XP_005850343.1|  hypothetical protein CHLNCDRAFT_142152           53.5    4e-05   Chlorella variabilis
gb|KIY94194.1|  hypothetical protein MNEG_13768                       49.7    5e-05   Monoraphidium neglectum
ref|XP_002505403.1|  predicted protein                                51.2    5e-05   Micromonas commoda
ref|XP_003059675.1|  predicted protein                                50.8    8e-05   Micromonas pusilla CCMP1545
ref|XP_002962942.1|  hypothetical protein SELMODRAFT_404377           51.2    3e-04   
ref|XP_011401235.1|  hypothetical protein F751_6989                   46.6    0.001   Auxenochlorella protothecoides



>ref|XP_009796725.1| PREDICTED: uncharacterized protein LOC104243262 [Nicotiana sylvestris]
 ref|XP_009796726.1| PREDICTED: uncharacterized protein LOC104243262 [Nicotiana sylvestris]
Length=175

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQVLVGQMY+SGYG+SRDAQKG+AWI+
Sbjct  82   QQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQVLVGQMYYSGYGISRDAQKGRAWIN  141

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            RAS++RSSAW+VSDKRPGYN SDSDSDDT  +AK
Sbjct  142  RASKSRSSAWKVSDKRPGYNASDSDSDDTVEDAK  175



>ref|XP_009587088.1| PREDICTED: uncharacterized protein LOC104084834 isoform X2 [Nicotiana 
tomentosiformis]
Length=175

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQVLVGQMY+SGYG+SRDAQKG+AWI+
Sbjct  82   QQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQVLVGQMYYSGYGISRDAQKGRAWIN  141

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            RAS++RSSAW+VSDKRPGYN SDSDSDDT  + K
Sbjct  142  RASKSRSSAWKVSDKRPGYNASDSDSDDTVEDPK  175



>ref|XP_004240896.1| PREDICTED: uncharacterized protein LOC101265648 [Solanum lycopersicum]
Length=176

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR+PLA+VV DCV+RWF DTLKEAKAGD +MQVLVGQMYFSGYG++RDAQKG+AWI+RAS
Sbjct  84   RRLPLADVVADCVKRWFHDTLKEAKAGDANMQVLVGQMYFSGYGIARDAQKGRAWITRAS  143

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            ++RSSAW+VSDKRPGYN SDSDSDDT  +AK
Sbjct  144  KSRSSAWKVSDKRPGYNASDSDSDDTVEDAK  174



>emb|CDP13949.1| unnamed protein product [Coffea canephora]
Length=179

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RRIPLAE V DCV+RWFQDTLKEAKAGD +MQVLV QMY+SGYG+ RDAQKGK W++RAS
Sbjct  89   RRIPLAEAVADCVKRWFQDTLKEAKAGDTAMQVLVSQMYYSGYGIPRDAQKGKTWMNRAS  148

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            R RSS W+VSDK PGYN SDSDS+DT  EAK
Sbjct  149  RARSSVWKVSDKHPGYNASDSDSEDTKDEAK  179



>ref|XP_006353405.1| PREDICTED: uncharacterized protein LOC102603532 isoform X1 [Solanum 
tuberosum]
 ref|XP_006353406.1| PREDICTED: uncharacterized protein LOC102603532 isoform X2 [Solanum 
tuberosum]
Length=176

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR+PLA+VV DCV+RWF DTLKEAKAGD +MQVLVGQMYFSGYG+S+DAQKG+AWI+RAS
Sbjct  84   RRLPLADVVADCVKRWFHDTLKEAKAGDANMQVLVGQMYFSGYGISKDAQKGRAWITRAS  143

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            ++RSSAW+VSDKRPGYN SDSDSDDT  + K
Sbjct  144  KSRSSAWKVSDKRPGYNASDSDSDDTVEDTK  174



>ref|XP_009761007.1| PREDICTED: uncharacterized protein LOC104213009 [Nicotiana sylvestris]
 ref|XP_009761613.1| PREDICTED: uncharacterized protein LOC104213009 [Nicotiana sylvestris]
Length=162

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  653  RNKMeeessngnsseEQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFS  474
            ++KMEEESSN NS      RR PLA+VV +CV+RWFQDTLKEAKAGD +MQVLVGQMY+S
Sbjct  53   KSKMEEESSNSNSKPLAEQRRHPLADVVGECVKRWFQDTLKEAKAGDTAMQVLVGQMYYS  112

Query  473  GYGVSRDAQKGKawisrasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            GYG+ RD QKG+AWI+RAS++RSSAW+VSDKRPGYNVSDSDSDDT  E K
Sbjct  113  GYGIPRDPQKGRAWINRASKSRSSAWKVSDKRPGYNVSDSDSDDTVEETK  162



>ref|XP_002265642.1| PREDICTED: uncharacterized protein LOC100243041 isoform X1 [Vitis 
vinifera]
 ref|XP_003632590.1| PREDICTED: uncharacterized protein LOC100243041 isoform X1 [Vitis 
vinifera]
Length=100

 Score =   125 bits (314),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+EVV+DCV+RWFQDTL+EAK+GD+SMQVLVGQMY+SGYGV RDAQKG+ W++RAS
Sbjct  11   HRVPLSEVVSDCVKRWFQDTLREAKSGDVSMQVLVGQMYYSGYGVPRDAQKGRVWMTRAS  70

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            RTRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  71   RTRSSVWKVSDKHPGYNASDSDSDELKGDS  100



>ref|XP_006828167.1| hypothetical protein AMTR_s00023p00110940 [Amborella trichopoda]
 gb|ERM95583.1| hypothetical protein AMTR_s00023p00110940 [Amborella trichopoda]
Length=99

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            Q   R+PL+EVV DCV+RWFQDTLKEA+AGD SMQVLVGQMY+SGYG+ RDAQKG+AW++
Sbjct  6    QNHNRLPLSEVVADCVKRWFQDTLKEARAGDSSMQVLVGQMYYSGYGIPRDAQKGRAWLT  65

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +AS+ RSS W+VSDK PGYN SDSDSD+   E K
Sbjct  66   KASKNRSSVWKVSDKHPGYNASDSDSDEQIKEQK  99



>ref|XP_004156634.1| PREDICTED: uncharacterized LOC101206121 [Cucumis sativus]
 gb|KGN58719.1| hypothetical protein Csa_3G730830 [Cucumis sativus]
Length=100

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            + L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W++
Sbjct  8    EALNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRIWMT  67

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDD  342
            +ASR+RSS W+VSDK PGYN SDSDSD+
Sbjct  68   KASRSRSSVWKVSDKHPGYNASDSDSDE  95



>ref|XP_003633434.1| PREDICTED: uncharacterized protein LOC100253518 [Vitis vinifera]
 ref|XP_010658206.1| PREDICTED: uncharacterized protein LOC100253518 [Vitis vinifera]
Length=156

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR+PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVGQMYFSGYGVSRDAQKG+AWISRAS
Sbjct  66   RRMPLAQVVSDCAKRWFQDTLKEAKAGDTTMQVLVGQMYFSGYGVSRDAQKGRAWISRAS  125

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            ++RSSA +V DK PGYN SDSDSDD   + K
Sbjct  126  KSRSSALKVGDKHPGYNASDSDSDDLKNDEK  156



>ref|XP_010264502.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264503.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264504.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264505.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
Length=100

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            +R  R+PL+EVV+DCVRRWFQDTLKEAKAGD  MQVLVGQMY+SGYGV RDAQKG+AWI+
Sbjct  5    ERQNRVPLSEVVSDCVRRWFQDTLKEAKAGDSGMQVLVGQMYYSGYGVPRDAQKGRAWIT  64

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDD  342
            RASR+RSS W+VSDK PGYN SDSDSD+
Sbjct  65   RASRSRSSVWKVSDKHPGYNASDSDSDE  92



>gb|KHG28253.1| Putative sel1-like repeat-containing protein L18 [Gossypium arboreum]
Length=149

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            +R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ W++RAS
Sbjct  60   QRLPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWMTRAS  119

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            R RSS W+VSDK PGYN SDSDSD+  G++
Sbjct  120  RLRSSVWKVSDKHPGYNASDSDSDEIKGDS  149



>ref|XP_008442362.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
 ref|XP_008442363.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
 ref|XP_008442364.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
Length=100

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  420
            L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W+++A
Sbjct  10   LNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRIWMTKA  69

Query  419  srtrssawRVSDKRPGYNVSDSDSDD  342
            SR+RSS W+VSDK PGYN SDSDSD+
Sbjct  70   SRSRSSVWKVSDKHPGYNASDSDSDE  95



>ref|XP_010039279.1| PREDICTED: uncharacterized protein LOC104427816 isoform X2 [Eucalyptus 
grandis]
Length=108

 Score =   123 bits (309),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ WI++ASR
Sbjct  14   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWITKASR  73

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             RSS W+VSDKRPGYN SDSDSD+
Sbjct  74   IRSSVWKVSDKRPGYNASDSDSDE  97



>ref|XP_009587086.1| PREDICTED: uncharacterized protein LOC104084834 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009587087.1| PREDICTED: uncharacterized protein LOC104084834 isoform X1 [Nicotiana 
tomentosiformis]
Length=189

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 88/108 (81%), Gaps = 14/108 (13%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK------  444
            Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQVLVGQMY+SGYG+SRDAQK      
Sbjct  82   QQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQVLVGQMYYSGYGISRDAQKDVGNAS  141

Query  443  --------GKawisrasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
                    G+AWI+RAS++RSSAW+VSDKRPGYN SDSDSDDT  + K
Sbjct  142  TDRSIWVQGRAWINRASKSRSSAWKVSDKRPGYNASDSDSDDTVEDPK  189



>ref|XP_010256999.1| PREDICTED: uncharacterized protein LOC104597244 [Nelumbo nucifera]
Length=156

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 86/95 (91%), Gaps = 1/95 (1%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            +R  R+PL+EVV+DCV+RWFQDTLKEAKAGD +MQ+LVGQMY+SGYGV RDAQKG+AWI+
Sbjct  62   ERQTRVPLSEVVSDCVKRWFQDTLKEAKAGDSAMQILVGQMYYSGYGVPRDAQKGRAWIT  121

Query  425  rasrtrssawRVSDKRPGYNVSDSDS-DDTAGEAK  324
            RAS++RSSAW+VSDK PGYN SDSDS ++  G+AK
Sbjct  122  RASKSRSSAWKVSDKHPGYNASDSDSEEEVKGDAK  156



>ref|XP_010039170.1| PREDICTED: uncharacterized protein LOC104427816 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039222.1| PREDICTED: uncharacterized protein LOC104427816 isoform X1 [Eucalyptus 
grandis]
Length=149

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ WI++ASR
Sbjct  55   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWITKASR  114

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             RSS W+VSDKRPGYN SDSDSD+
Sbjct  115  IRSSVWKVSDKRPGYNASDSDSDE  138



>ref|XP_010091064.1| hypothetical protein L484_021946 [Morus notabilis]
 gb|EXB42354.1| hypothetical protein L484_021946 [Morus notabilis]
Length=348

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVVTDCV+RWF+DTLKEAK+GDI+MQVLVGQMY+SGYGV RDAQKG+ WI+RASR
Sbjct  260  RLPLSEVVTDCVKRWFKDTLKEAKSGDINMQVLVGQMYYSGYGVPRDAQKGRIWITRASR  319

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEA  327
            TRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  320  TRSSVWKVSDKHPGYNASDSDSDEPKGDS  348



>gb|KCW88248.1| hypothetical protein EUGRSUZ_A00636 [Eucalyptus grandis]
 gb|KCW88249.1| hypothetical protein EUGRSUZ_A00636 [Eucalyptus grandis]
Length=180

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ WI++ASR
Sbjct  86   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWITKASR  145

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             RSS W+VSDKRPGYN SDSDSD+
Sbjct  146  IRSSVWKVSDKRPGYNASDSDSDE  169



>gb|KJB77082.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
 gb|KJB77083.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
 gb|KJB77085.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
Length=149

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            +R+PL+EVV+DCV+RWF+D+LKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ W++RAS
Sbjct  60   QRLPLSEVVSDCVKRWFKDSLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWMTRAS  119

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            R RSS W+VS K PGYN SDSDSD+  G++
Sbjct  120  RLRSSVWKVSHKHPGYNASDSDSDEIKGDS  149



>gb|EYU20083.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
 gb|EYU20084.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
 gb|EYU20085.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
Length=165

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  602  RLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisr  423
            R R  PLA+VV DCV+RWFQDTLKEAK GD SMQVLVGQMY+SGYGV RD+QK KAWI+R
Sbjct  73   RQRMTPLADVVADCVKRWFQDTLKEAKNGDTSMQVLVGQMYYSGYGVGRDSQKAKAWINR  132

Query  422  asrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            ASRTRSS W+V DK PGYN SDSDSDD   EAK
Sbjct  133  ASRTRSSVWKVGDKHPGYNASDSDSDDPKEEAK  165



>ref|XP_006429512.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 ref|XP_006429513.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 ref|XP_006481132.1| PREDICTED: uncharacterized protein LOC102610400 isoform X2 [Citrus 
sinensis]
 gb|ESR42752.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 gb|ESR42753.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 gb|KDO63289.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63290.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63291.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63292.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
Length=115

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV+DCV+RWF+DTLKEAK GDI+MQVLVGQMYFSGYGV+RDAQKG+ WISRASR
Sbjct  27   RVPLSEVVSDCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWISRASR  86

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEA  327
            TRSS W+V +K PGYN SDSDSD+   E+
Sbjct  87   TRSSVWKVGEKHPGYNASDSDSDEMKEES  115



>ref|XP_007026543.1| Uncharacterized protein TCM_021578 [Theobroma cacao]
 gb|EOY07045.1| Uncharacterized protein TCM_021578 [Theobroma cacao]
Length=162

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            +R+PL++VV+DCV+RWF+DTLKEAKAGD++MQVLV QMY+SGYGV RDAQKG+ W++RAS
Sbjct  73   QRLPLSDVVSDCVKRWFKDTLKEAKAGDVNMQVLVSQMYYSGYGVPRDAQKGRIWMTRAS  132

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            R RSS W+VSDK PGYN SDSDSD+  G++
Sbjct  133  RLRSSVWKVSDKHPGYNASDSDSDEMKGDS  162



>ref|XP_007207508.1| hypothetical protein PRUPE_ppa013808mg [Prunus persica]
 ref|XP_008244803.1| PREDICTED: uncharacterized protein LOC103342916 [Prunus mume]
 ref|XP_008244804.1| PREDICTED: uncharacterized protein LOC103342916 [Prunus mume]
 gb|EMJ08707.1| hypothetical protein PRUPE_ppa013808mg [Prunus persica]
Length=102

 Score =   120 bits (300),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+EVV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RDA  G+ WI+RAS
Sbjct  13   HRLPLSEVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDAHMGRIWITRAS  72

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  73   RTRSSVWKVSDKQPGYNASDSDSDELKGDS  102



>ref|XP_007218537.1| hypothetical protein PRUPE_ppa012708mg [Prunus persica]
 gb|EMJ19736.1| hypothetical protein PRUPE_ppa012708mg [Prunus persica]
Length=157

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVGQMY+SGYGVSRDA+KG+AW++RAS+
Sbjct  68   RVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVGQMYYSGYGVSRDAKKGQAWMNRASK  127

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +R+S W+VS+K PGYN SDS+SD+   +AK
Sbjct  128  SRTSVWKVSNKPPGYNASDSNSDELEEDAK  157



>ref|XP_008233834.1| PREDICTED: uncharacterized protein LOC103332851 isoform X1 [Prunus 
mume]
Length=157

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVGQMY+SGYGVSRDA+KG+AW++RAS+
Sbjct  68   RVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVGQMYYSGYGVSRDAKKGQAWMNRASK  127

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +RSS W+VS+K PGYN SDS+SD+   +AK
Sbjct  128  SRSSVWKVSNKPPGYNASDSNSDELEEDAK  157



>gb|KDP22810.1| hypothetical protein JCGZ_00397 [Jatropha curcas]
Length=153

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV+DCV+RWF+DTLK+AK+GDI+MQVLV QMY+SGYGV RDAQKG+ W++RASR
Sbjct  65   RLPLSEVVSDCVKRWFKDTLKDAKSGDINMQVLVSQMYYSGYGVPRDAQKGRIWMTRASR  124

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEA  327
            TRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  125  TRSSVWKVSDKHPGYNASDSDSDELKGDS  153



>ref|XP_007134617.1| hypothetical protein PHAVU_010G062000g [Phaseolus vulgaris]
 gb|ESW06611.1| hypothetical protein PHAVU_010G062000g [Phaseolus vulgaris]
Length=100

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            +R  R+PL+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W++
Sbjct  8    ERSSRVPLSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRVWLT  67

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDD  342
            +ASRTRSS W+V DK PGYN SDSDSD+
Sbjct  68   KASRTRSSVWKVGDKHPGYNASDSDSDE  95



>ref|XP_002520815.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41524.1| conserved hypothetical protein [Ricinus communis]
Length=159

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+ VV+DCVRRWFQDTLKEAKAGDISMQVLVGQMYF+GYG+ +D+QKG+AWI+RAS+
Sbjct  67   RLPLSNVVSDCVRRWFQDTLKEAKAGDISMQVLVGQMYFNGYGIPKDSQKGRAWINRASK  126

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEA  327
            +R SAW+VSDKRPGY  SDSDSD+   +A
Sbjct  127  SRVSAWKVSDKRPGYAASDSDSDEGKDDA  155



>gb|EYU41977.1| hypothetical protein MIMGU_mgv1a016033mg [Erythranthe guttata]
Length=136

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR+PL++VV+DCV RWFQDTLKEAK GD+SMQVLVGQM+ SGYG+ RDA K + W+SRAS
Sbjct  47   RRVPLSDVVSDCVERWFQDTLKEAKTGDVSMQVLVGQMFNSGYGIPRDADKARTWMSRAS  106

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            R RSS W+VS+KRPGYN SDSDSDD AG +
Sbjct  107  RVRSSVWKVSNKRPGYNASDSDSDDLAGNS  136



>ref|XP_011077502.1| PREDICTED: uncharacterized protein LOC105161501 [Sesamum indicum]
 ref|XP_011077503.1| PREDICTED: uncharacterized protein LOC105161501 [Sesamum indicum]
Length=98

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+ VV+DC++RWFQDTLKEA+ GDI+MQVLV QMY+SGYGV+RDA KG+ WI++ASR
Sbjct  10   RLPLSVVVSDCIKRWFQDTLKEARTGDINMQVLVAQMYYSGYGVARDANKGRIWITKASR  69

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEA  327
             RSS W+VS+KRPGYN SDSDSD+ AG++
Sbjct  70   MRSSVWKVSNKRPGYNASDSDSDEMAGDS  98



>ref|XP_010543693.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
 ref|XP_010543694.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
 ref|XP_010543696.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
Length=155

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA+VV DCV+RWFQDTLKEAKAGD+ MQVLVGQMY SGYGV +D QKG+AWI+RASR
Sbjct  69   RVPLAQVVDDCVKRWFQDTLKEAKAGDVGMQVLVGQMYCSGYGVPKDEQKGRAWINRASR  128

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            TRSSAW+VSDKRPGYN SDSDS+D
Sbjct  129  TRSSAWQVSDKRPGYNASDSDSND  152



>ref|XP_006289188.1| hypothetical protein CARUB_v10002629mg [Capsella rubella]
 gb|EOA22086.1| hypothetical protein CARUB_v10002629mg [Capsella rubella]
Length=164

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  420
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QKG+AWIS+A
Sbjct  76   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQKGRAWISKA  135

Query  419  srtrssawRVSDKRPGYNVSDSDSDD  342
            SRTRS+AW+VS K PGYN SDSDS+D
Sbjct  136  SRTRSTAWQVSAKPPGYNASDSDSND  161



>gb|EPS60291.1| hypothetical protein M569_14514 [Genlisea aurea]
Length=161

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  602  RLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisr  423
            R +R+PL+EVV DCV+RWFQDTLKEA+ GD SMQ+L+GQMY++GYGV+RD QKG+A ISR
Sbjct  69   RQQRLPLSEVVADCVKRWFQDTLKEARNGDASMQLLLGQMYYNGYGVARDPQKGRACISR  128

Query  422  asrtrssawRVSDKRPGYNVSDSDSDD  342
            AS+ RSS W++ DK PGYN SDSDSDD
Sbjct  129  ASKNRSSVWKIGDKHPGYNASDSDSDD  155



>ref|XP_011095090.1| PREDICTED: uncharacterized protein LOC105174627 [Sesamum indicum]
 ref|XP_011095091.1| PREDICTED: uncharacterized protein LOC105174627 [Sesamum indicum]
Length=137

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 79/91 (87%), Gaps = 2/91 (2%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV+DC  RWFQDTLKEAKAGD++MQVLVGQMY+SGYGV +DA KGK W++RASR
Sbjct  47   RLPLSEVVSDCTERWFQDTLKEAKAGDVNMQVLVGQMYYSGYGVPKDADKGKFWMNRASR  106

Query  413  trssawRVSDKRPGYNVSDSD--SDDTAGEA  327
             RSS W++S KRPGYN SDSD  SD+ AG++
Sbjct  107  MRSSVWKLSHKRPGYNASDSDSESDELAGDS  137



>ref|XP_010031141.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 ref|XP_010031142.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 ref|XP_010031143.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 gb|KCW50408.1| hypothetical protein EUGRSUZ_J00156 [Eucalyptus grandis]
 gb|KCW50409.1| hypothetical protein EUGRSUZ_J00156 [Eucalyptus grandis]
Length=171

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            +R  R+PLA+VV+DC RRWFQDTL+EAKAGD +MQVLVGQMY SGYGV RD QKG+AWI+
Sbjct  78   ERNTRLPLAQVVSDCARRWFQDTLREAKAGDGAMQVLVGQMYNSGYGVPRDPQKGRAWIN  137

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +AS+ RSS WRVSDK+PGYN SDSDS +  G+ K
Sbjct  138  KASKARSSVWRVSDKQPGYNASDSDSGEMDGDKK  171



>ref|NP_001238121.1| uncharacterized protein LOC100527831 [Glycine max]
 ref|XP_006572841.1| PREDICTED: uncharacterized protein LOC100527831 isoform X1 [Glycine 
max]
 gb|ACU17021.1| unknown [Glycine max]
 gb|KHN44844.1| hypothetical protein glysoja_024415 [Glycine soja]
Length=100

 Score =   114 bits (286),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            +R  R+ L+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY+ GYGV RDAQKG+ W++
Sbjct  8    ERSERVALSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYYGGYGVPRDAQKGRVWLT  67

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDD  342
            +ASRTRSS W+V DK PGYN SDSDSD+
Sbjct  68   KASRTRSSVWKVGDKHPGYNASDSDSDE  95



>ref|XP_008782586.1| PREDICTED: uncharacterized protein LOC103702077 [Phoenix dactylifera]
Length=155

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR+PL+EVV+DCVRRWFQD L+EAK GD +MQVLVGQMY SGYG  R+ QKGKAWI++AS
Sbjct  65   RRVPLSEVVSDCVRRWFQDALREAKNGDAAMQVLVGQMYHSGYGCPRNEQKGKAWIAKAS  124

Query  416  rtrssawRVSDKRPGYNVSDSDSDDT  339
            + RS+ W+VSDK PGYN SDSD+D+ 
Sbjct  125  KYRSAVWKVSDKHPGYNASDSDTDEV  150



>ref|XP_008370217.1| PREDICTED: uncharacterized protein LOC103433722 isoform X2 [Malus 
domestica]
 ref|XP_008345562.1| PREDICTED: uncharacterized protein LOC103408493 isoform X2 [Malus 
domestica]
Length=106

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  17   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  76

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  77   RTRSSVWKVSDKQPGYNASDSDSDELKGDS  106



>ref|XP_003623468.1| hypothetical protein MTR_7g071210 [Medicago truncatula]
 gb|AES79686.1| hypothetical protein MTR_7g071210 [Medicago truncatula]
Length=100

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+ VV DCV+RWF+DTL+EAKAGD++MQ+LVGQMY SGYGV++DAQKGK W+++ASR
Sbjct  12   RFPLSGVVADCVKRWFKDTLREAKAGDVNMQILVGQMYCSGYGVAKDAQKGKLWLTKASR  71

Query  413  trssawRVSDKRPGYNVSDSDSDDT  339
             RSS W+V DKRPGYN SDSDSD++
Sbjct  72   VRSSVWKVGDKRPGYNASDSDSDES  96



>ref|XP_010921063.1| PREDICTED: uncharacterized protein LOC105044761 [Elaeis guineensis]
Length=169

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR+PL+EVV+DCVRRWFQD L+EAK GD +MQVLVGQMY SGYG  R+ QKGKAWI++AS
Sbjct  79   RRVPLSEVVSDCVRRWFQDALREAKNGDAAMQVLVGQMYHSGYGCPRNEQKGKAWIAKAS  138

Query  416  rtrssawRVSDKRPGYNVSDSDSDDT  339
            + RS+ W+VSDK PGYN SDSDSD+ 
Sbjct  139  KYRSTVWKVSDKHPGYNASDSDSDEV  164



>ref|XP_008370215.1| PREDICTED: uncharacterized protein LOC103433722 isoform X1 [Malus 
domestica]
 ref|XP_008370216.1| PREDICTED: uncharacterized protein LOC103433722 isoform X1 [Malus 
domestica]
 ref|XP_008345560.1| PREDICTED: uncharacterized protein LOC103408493 isoform X1 [Malus 
domestica]
 ref|XP_008345561.1| PREDICTED: uncharacterized protein LOC103408493 isoform X1 [Malus 
domestica]
Length=151

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  62   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  121

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  122  RTRSSVWKVSDKQPGYNASDSDSDELKGDS  151



>ref|XP_009369229.1| PREDICTED: uncharacterized protein LOC103958662 [Pyrus x bretschneideri]
Length=151

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA VV+DCVRRWFQDTLKEAKAGD SMQVLVGQMY SGYGV +D +KG AW+++AS+
Sbjct  62   RVPLARVVSDCVRRWFQDTLKEAKAGDSSMQVLVGQMYCSGYGVPKDPKKGHAWMNKASK  121

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +R+S W+VSDK PGYN SDS+SD+   + K
Sbjct  122  SRASVWKVSDKPPGYNASDSNSDELKDDTK  151



>ref|XP_008355547.1| PREDICTED: uncharacterized protein LOC103419212 [Malus domestica]
Length=152

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA VV+DCVRRWFQDTLKEAKAGD SMQVLVGQMY SGYGV +D +KG AW+++AS+
Sbjct  63   RVPLARVVSDCVRRWFQDTLKEAKAGDSSMQVLVGQMYCSGYGVPKDPKKGHAWMNKASK  122

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +R+S W+VSDK PGYN SDS+SD+   + K
Sbjct  123  SRASVWKVSDKPPGYNASDSNSDELKDDTK  152



>gb|AAO42324.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00521.1| hypothetical protein [Arabidopsis thaliana]
Length=157

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  420
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  69   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  128

Query  419  srtrssawRVSDKRPGYNVSDSDSDD  342
            SRTRSSAW+VSDK PGYN SDSDS+D
Sbjct  129  SRTRSSAWQVSDKPPGYNASDSDSND  154



>gb|KFK24957.1| hypothetical protein AALP_AA8G047700 [Arabis alpina]
Length=155

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  69   RIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  128

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            TRSSAW+VSDK PGYN SDSDS+D
Sbjct  129  TRSSAWQVSDKPPGYNASDSDSND  152



>ref|XP_009350684.1| PREDICTED: uncharacterized protein LOC103942213 [Pyrus x bretschneideri]
Length=151

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA VV+DCVRRWFQDTLKEAKAGD SMQVLVGQMY SGYGV +D +KG AW+++AS+
Sbjct  62   RVPLARVVSDCVRRWFQDTLKEAKAGDSSMQVLVGQMYCSGYGVPKDPKKGHAWMNKASK  121

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +R+S W+VSDK PGYN SDS+SD+   + K
Sbjct  122  SRASVWKVSDKPPGYNASDSNSDELKDDTK  151



>emb|CDX98838.1| BnaC09g49970D [Brassica napus]
Length=160

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  74   RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  133

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            TRSSAW+VSDK PGYN SDSDS+D
Sbjct  134  TRSSAWQVSDKPPGYNASDSDSND  157



>ref|NP_196155.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90864.1| uncharacterized protein AT5G05360 [Arabidopsis thaliana]
Length=163

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  420
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  134

Query  419  srtrssawRVSDKRPGYNVSDSDSDD  342
            SRTRSSAW+VSDK PGYN SDSDS+D
Sbjct  135  SRTRSSAWQVSDKPPGYNASDSDSND  160



>ref|XP_008388305.1| PREDICTED: uncharacterized protein LOC103450710 [Malus domestica]
 ref|XP_008388306.1| PREDICTED: uncharacterized protein LOC103450711 [Malus domestica]
Length=106

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV+RDA  G+ WI+RAS
Sbjct  17   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVARDAHMGRVWITRAS  76

Query  416  rtrssawRVSDKRPGYNVSDSDSDD  342
            RTRSSAW+V DK+PGYN SDSDSD+
Sbjct  77   RTRSSAWKVGDKQPGYNASDSDSDE  101



>ref|XP_003522147.1| PREDICTED: uncharacterized protein LOC100794599 isoform X1 [Glycine 
max]
 ref|XP_006576459.1| PREDICTED: uncharacterized protein LOC100794599 isoform X2 [Glycine 
max]
 ref|XP_006576460.1| PREDICTED: uncharacterized protein LOC100794599 isoform X3 [Glycine 
max]
 ref|XP_006576461.1| PREDICTED: uncharacterized protein LOC100794599 isoform X4 [Glycine 
max]
 ref|XP_006576462.1| PREDICTED: uncharacterized protein LOC100794599 isoform X5 [Glycine 
max]
 ref|XP_006576463.1| PREDICTED: uncharacterized protein LOC100794599 isoform X6 [Glycine 
max]
 gb|KHN33246.1| hypothetical protein glysoja_027933 [Glycine soja]
Length=100

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            +R  R+ L+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY SGYGV RDAQKG+ W++
Sbjct  8    ERSGRVALSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYNSGYGVPRDAQKGRVWVT  67

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDD  342
            +AS+ RSS W+V DK PGYN SDSDSD+
Sbjct  68   KASKARSSVWKVGDKHPGYNASDSDSDE  95



>ref|XP_006398999.1| hypothetical protein EUTSA_v10014886mg [Eutrema salsugineum]
 gb|ESQ40452.1| hypothetical protein EUTSA_v10014886mg [Eutrema salsugineum]
Length=161

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  75   RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  134

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            +RSSAW+VSDK PGYN SDSDS+D
Sbjct  135  SRSSAWQVSDKPPGYNASDSDSND  158



>emb|CDX70156.1| BnaA10g25050D [Brassica napus]
Length=160

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  74   RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  133

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            TRSSAW+VSDK PGYN SDSDS+D
Sbjct  134  TRSSAWQVSDKPPGYNASDSDSND  157



>ref|XP_009122145.1| PREDICTED: uncharacterized protein LOC103846889 [Brassica rapa]
Length=160

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  74   RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  133

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            TRSSAW+VSDK PGYN SDSDS+D
Sbjct  134  TRSSAWQVSDKPPGYNASDSDSND  157



>ref|XP_002315124.1| hypothetical protein POPTR_0010s18960g [Populus trichocarpa]
 gb|EEF01295.1| hypothetical protein POPTR_0010s18960g [Populus trichocarpa]
Length=150

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            +R+PL +VV+DC +RWF+DTLKEAK GDISMQVLVGQMYF+GYGV +D +KG AWISRAS
Sbjct  63   KRVPLGQVVSDCAKRWFEDTLKEAKTGDISMQVLVGQMYFNGYGVPKDVEKGSAWISRAS  122

Query  416  rtrssawRVSDKRPGYNVSDSDSDD  342
            + R+S W+VS+KRPGYN SDSDS+D
Sbjct  123  KRRASVWKVSNKRPGYNGSDSDSED  147



>ref|XP_008233835.1| PREDICTED: uncharacterized protein LOC103332851 isoform X2 [Prunus 
mume]
Length=155

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVGQMY+SGYGVSRDA+K   W++RAS+
Sbjct  68   RVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVGQMYYSGYGVSRDAKKA--WMNRASK  125

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +RSS W+VS+K PGYN SDS+SD+   +AK
Sbjct  126  SRSSVWKVSNKPPGYNASDSNSDELEEDAK  155



>ref|XP_010491070.1| PREDICTED: uncharacterized protein LOC104768733 [Camelina sativa]
Length=167

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  420
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+AWIS+A
Sbjct  79   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGRAWISKA  138

Query  419  srtrssawRVSDKRPGYNVSDSDSDD  342
            SRTRSSAW+VS+K PGYN SDSDS+D
Sbjct  139  SRTRSSAWQVSEKPPGYNASDSDSND  164



>ref|XP_009373106.1| PREDICTED: uncharacterized protein LOC103962156 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009373107.1| PREDICTED: uncharacterized protein LOC103962156 isoform X3 [Pyrus 
x bretschneideri]
Length=108

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  19   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  78

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  79   RTRSSVWKVSDKQPGYNASDSDSDELKGDS  108



>ref|XP_008355552.1| PREDICTED: uncharacterized protein LOC103419214 [Malus domestica]
Length=151

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            +R  R+PLA  V+DCVRRWFQDTLKEA+AGD SMQVLVGQMY SGYGV +D +KG AW++
Sbjct  58   ERQNRVPLARKVSDCVRRWFQDTLKEARAGDSSMQVLVGQMYCSGYGVPKDPRKGHAWMN  117

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +AS++R+S W+VSDK PGYN SDS+SD+   + K
Sbjct  118  KASKSRASVWKVSDKPPGYNASDSNSDELKDDTK  151



>ref|XP_009373105.1| PREDICTED: uncharacterized protein LOC103962156 isoform X2 [Pyrus 
x bretschneideri]
Length=153

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  64   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  123

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  124  RTRSSVWKVSDKQPGYNASDSDSDELKGDS  153



>ref|XP_010452441.1| PREDICTED: uncharacterized protein LOC104734539 [Camelina sativa]
Length=170

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  420
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+AWIS+A
Sbjct  82   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGRAWISKA  141

Query  419  srtrssawRVSDKRPGYNVSDSDSDD  342
            SRTRSSAW+VS K PGYN SDSDS+D
Sbjct  142  SRTRSSAWQVSSKPPGYNASDSDSND  167



>ref|XP_009373104.1| PREDICTED: uncharacterized protein LOC103962156 isoform X1 [Pyrus 
x bretschneideri]
Length=159

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  70   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  129

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  130  RTRSSVWKVSDKQPGYNASDSDSDELKGDS  159



>ref|XP_010423476.1| PREDICTED: uncharacterized protein LOC104708579 [Camelina sativa]
Length=170

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  420
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+AWIS+A
Sbjct  82   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGRAWISKA  141

Query  419  srtrssawRVSDKRPGYNVSDSDSDD  342
            SRTRSSAW+VS K PGYN SDSDS+D
Sbjct  142  SRTRSSAWQVSSKPPGYNASDSDSND  167



>ref|XP_011076630.1| PREDICTED: uncharacterized protein LOC105160829 [Sesamum indicum]
Length=163

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR+PL+EVV DCV+RWFQDTLKEAK GDI+MQVLVGQMY+SGYGV+RDAQKG+AWI+RAS
Sbjct  73   RRMPLSEVVADCVKRWFQDTLKEAKNGDIAMQVLVGQMYYSGYGVARDAQKGRAWINRAS  132

Query  416  rtrssawRVSDKRPGYNV  363
            ++RSS W+V DK PGYN 
Sbjct  133  KSRSSVWKVGDKHPGYNA  150



>ref|XP_011015169.1| PREDICTED: uncharacterized protein LOC105118821 [Populus euphratica]
Length=150

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -2

Query  590  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrt  411
            +PL +VV+DC +RWF+DTLKEAK GDISMQVLVGQMYF+GYGV +D +KG AWISRAS+ 
Sbjct  65   VPLGQVVSDCAKRWFEDTLKEAKTGDISMQVLVGQMYFNGYGVPKDVEKGSAWISRASKR  124

Query  410  rssawRVSDKRPGYNVSDSDSDD  342
            R+S W+VS+KRPGYN SDSDS+D
Sbjct  125  RASVWKVSNKRPGYNGSDSDSED  147



>ref|XP_010529121.1| PREDICTED: uncharacterized protein LOC104806101 [Tarenaya hassleriana]
Length=145

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR PL+ VV DC +RWF+DTL+EAKAGD  MQVLVGQMY++GYGV RDA+KG+ WI++AS
Sbjct  62   RRFPLSAVVADCAKRWFKDTLQEAKAGDTGMQVLVGQMYYTGYGVPRDARKGRLWITKAS  121

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            + RSS W V DK PGYN SDSDSD
Sbjct  122  KIRSSVWSVKDKHPGYNASDSDSD  145



>ref|XP_010695454.1| PREDICTED: uncharacterized protein LOC104908080 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695460.1| PREDICTED: uncharacterized protein LOC104908080 [Beta vulgaris 
subsp. vulgaris]
Length=160

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLAEVV+DC RRWFQDTLKEA+ GD +MQVLVGQMY SGYGV ++ +KG+ WI+RAS+
Sbjct  72   RVPLAEVVSDCARRWFQDTLKEARDGDTAMQVLVGQMYNSGYGVPKNTEKGRTWITRASK  131

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            +RSSAWRVSDK+PGYN SDS+S D
Sbjct  132  SRSSAWRVSDKQPGYNASDSESQD  155



>ref|XP_010683583.1| PREDICTED: uncharacterized protein LOC104898233 [Beta vulgaris 
subsp. vulgaris]
Length=104

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R  L+EVV DCVRRWFQDTLKEAK GD++MQVLV QMY +GYGV +D QK KAW+SRASR
Sbjct  15   RKALSEVVADCVRRWFQDTLKEAKGGDVNMQVLVSQMYTAGYGVPKDTQKAKAWMSRASR  74

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
             RSS WRVS+K PGYN SDSDSD+  G+A+
Sbjct  75   VRSSVWRVSEKHPGYNASDSDSDELMGDAR  104



>gb|ABK26779.1| unknown [Picea sitchensis]
Length=144

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL EVV DC RRWFQD+LKEAKAGD  MQVLVGQMY SGYGV RD Q+GKAW  +A++
Sbjct  55   RLPLKEVVADCARRWFQDSLKEAKAGDTGMQVLVGQMYCSGYGVHRDIQRGKAWFQKAAK  114

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            +RS    +  KRPGYN S+SDSDD
Sbjct  115  SRSRVLNLVAKRPGYNASESDSDD  138



>ref|XP_004492521.1| PREDICTED: uncharacterized protein LOC101512157 isoform X1 [Cicer 
arietinum]
Length=100

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+ +V DCV+RWF+D L+EAKAGD++MQVLVGQMY++GYGV +DAQKG+ W+++ASR
Sbjct  12   RVPLSGMVADCVKRWFKDALREAKAGDVNMQVLVGQMYYNGYGVPKDAQKGRIWLTKASR  71

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             RSS W+V DKRPGYN SDSDS++
Sbjct  72   VRSSVWKVGDKRPGYNASDSDSEE  95



>ref|XP_006435843.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 ref|XP_006435844.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 gb|ESR49083.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 gb|ESR49084.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
Length=101

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M+VLVGQMY SGYGV+RD +KG AWI 
Sbjct  8    QQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAMEVLVGQMYLSGYGVARDEKKGHAWIK  67

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            RA+ +RSSAW++ DK PGY  SDSDSD+  G+ K
Sbjct  68   RAATSRSSAWKLRDKPPGYAASDSDSDELKGDTK  101



>dbj|BAJ91570.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K + W+ +ASR
Sbjct  70   RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKSRIWMEKASR  129

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
             RS+ W+V +KRPGYN SDSDSDD    AK
Sbjct  130  YRSTVWKVCNKRPGYNASDSDSDDVKETAK  159



>ref|XP_007008833.1| Uncharacterized protein TCM_042415 [Theobroma cacao]
 gb|EOY17643.1| Uncharacterized protein TCM_042415 [Theobroma cacao]
Length=157

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            RIPLA+VV+D V+ WFQD LKEAKAGD +MQVLVGQMY SG+GV +D QKG AWI +ASR
Sbjct  68   RIPLAQVVSDLVKGWFQDALKEAKAGDTNMQVLVGQMYCSGFGVPKDVQKGLAWIGKASR  127

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +RSS W+VSDK PGYN SDSDSD+  G+AK
Sbjct  128  SRSSVWKVSDKHPGYNASDSDSDELKGDAK  157



>gb|KGN65322.1| hypothetical protein Csa_1G324870 [Cucumis sativus]
Length=85

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            + L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W++
Sbjct  8    EALNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRIWMT  67

Query  425  rasrtrssawRVSDKRPG  372
            +ASR+RSS W+VSDK PG
Sbjct  68   KASRSRSSVWKVSDKHPG  85



>ref|XP_009402772.1| PREDICTED: uncharacterized protein LOC103986477, partial [Musa 
acuminata subsp. malaccensis]
Length=155

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL EVV DC RRWFQD LKEA+AGD  MQVLVGQMY SGYGV ++ QK  AWI++AS+
Sbjct  64   RVPLKEVVADCTRRWFQDALKEARAGDAGMQVLVGQMYHSGYGVLKNDQKADAWIAKASK  123

Query  413  trssawRVSDKRPGYNVSDSDSDDT  339
             RSS W+VSDKRPGYN SDSDSDD 
Sbjct  124  YRSSVWKVSDKRPGYNASDSDSDDN  148



>ref|XP_008809978.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
 ref|XP_008809979.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
 ref|XP_008809980.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
Length=166

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            RR+PL+EVV+DCVRRWFQD L EA+ GD  MQVLVGQMY SGYG  R+ QKGKAWI++AS
Sbjct  76   RRVPLSEVVSDCVRRWFQDALNEARTGDPGMQVLVGQMYHSGYGCPRNEQKGKAWIAKAS  135

Query  416  rtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            R RS+AW+VS K PGYN SDSDSD+   + K
Sbjct  136  RYRSAAWKVSYKHPGYNASDSDSDEAKDDVK  166



>ref|XP_006486231.1| PREDICTED: uncharacterized protein LOC102630879 isoform X1 [Citrus 
sinensis]
 ref|XP_006486232.1| PREDICTED: uncharacterized protein LOC102630879 isoform X2 [Citrus 
sinensis]
 ref|XP_006486233.1| PREDICTED: uncharacterized protein LOC102630879 isoform X3 [Citrus 
sinensis]
Length=160

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M+VLVGQMY SGYGV+RD +KG AWI 
Sbjct  67   QQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAMEVLVGQMYLSGYGVARDEKKGHAWIK  126

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            RA+ +RSSAW++ DK PGY  SDSDSD+  G+ K
Sbjct  127  RAATSRSSAWKLRDKPPGYAASDSDSDELKGDTK  160



>ref|XP_009416310.1| PREDICTED: uncharacterized protein LOC103996957 [Musa acuminata 
subsp. malaccensis]
Length=153

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL +VV DC RRWFQD LKEA+AGD +MQVLVGQMY SGYGV R+ QK   WIS+AS+
Sbjct  63   RVPLKDVVADCTRRWFQDALKEARAGDAAMQVLVGQMYHSGYGVPRNEQKAYTWISKASK  122

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             RSS W+VSDKRPGYN SDSD+D+
Sbjct  123  YRSSVWKVSDKRPGYNASDSDTDE  146



>gb|AAC28759.2| expressed protein [Arabidopsis thaliana]
 gb|ABD38894.1| At2g38450 [Arabidopsis thaliana]
Length=105

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  20   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDARKGRLWITKAS  79

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            R RSS W+V DKRPGYN SDSDS+
Sbjct  80   RVRSSVWKVIDKRPGYNASDSDSE  103



>ref|NP_001144203.1| uncharacterized protein LOC100277064 [Zea mays]
 gb|ACG38663.1| hypothetical protein [Zea mays]
 gb|ACG42742.1| hypothetical protein [Zea mays]
 gb|ACL54176.1| unknown [Zea mays]
 tpg|DAA44916.1| TPA: hypothetical protein ZEAMMB73_023403 [Zea mays]
Length=170

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K + W+ +ASR
Sbjct  79   RVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKARVWMEKASR  138

Query  413  trssawRVSDKRPGYNVSDSDS  348
             RS+ W+VS+KRPGYN SDSDS
Sbjct  139  YRSTVWKVSNKRPGYNASDSDS  160



>ref|XP_002879746.1| hypothetical protein ARALYDRAFT_345628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56005.1| hypothetical protein ARALYDRAFT_345628 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  54   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDAKKGRLWITKAS  113

Query  416  rtrssawRVSDKRPGYNVSDSDS  348
            R RSS W+V DKRPGYN SDSDS
Sbjct  114  RVRSSVWKVKDKRPGYNASDSDS  136



>ref|XP_010509118.1| PREDICTED: uncharacterized protein LOC104785576 [Camelina sativa]
Length=142

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  57   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGRLWITKAS  116

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            + RSS W+V DKRPGYN SDSDS+
Sbjct  117  KVRSSVWKVKDKRPGYNASDSDSE  140



>ref|XP_009421405.1| PREDICTED: uncharacterized protein LOC104000960 [Musa acuminata 
subsp. malaccensis]
Length=96

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -2

Query  590  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrt  411
            +PL EVV DCVRRWFQD LKEA+AGD+SMQVLV QMY SGYGV+++ QK   WI++ASR 
Sbjct  11   VPLKEVVADCVRRWFQDALKEARAGDVSMQVLVAQMYHSGYGVAKNEQKANVWITKASRY  70

Query  410  rssawRVSDKRPGYNVSDSDSDD  342
            RS+  +VSDK PGYN SDS SD+
Sbjct  71   RSAVRKVSDKHPGYNASDSYSDE  93



>ref|XP_003558119.1| PREDICTED: uncharacterized protein LOC100845835 [Brachypodium 
distachyon]
Length=157

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  426
            Q   R+PL EVV DC +RWFQD+LKEA+AGD +MQVLVGQMY SGYGV+++  K + W+ 
Sbjct  64   QEHERVPLGEVVLDCTKRWFQDSLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKARIWME  123

Query  425  rasrtrssawRVSDKRPGYNVSDSDSDD  342
            +ASR RS+ W+VS+KRPGYN SDSD+DD
Sbjct  124  KASRYRSTVWKVSNKRPGYNASDSDTDD  151



>gb|KHN31321.1| hypothetical protein glysoja_022975 [Glycine soja]
Length=159

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVGQMY+SGYGV+RD QKG AWIS+ASR
Sbjct  67   RTPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVGQMYYSGYGVARDPQKGHAWISKASR  126

Query  413  trssawRVSDKRPGYNVSDSDS  348
             R+S W++  KRPGY  SDSDS
Sbjct  127  NRNSVWKLCGKRPGYRASDSDS  148



>ref|XP_003552182.1| PREDICTED: uncharacterized protein LOC100779520 [Glycine max]
Length=159

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVGQMY+SGYGV+RD QKG AWIS+ASR
Sbjct  67   RTPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVGQMYYSGYGVARDPQKGHAWISKASR  126

Query  413  trssawRVSDKRPGYNVSDSDS  348
             R+S W++  KRPGY  SDSDS
Sbjct  127  NRNSVWKLCGKRPGYRASDSDS  148



>ref|NP_565889.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09538.1| uncharacterized protein AT2G38450 [Arabidopsis thaliana]
Length=138

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  53   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDARKGRLWITKAS  112

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            R RSS W+V DKRPGYN SDSDS+
Sbjct  113  RVRSSVWKVIDKRPGYNASDSDSE  136



>gb|KFK36738.1| hypothetical protein AALP_AA4G163100 [Arabis alpina]
Length=106

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAK G+I+MQVL+GQMY+SGYGV +D++KG+ WI++AS
Sbjct  23   RYVPLSSVVSDCAKRWFKDTLEEAKGGNITMQVLLGQMYYSGYGVPKDSRKGRLWITKAS  82

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            R RSS W+V DKRPGYN SDSDSD
Sbjct  83   RVRSSVWKVKDKRPGYNASDSDSD  106



>ref|XP_006295208.1| hypothetical protein CARUB_v10024290mg [Capsella rubella]
 gb|EOA28106.1| hypothetical protein CARUB_v10024290mg [Capsella rubella]
Length=137

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY SGYG+ +DA+KGK WI++AS
Sbjct  52   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYNSGYGIPKDAKKGKLWITKAS  111

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            R RSS W+V DKRPGYN SDSDS+
Sbjct  112  RVRSSVWKVKDKRPGYNASDSDSE  135



>ref|XP_004307701.1| PREDICTED: uncharacterized protein LOC101294508 [Fragaria vesca 
subsp. vesca]
Length=154

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLA VV+DC +RWFQDTLKEAK GD +MQVLVGQMY SGYGV ++ +KG AWISRASR
Sbjct  65   RVPLARVVSDCAKRWFQDTLKEAKGGDTAMQVLVGQMYHSGYGVEKNPEKGHAWISRASR  124

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
            +R + W+VS K+PGY+ SDSDSD+    AK
Sbjct  125  SRRAVWKVSQKQPGYHASDSDSDELEDVAK  154



>ref|XP_010505467.1| PREDICTED: uncharacterized protein LOC104782284 [Camelina sativa]
Length=143

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  58   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGRLWITKAS  117

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            R RSS W+V DKRPGYN SDSDS+
Sbjct  118  RVRSSVWKVKDKRPGYNASDSDSE  141



>ref|XP_007163593.1| hypothetical protein PHAVU_001G247500g [Phaseolus vulgaris]
 gb|ESW35587.1| hypothetical protein PHAVU_001G247500g [Phaseolus vulgaris]
Length=156

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLA+VV DC +RWFQDTL+EAKAGD SMQVLVGQMY SGYGV RD QKG  WIS+A++
Sbjct  64   RTPLAKVVADCAKRWFQDTLREAKAGDTSMQVLVGQMYNSGYGVPRDPQKGHGWISKAAK  123

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             R+S W+V  KRPGY  SDSDS D
Sbjct  124  NRNSVWKVCGKRPGYRASDSDSCD  147



>ref|XP_002265673.1| PREDICTED: uncharacterized protein LOC100243041 isoform X2 [Vitis 
vinifera]
Length=99

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
             R+PL+EVV+DCV+RWFQDTL+EAK+GD+SMQVLVGQMY+SGYGV RDAQKG+ W++RAS
Sbjct  11   HRVPLSEVVSDCVKRWFQDTLREAKSGDVSMQVLVGQMYYSGYGVPRDAQKGRVWMTRAS  70

Query  416  rtrssawRVSDKRPG  372
            RTRSS W+VSDK PG
Sbjct  71   RTRSSVWKVSDKHPG  85



>ref|XP_009421407.1| PREDICTED: uncharacterized protein LOC104000963 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  590  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrt  411
            +PL EVV DC RRWFQD LKEA++GD+SMQ+LV QMY SGYGV+++ QK   WI++ASR 
Sbjct  57   VPLKEVVADCARRWFQDALKEARSGDVSMQILVAQMYHSGYGVAKNEQKANVWITKASRY  116

Query  410  rssawRVSDKRPGYNVSDSDSDD  342
            RS+ W+VSDK PGYN SDSDSD+
Sbjct  117  RSAVWKVSDKHPGYNASDSDSDE  139



>ref|XP_010517139.1| PREDICTED: uncharacterized protein LOC104792648 isoform X1 [Camelina 
sativa]
Length=144

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  59   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGRLWITKAS  118

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            R RSS W+V DKRPGYN SDSDS+
Sbjct  119  RVRSSVWKVKDKRPGYNASDSDSE  142



>gb|KHN04800.1| hypothetical protein glysoja_031900 [Glycine soja]
Length=144

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLA+VV DC +RWFQDTLKEAKAGD +MQVLVGQMY+SGYGV RD QKG  WIS+ASR
Sbjct  63   RTPLAKVVADCSKRWFQDTLKEAKAGDSAMQVLVGQMYYSGYGVPRDPQKGHVWISKASR  122

Query  413  trssawRVSDKRPGYNVSDSDS  348
             R+S W+V  KRPGY  SDSDS
Sbjct  123  NRNSVWKVCGKRPGYRASDSDS  144



>gb|AAM62527.1| unknown [Arabidopsis thaliana]
Length=105

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC + WF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  20   RFVPLSSVVSDCAKXWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDAKKGRLWITKAS  79

Query  416  rtrssawRVSDKRPGYNVSDSDSD  345
            R RSS W+V DKRPGYN SDSDS+
Sbjct  80   RVRSSVWKVIDKRPGYNASDSDSE  103



>ref|XP_009406892.1| PREDICTED: uncharacterized protein LOC103989686 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL +VV DC RRWFQD LKEA+AGD +MQVLVGQMY +GYG++++ QK  AWI++AS 
Sbjct  65   RVPLRDVVADCTRRWFQDALKEARAGDAAMQVLVGQMYHNGYGIAKNEQKAHAWITKASN  124

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             RSS W+VSDKRPGYN SDSDS++
Sbjct  125  YRSSVWKVSDKRPGYNASDSDSEE  148



>ref|XP_007140174.1| hypothetical protein PHAVU_008G090100g [Phaseolus vulgaris]
 gb|ESW12168.1| hypothetical protein PHAVU_008G090100g [Phaseolus vulgaris]
Length=94

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL++VV DC +RWF+DTLKEAKAGD++MQVLV QMY+ GYG+ +D QKG+ W+++ASR
Sbjct  6    RVPLSDVVADCAKRWFKDTLKEAKAGDVNMQVLVSQMYYHGYGIPKDGQKGRVWLTKASR  65

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             RSS WRV  K PGYN SDS+SDD
Sbjct  66   VRSSVWRVGRKPPGYNASDSESDD  89



>gb|AFK39264.1| unknown [Lotus japonicus]
Length=101

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV DCV+RWF+DTLKEAK GDI+MQVLVGQMY +GYGV +DAQKG+ W+++ASR
Sbjct  13   RVPLSEVVADCVKRWFKDTLKEAKGGDINMQVLVGQMYCTGYGVPKDAQKGRIWLTKASR  72

Query  413  trssawRVSDKRPGYN  366
             RSS W+V DKRPGYN
Sbjct  73   VRSSVWKVGDKRPGYN  88



>gb|ACU23149.1| unknown [Glycine max]
Length=159

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVGQMY+SGYGV+RD QKG AWIS+ASR
Sbjct  67   RTPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVGQMYYSGYGVARDPQKGHAWISKASR  126

Query  413  trssawRVSDKRPGYNVSDSDS  348
             R+S W++  KRPGY  SD DS
Sbjct  127  NRNSVWKLCGKRPGYRASDFDS  148



>gb|KJB67482.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
 gb|KJB67483.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
Length=157

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            RIPLA+VV++ V+ WFQ+ LKEAKAGD +MQVLVGQMY +GYGV +D QKG+AWIS+ASR
Sbjct  68   RIPLAQVVSELVKGWFQEALKEAKAGDTNMQVLVGQMYCNGYGVPKDVQKGRAWISKASR  127

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            +RSS W+VSDK PGYN SDSDSD+
Sbjct  128  SRSSVWKVSDKHPGYNASDSDSDE  151



>ref|XP_002312191.1| hypothetical protein POPTR_0008s07490g [Populus trichocarpa]
 gb|EEE89558.1| hypothetical protein POPTR_0008s07490g [Populus trichocarpa]
Length=102

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            +R+PL  VV+DC +RWFQDTLKEAK GDI+MQVLVGQMYF+GYGV +D +KG  W+SRAS
Sbjct  12   KRVPLGLVVSDCAKRWFQDTLKEAKTGDITMQVLVGQMYFNGYGVPKDVEKGSDWMSRAS  71

Query  416  rtrssawRVSDKRPGYN  366
            + R S W+VSDKRPGYN
Sbjct  72   KRRMSVWKVSDKRPGYN  88



>emb|CDY07730.1| BnaA03g17810D [Brassica napus]
Length=141

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  590  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrt  411
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+KG+ WI++AS+ 
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARKGRVWITKASKV  117

Query  410  rssawRVSDKRPGYNVSDSDS  348
            RSS W+V +KRPGYN SDSDS
Sbjct  118  RSSVWKVMNKRPGYNASDSDS  138



>ref|XP_006481131.1| PREDICTED: uncharacterized protein LOC102610400 isoform X1 [Citrus 
sinensis]
Length=116

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV+DCV+RWF+DTLKEAK GDI+MQVLVGQMYFSGYGV+RDAQKG+ WISRASR
Sbjct  27   RVPLSEVVSDCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWISRASR  86

Query  413  trssawRVSDKRPG  372
            TRSS W+V +K PG
Sbjct  87   TRSSVWKVGEKHPG  100



>ref|XP_006654273.1| PREDICTED: uncharacterized protein LOC102714375 [Oryza brachyantha]
Length=105

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+EVV DCV+RWFQD LKEA+ GD +MQVLV QMY SGYG+ +   KG+AW  +ASR
Sbjct  15   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQVLVAQMYHSGYGIPKSEHKGRAWAEKASR  74

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEAK  324
             R S W+V  KRPGYN SDSDSD+T  + K
Sbjct  75   YRPSVWKVGTKRPGYNASDSDSDETNNDEK  104



>ref|XP_009133257.1| PREDICTED: uncharacterized protein LOC103857784 isoform X1 [Brassica 
rapa]
 emb|CDY14460.1| BnaC03g21350D [Brassica napus]
Length=141

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -2

Query  590  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrt  411
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+KG+ WI++AS+ 
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARKGRVWITKASKV  117

Query  410  rssawRVSDKRPGYNVSDSDS  348
            RSS W+V +KRPGYN SDSDS
Sbjct  118  RSSVWKVMNKRPGYNASDSDS  138



>ref|XP_011005568.1| PREDICTED: uncharacterized protein LOC105111778 [Populus euphratica]
 ref|XP_011005640.1| PREDICTED: uncharacterized protein LOC105111778 [Populus euphratica]
Length=102

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            +R+PL  VV+DC +RWFQD LKEAK GDI+MQVLVGQMYF+GYGV +D +KG  W+SRAS
Sbjct  12   KRVPLGLVVSDCAKRWFQDALKEAKTGDITMQVLVGQMYFNGYGVPKDVEKGSYWMSRAS  71

Query  416  rtrssawRVSDKRPGYN  366
            + R S W+VSDKRPGYN
Sbjct  72   KRRMSVWKVSDKRPGYN  88



>ref|XP_004137693.1| PREDICTED: uncharacterized protein LOC101206121, partial [Cucumis 
sativus]
Length=81

 Score =   101 bits (252),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            + L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+
Sbjct  8    EALNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGR  63



>ref|XP_006374033.1| hypothetical protein POPTR_0016s13640g [Populus trichocarpa]
 gb|ERP51830.1| hypothetical protein POPTR_0016s13640g [Populus trichocarpa]
Length=145

 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL++VV+DC++RWF+DTLKEAKAGDI+MQVLV QMY+SGYGV +D QKG+ W++RASR
Sbjct  55   RVPLSDVVSDCIKRWFKDTLKEAKAGDINMQVLVSQMYYSGYGVPKDEQKGRIWMTRASR  114

Query  413  trssawRVSDKRPGYNV  363
            TRS  W+VS+K+PGYN 
Sbjct  115  TRSWVWKVSNKQPGYNA  131



>ref|XP_011032587.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
 ref|XP_011032588.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
 ref|XP_011032589.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
Length=145

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL++VV+DC++RWF+DTLKEAKAGDI+MQVLV QMY+SGYGV +D QKG+ W++RASR
Sbjct  55   RVPLSDVVSDCIKRWFKDTLKEAKAGDINMQVLVSQMYYSGYGVPKDEQKGRIWMTRASR  114

Query  413  trssawRVSDKRPGYNV  363
            TRS  W+VS+K+PGYN 
Sbjct  115  TRSWVWKVSNKQPGYNA  131



>gb|KJB77084.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
Length=137

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            +R+PL+EVV+DCV+RWF+D+LKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ W++RAS
Sbjct  60   QRLPLSEVVSDCVKRWFKDSLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWMTRAS  119

Query  416  rtrssawRVSDKRPG  372
            R RSS W+VS K PG
Sbjct  120  RLRSSVWKVSHKHPG  134



>ref|NP_001238136.1| uncharacterized protein LOC100527576 [Glycine max]
 gb|ACU16686.1| unknown [Glycine max]
Length=100

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+ VV DCV+RWF+DTLKEAKAGD++MQVLVGQMY+ GYGV RDAQKG+ W+++ASR
Sbjct  13   RAPLSGVVADCVKRWFKDTLKEAKAGDVNMQVLVGQMYYHGYGVPRDAQKGRIWLTKASR  72

Query  413  trssawRVSDKRPGYN  366
             RSS WRV  KRPGYN
Sbjct  73   VRSSVWRVGGKRPGYN  88



>gb|KDP21698.1| hypothetical protein JCGZ_03369 [Jatropha curcas]
Length=156

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL++VV++CV+RWFQDTLKEAKAGDI+MQVLVGQMY +GYGV +D QKG  WISRAS+
Sbjct  63   RVPLSQVVSECVKRWFQDTLKEAKAGDIAMQVLVGQMYCNGYGVPKDDQKGHGWISRASK  122

Query  413  trssawRVSDKRPGYN  366
            +R+SAW+V DKRPGYN
Sbjct  123  SRASAWKVRDKRPGYN  138



>ref|XP_004146456.1| PREDICTED: uncharacterized protein LOC101213931 isoform 2 [Cucumis 
sativus]
 ref|XP_004146457.1| PREDICTED: uncharacterized protein LOC101213931 isoform 3 [Cucumis 
sativus]
 ref|XP_004171853.1| PREDICTED: uncharacterized protein LOC101228310 isoform 2 [Cucumis 
sativus]
 ref|XP_004171854.1| PREDICTED: uncharacterized protein LOC101228310 isoform 3 [Cucumis 
sativus]
 gb|KGN50710.1| hypothetical protein Csa_5G218760 [Cucumis sativus]
Length=157

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLA+VV+DCV+RWFQDTLKEAKAGD SMQVLVGQM+ SGYGV ++ +KG AWI RAS+
Sbjct  65   RTPLADVVSDCVKRWFQDTLKEAKAGDTSMQVLVGQMFCSGYGVPKNTKKGLAWIYRASK  124

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             ++S W+ SD+ PGY  +DS+S D
Sbjct  125  YQASVWKASDRHPGYLATDSESSD  148



>ref|NP_974733.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABK32156.1| At5g05360 [Arabidopsis thaliana]
 gb|AED90863.1| uncharacterized protein AT5G05360 [Arabidopsis thaliana]
Length=153

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  420
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  134

Query  419  srtrssawRVSDKRPGYNV  363
            SRTRSSAW+VSDK PG N+
Sbjct  135  SRTRSSAWQVSDKPPGNNI  153



>ref|XP_004984894.1| PREDICTED: myc-associated zinc finger protein-like [Setaria italica]
Length=173

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K + W+ +ASR
Sbjct  82   RVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKARVWMEKASR  141

Query  413  trssawRVSDKRPGYNV  363
             RS+ W+VS+KRPGYN 
Sbjct  142  YRSTVWKVSNKRPGYNA  158



>ref|NP_001055251.1| Os05g0342900 [Oryza sativa Japonica Group]
 gb|AAV43869.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAV44160.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17165.1| Os05g0342900 [Oryza sativa Japonica Group]
 gb|EAY97601.1| hypothetical protein OsI_19526 [Oryza sativa Indica Group]
 dbj|BAG89024.1| unnamed protein product [Oryza sativa Japonica Group]
Length=103

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+EVV DCV+RWFQD LKEA+ GD +MQVLV QMY SGYG+ ++  KG+AW  +ASR
Sbjct  13   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQVLVAQMYHSGYGIPKNEHKGRAWAEKASR  72

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             R S W+V  KRPGYN SDSDSD+
Sbjct  73   YRPSVWKVGTKRPGYNASDSDSDE  96



>ref|XP_004500530.1| PREDICTED: uncharacterized protein LOC101512952 isoform X1 [Cicer 
arietinum]
 ref|XP_004500531.1| PREDICTED: uncharacterized protein LOC101512952 isoform X2 [Cicer 
arietinum]
 ref|XP_004500532.1| PREDICTED: uncharacterized protein LOC101512952 isoform X3 [Cicer 
arietinum]
 ref|XP_004500533.1| PREDICTED: uncharacterized protein LOC101512952 isoform X4 [Cicer 
arietinum]
Length=154

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLA VV  C +RWFQDTLK AKAGD SMQVLVGQMY SGYGV RD QKG AWISRASR
Sbjct  64   RTPLARVVAYCSKRWFQDTLKGAKAGDSSMQVLVGQMYNSGYGVPRDPQKGHAWISRASR  123

Query  413  trssawRVSDKRPGYNVSDSDS  348
            +R+  W+VS+K+PGY  SDSDS
Sbjct  124  SRNLVWKVSEKQPGYRASDSDS  145



>ref|XP_002465405.1| hypothetical protein SORBIDRAFT_01g038090 [Sorghum bicolor]
 gb|EER92403.1| hypothetical protein SORBIDRAFT_01g038090 [Sorghum bicolor]
Length=215

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K + W+ +ASR
Sbjct  124  RVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKARVWMEKASR  183

Query  413  trssawRVSDKRPGYNV  363
             RS+ W+VS+KRPGYN 
Sbjct  184  YRSTVWKVSNKRPGYNA  200



>ref|XP_004962417.1| PREDICTED: uncharacterized protein LOC101777264 isoform X1 [Setaria 
italica]
 ref|XP_004962418.1| PREDICTED: uncharacterized protein LOC101777264 isoform X2 [Setaria 
italica]
Length=104

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+EVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYGV ++  KG+ W+ RAS+
Sbjct  14   RKPLSEVVGDCVQRWFQDAFKEARKGDVANQVLVAQMFFSGYGVPKNEYKGRQWMDRASK  73

Query  413  trssawRVSDKRPGYNVSDSDSDDTAGEA  327
             RSSA +V  KRPGYN SDSDSD+   +A
Sbjct  74   YRSSALKVGMKRPGYNASDSDSDEANDDA  102



>ref|NP_001049844.1| Os03g0298600 [Oryza sativa Japonica Group]
 gb|ABF95462.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11758.1| Os03g0298600 [Oryza sativa Japonica Group]
 dbj|BAG90150.1| unnamed protein product [Oryza sativa Japonica Group]
Length=170

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV DC RRWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K + W  +ASR
Sbjct  74   RVPLSEVVLDCTRRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKAQIWTEKASR  133

Query  413  trssawRVSDKRPGYNV  363
             RS+ W+VS+KRPGYN 
Sbjct  134  YRSTVWKVSNKRPGYNA  150



>ref|XP_008456900.1| PREDICTED: uncharacterized protein LOC103496713 isoform X2 [Cucumis 
melo]
 ref|XP_008456901.1| PREDICTED: uncharacterized protein LOC103496713 isoform X2 [Cucumis 
melo]
Length=157

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL++VV+DCV+RWFQDTLKEAKAGD SMQVLVGQM+ SGYGV ++ +KG AWI RAS+
Sbjct  65   RTPLSDVVSDCVKRWFQDTLKEAKAGDTSMQVLVGQMFCSGYGVPKNTKKGLAWIYRASK  124

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             + S W+ S++ PGY  +DS+S +
Sbjct  125  YQPSVWKASERHPGYLATDSESSN  148



>gb|EEE58888.1| hypothetical protein OsJ_10507 [Oryza sativa Japonica Group]
Length=180

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R+PL+EVV DC RRWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K + W  +ASR
Sbjct  74   RVPLSEVVLDCTRRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKAQIWTEKASR  133

Query  413  trssawRVSDKRPGYNV  363
             RS+ W+VS+KRPGYN 
Sbjct  134  YRSTVWKVSNKRPGYNA  150



>ref|XP_006411058.1| hypothetical protein EUTSA_v10017381mg [Eutrema salsugineum]
 gb|ESQ52511.1| hypothetical protein EUTSA_v10017381mg [Eutrema salsugineum]
Length=146

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  417
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYG+ +D +KG+ WI++AS
Sbjct  57   RCVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGIPKDPRKGRLWITKAS  116

Query  416  rtrssawRVSDKRPGYNV  363
            R RSS W+V DKRPGYN 
Sbjct  117  RVRSSVWKVKDKRPGYNA  134



>ref|XP_003601009.1| hypothetical protein MTR_3g072010 [Medicago truncatula]
 gb|AES71260.1| Sel1 repeat protein [Medicago truncatula]
 gb|AFK43254.1| unknown [Medicago truncatula]
 gb|AFK48125.1| unknown [Medicago truncatula]
Length=156

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            RI L+ VV DC  RWF DTLKEAK GD+S QVLVGQMY SGYGV R+ QKG AWISRASR
Sbjct  66   RIALSRVVADCTHRWFHDTLKEAKRGDLSSQVLVGQMYCSGYGVPRNPQKGHAWISRASR  125

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
            +R+S W++S+K PGY  SDSDS +
Sbjct  126  SRNSVWQLSEKPPGYRASDSDSSE  149



>ref|XP_006282317.1| hypothetical protein CARUB_v10028606mg, partial [Capsella rubella]
 gb|EOA15215.1| hypothetical protein CARUB_v10028606mg, partial [Capsella rubella]
Length=117

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  444
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QK
Sbjct  66   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQK  117



>ref|XP_006289773.1| hypothetical protein CARUB_v10003374mg, partial [Capsella rubella]
 gb|EOA22671.1| hypothetical protein CARUB_v10003374mg, partial [Capsella rubella]
Length=130

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  444
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QK
Sbjct  79   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQK  130



>ref|XP_002871153.1| hypothetical protein ARALYDRAFT_325170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47412.1| hypothetical protein ARALYDRAFT_325170 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+
Sbjct  73   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGR  126



>ref|XP_004146455.1| PREDICTED: uncharacterized protein LOC101213931 isoform 1 [Cucumis 
sativus]
 ref|XP_004171852.1| PREDICTED: uncharacterized protein LOC101228310 isoform 1 [Cucumis 
sativus]
Length=181

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLA+VV+DCV+RWFQDTLKEAKAGD SMQVLVGQM+ SGYGV ++ +KG AWI RAS+
Sbjct  65   RTPLADVVSDCVKRWFQDTLKEAKAGDTSMQVLVGQMFCSGYGVPKNTKKGLAWIYRASK  124

Query  413  trssawRVSDKRPGYNVSDS  354
             ++S W+ SD+ PG  +  S
Sbjct  125  YQASVWKASDRHPGIQILQS  144



>ref|XP_010497949.1| PREDICTED: uncharacterized protein LOC104775718, partial [Camelina 
sativa]
Length=68

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  444
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QK
Sbjct  17   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQK  68



>dbj|BAB09979.1| unnamed protein product [Arabidopsis thaliana]
Length=179

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGR  128



>gb|KJB67484.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
Length=183

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 74/110 (67%), Gaps = 26/110 (24%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            RIPLA+VV++ V+ WFQ+ LKEAKAGD +MQVLVGQMY +GYGV +D QKG+AWIS+ASR
Sbjct  68   RIPLAQVVSELVKGWFQEALKEAKAGDTNMQVLVGQMYCNGYGVPKDVQKGRAWISKASR  127

Query  413  trssawRVSDKRP--------------------------GYNVSDSDSDD  342
            +RSS W+VSDK P                          GYN SDSDSD+
Sbjct  128  SRSSVWKVSDKHPGTLCVCACVKVGLLLLSKTIFLRFPSGYNASDSDSDE  177



>ref|XP_008456899.1| PREDICTED: uncharacterized protein LOC103496713 isoform X1 [Cucumis 
melo]
Length=181

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL++VV+DCV+RWFQDTLKEAKAGD SMQVLVGQM+ SGYGV ++ +KG AWI RAS+
Sbjct  65   RTPLSDVVSDCVKRWFQDTLKEAKAGDTSMQVLVGQMFCSGYGVPKNTKKGLAWIYRASK  124

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             + S W+ S++ PG  +  S  D+
Sbjct  125  YQPSVWKASERHPGIQIVRSLIDN  148



>gb|KHN29550.1| hypothetical protein glysoja_005274 [Glycine soja]
Length=185

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  444
            R PL+ VV DCV+RWF+DTLKEAKAGD++MQVLVGQMY+ GYGV RDAQK
Sbjct  13   RAPLSGVVADCVKRWFKDTLKEAKAGDVNMQVLVGQMYYHGYGVPRDAQK  62



>gb|EMT09012.1| hypothetical protein F775_27191 [Aegilops tauschii]
Length=152

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  441
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  KG
Sbjct  70   RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKG  120



>gb|EMS50296.1| hypothetical protein TRIUR3_29514 [Triticum urartu]
Length=328

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  441
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  KG
Sbjct  229  RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKG  279



>dbj|BAK02754.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  444
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K
Sbjct  68   RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHK  117



>ref|XP_010517140.1| PREDICTED: uncharacterized protein LOC104792648 isoform X2 [Camelina 
sativa]
Length=127

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  444
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+K
Sbjct  59   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKK  109



>ref|NP_001143861.1| uncharacterized protein LOC100276657 [Zea mays]
 gb|ACG36065.1| hypothetical protein [Zea mays]
Length=134

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLAEVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYG  ++  KGK W+ R SR
Sbjct  14   RKPLAEVVGDCVQRWFQDAYKEARKGDVANQVLVAQMFFSGYGTPKNEYKGKQWMDRVSR  73

Query  413  trssawRVSDKRPGYN  366
             RSSA +V  KRPGYN
Sbjct  74   FRSSALKVGMKRPGYN  89



>ref|XP_008647657.1| PREDICTED: uncharacterized protein LOC100276657 isoform X1 [Zea 
mays]
 ref|XP_008647658.1| PREDICTED: uncharacterized protein LOC100276657 isoform X1 [Zea 
mays]
 gb|AFW77783.1| hypothetical protein ZEAMMB73_141974 [Zea mays]
 gb|AFW77784.1| hypothetical protein ZEAMMB73_141974 [Zea mays]
Length=104

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PLAEVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYG  ++  KGK W+ RASR
Sbjct  14   RKPLAEVVGDCVQRWFQDAYKEARKGDVANQVLVAQMFFSGYGTPKNEYKGKQWMDRASR  73

Query  413  trssawRVSDKRPGYN  366
             RSSA +V  KRPGYN
Sbjct  74   FRSSALKVGMKRPGYN  89



>ref|NP_001142513.1| hypothetical protein [Zea mays]
 gb|ACG24563.1| hypothetical protein [Zea mays]
Length=105

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK W+ RASR
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGKQWMDRASR  73

Query  413  trssawRVSDKRPGYN  366
             RSSA +V  KRPGYN
Sbjct  74   FRSSALKVGMKRPGYN  89



>ref|XP_008654668.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 ref|XP_008654669.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 ref|XP_008654670.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 gb|AFW82044.1| hypothetical protein ZEAMMB73_653152 [Zea mays]
 gb|AFW82045.1| hypothetical protein ZEAMMB73_653152 [Zea mays]
Length=105

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK W+ RASR
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGKQWMDRASR  73

Query  413  trssawRVSDKRPGYN  366
             RSSA +V  KRPGYN
Sbjct  74   FRSSALKVGMKRPGYN  89



>ref|XP_010529921.1| PREDICTED: uncharacterized protein LOC104806634 [Tarenaya hassleriana]
Length=175

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 68/114 (60%), Gaps = 29/114 (25%)
 Frame = -2

Query  599  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMY--------------------  480
            +RR+PL+     C +RWF++TL+EAKAGD  MQVLVGQMY                    
Sbjct  62   IRRVPLSAGGAGCAKRWFKETLQEAKAGDTGMQVLVGQMYYSGYGWFKETLQEAKAGDTG  121

Query  479  ---------FSGYGVSRDAQKGKawisrasrtrssawRVSDKRPGYNVSDSDSD  345
                     +SGYGV RD +KG+ WIS+AS+ RSS W V DK PGYN SDSDS+
Sbjct  122  MQVLVGQMYYSGYGVPRDDRKGRLWISKASKIRSSVWSVRDKHPGYNASDSDSE  175



>ref|XP_002439596.1| hypothetical protein SORBIDRAFT_09g015880 [Sorghum bicolor]
 gb|EES18026.1| hypothetical protein SORBIDRAFT_09g015880 [Sorghum bicolor]
Length=104

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK W+ RASR
Sbjct  14   RRPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGKQWMDRASR  73

Query  413  trssawRVSDKRPGYN  366
             RSSA RV  KRPGYN
Sbjct  74   FRSSALRVGMKRPGYN  89



>gb|KDO44850.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44851.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44852.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44853.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44854.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
Length=137

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  441
            Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M+VLVGQMY SGYGV+   ++G
Sbjct  67   QQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAMEVLVGQMYLSGYGVAEMKKRG  121



>ref|XP_009133258.1| PREDICTED: uncharacterized protein LOC103857784 isoform X2 [Brassica 
rapa]
Length=130

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  590  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  444
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+K
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARK  106



>gb|ACG31011.1| hypothetical protein [Zea mays]
Length=105

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KG  W+ RASR
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGXQWMDRASR  73

Query  413  trssawRVSDKRPGY  369
             RSSA +V  KRPGY
Sbjct  74   FRSSALKVGMKRPGY  88



>emb|CBI25405.3| unnamed protein product [Vitis vinifera]
Length=61

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  506  MQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            MQVLVGQMYFSGYGVSRDAQKG+AWISRAS++RSSA +V DK PGYN SDSDSDD   + 
Sbjct  1    MQVLVGQMYFSGYGVSRDAQKGRAWISRASKSRSSALKVGDKHPGYNASDSDSDDLKNDE  60

Query  326  K  324
            K
Sbjct  61   K  61



>emb|CBI18085.3| unnamed protein product [Vitis vinifera]
Length=60

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  506  MQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawRVSDKRPGYNVSDSDSDDTAGEA  327
            MQVLVGQMY+SGYGV RDAQKG+ W++RASRTRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  1    MQVLVGQMYYSGYGVPRDAQKGRVWMTRASRTRSSVWKVSDKHPGYNASDSDSDELKGDS  60



>ref|XP_001778215.1| predicted protein [Physcomitrella patens]
 gb|EDQ56997.1| predicted protein [Physcomitrella patens]
Length=156

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  444
            + IPL EVV +C  RWF+ TLK AK+GDIS Q LVGQM+ SGYGV  + +K
Sbjct  22   KAIPLREVVANCEHRWFEQTLKAAKSGDISSQCLVGQMFCSGYGVPVNVKK  72



>ref|XP_002526705.1| hypothetical protein RCOM_0850070 [Ricinus communis]
 gb|EEF35727.1| hypothetical protein RCOM_0850070 [Ricinus communis]
Length=109

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -2

Query  500  VLVGQMYFSGYGVSRDAQKGKawisrasrtrssawRVSDKRPGYNVSDSDSDD  342
            VLVGQMY+SGYG+ RDAQKGK W++RAS+TRSS WRVSDK PGYN SDSDSD+
Sbjct  52   VLVGQMYYSGYGIPRDAQKGKIWMTRASKTRSSVWRVSDKHPGYNASDSDSDE  104



>ref|XP_005650064.1| hypothetical protein COCSUDRAFT_32673 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25520.1| hypothetical protein COCSUDRAFT_32673 [Coccomyxa subellipsoidea 
C-169]
Length=116

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  587  PLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            PL  VV D VRRWFQ+T KEA  GD+  Q L+GQM   GYG  RD+  GK
Sbjct  47   PLTAVVHDAVRRWFQETHKEALRGDVKQQALLGQMLLEGYGCERDSAAGK  96



>gb|EEE63318.1| hypothetical protein OsJ_18129 [Oryza sativa Japonica Group]
Length=84

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 52/84 (62%), Gaps = 19/84 (23%)
 Frame = -2

Query  593  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  414
            R PL+EVV DCV+RWFQD LKEA+ GD +MQ                   G+AW  +ASR
Sbjct  13   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQ-------------------GRAWAEKASR  53

Query  413  trssawRVSDKRPGYNVSDSDSDD  342
             R S W+V  KRPGYN SDSDSD+
Sbjct  54   YRPSVWKVGTKRPGYNASDSDSDE  77



>ref|XP_001692982.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03551.1| predicted protein [Chlamydomonas reinhardtii]
Length=136

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  590  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            IPL  VV + V+RWF+DTL EA+ GD+  Q LVG+MY  GYG  +DA+  K
Sbjct  66   IPLKYVVQEAVKRWFEDTLLEAQRGDVKQQALVGEMYKEGYGCQKDARAAK  116



>ref|XP_002950802.1| hypothetical protein VOLCADRAFT_120924 [Volvox carteri f. nagariensis]
 gb|EFJ48117.1| hypothetical protein VOLCADRAFT_120924 [Volvox carteri f. nagariensis]
Length=135

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  590  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            IPL  VV + V+RWF+DTL EA+ GD+  Q L+G+MY  GYG  +D + GK
Sbjct  65   IPLKYVVQEAVKRWFEDTLLEAQRGDVKQQALLGEMYKEGYGCQKDVRAGK  115



>gb|KIY93418.1| hypothetical protein MNEG_14545 [Monoraphidium neglectum]
Length=90

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 33/57 (58%), Gaps = 9/57 (16%)
 Frame = -2

Query  590  IPLAEVV---------TDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQ  447
            +PL  VV         T  VRRWF+DTL EA+ GD+  Q LV QM+  GYG  RD Q
Sbjct  11   VPLKAVVQAAQRNRNATAQVRRWFEDTLVEAQRGDVKQQALVAQMFAEGYGCQRDLQ  67



>ref|XP_009590059.1| PREDICTED: uncharacterized protein LOC104087340, partial [Nicotiana 
tomentosiformis]
Length=57

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = -2

Query  596  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMY  480
            RR  LAEVV +   RW +DTLKE KAGD +MQVLVGQMY
Sbjct  17   RRHSLAEVVGEW--RWCRDTLKETKAGDTTMQVLVGQMY  53



>ref|XP_005850343.1| hypothetical protein CHLNCDRAFT_142152 [Chlorella variabilis]
 gb|EFN58241.1| hypothetical protein CHLNCDRAFT_142152 [Chlorella variabilis]
Length=486

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -2

Query  584  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            L  VV D +RRW+ +T KEA  GD+  Q L+GQM   GYG   D  KG+
Sbjct  36   LGAVVADALRRWYLETEKEALRGDVKAQALLGQMLIEGYGCQADPVKGR  84



>gb|KIY94194.1| hypothetical protein MNEG_13768, partial [Monoraphidium neglectum]
Length=56

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  560  VRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRD  453
            VRRWF+DT  EA+ GD+  Q L+ QMY  GYG  RD
Sbjct  1    VRRWFEDTQIEAQRGDVKQQALLAQMYNEGYGTERD  36



>ref|XP_002505403.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66661.1| predicted protein [Micromonas sp. RCC299]
Length=155

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  584  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            L +V+ D + RWF DTL+ AK GD +   L+ +M  +GYG ++DA++ +
Sbjct  85   LKDVMADAIERWFVDTLRNAKNGDANQAALLAEMLSTGYGCTKDAEEAR  133



>ref|XP_003059675.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55627.1| predicted protein [Micromonas pusilla CCMP1545]
Length=158

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  584  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            L +V+ + + RWF DTL+ AK GD++   L+ +M  +GYG ++DA++ +
Sbjct  88   LKDVMANAIERWFIDTLRNAKNGDVNQAALLAEMLATGYGCNKDAEEAR  136



>ref|XP_002962942.1| hypothetical protein SELMODRAFT_404377 [Selaginella moellendorffii]
 gb|EFJ36405.1| hypothetical protein SELMODRAFT_404377 [Selaginella moellendorffii]
Length=833

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  605  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  441
            + L + PL E+V    R+WF + L+ A AGD  MQ L+G+M+ +GYG   +  +G
Sbjct  3    ETLEKGPLREIVAQLTRQWFLEALELAMAGDRQMQQLIGKMFCTGYGCHANLSQG  57



>ref|XP_011401235.1| hypothetical protein F751_6989 [Auxenochlorella protothecoides]
 gb|KFM28222.1| hypothetical protein F751_6989 [Auxenochlorella protothecoides]
Length=95

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  584  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  438
            L+ VV D ++RW+ +T KEA  GD+    L+GQM   GYG   + ++G+
Sbjct  27   LSLVVADALKRWYAETEKEALRGDLKSAALLGQMLNEGYGCKANPERGR  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875