BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002G22

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            340   5e-111   Nicotiana sylvestris
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            338   1e-110   Nicotiana tomentosiformis
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       334   8e-109   Solanum tuberosum [potatoes]
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            332   3e-108   Solanum lycopersicum
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                320   4e-103   Erythranthe guttata [common monkey flower]
emb|CDP02851.1|  unnamed protein product                                319   6e-103   Coffea canephora [robusta coffee]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            311   5e-100   Sesamum indicum [beniseed]
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             301   8e-96    Prunus persica
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            300   1e-95    Vitis vinifera
emb|CAN75200.1|  hypothetical protein VITISV_014887                     300   5e-95    Vitis vinifera
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    298   8e-95    Theobroma cacao [chocolate]
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            296   6e-94    Prunus mume [ume]
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            295   7e-94    Fragaria vesca subsp. vesca
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            295   2e-93    Nelumbo nucifera [Indian lotus]
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    294   5e-93    
ref|XP_011018073.1|  PREDICTED: serine carboxypeptidase II-2-like       287   7e-92    Populus euphratica
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    288   7e-91    Citrus sinensis [apfelsine]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             287   1e-90    Citrus clementina [clementine]
emb|CBI36578.3|  unnamed protein product                                287   2e-90    Vitis vinifera
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    287   2e-90    Populus euphratica
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            287   3e-90    Vitis vinifera
ref|XP_002528403.1|  serine carboxypeptidase, putative                  286   4e-90    Ricinus communis
gb|EPS71160.1|  hypothetical protein M569_03591                         285   4e-90    Genlisea aurea
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            285   8e-90    Pyrus x bretschneideri [bai li]
gb|AFK34001.1|  unknown                                                 276   1e-89    Medicago truncatula
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         284   2e-89    Jatropha curcas
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    284   3e-89    Phoenix dactylifera
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            283   4e-89    Eucalyptus grandis [rose gum]
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       283   5e-89    Eucalyptus grandis [rose gum]
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            283   7e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            282   2e-88    
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       280   6e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         280   1e-87    Gossypium arboreum [tree cotton]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       279   2e-87    Setaria italica
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       278   4e-87    Medicago truncatula
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            278   4e-87    Elaeis guineensis
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             278   5e-87    Phaseolus vulgaris [French bean]
gb|ACF84647.1|  unknown                                                 270   1e-86    Zea mays [maize]
gb|KEH38195.1|  serine carboxypeptidase-like protein                    276   2e-86    Medicago truncatula
ref|NP_001057009.1|  Os06g0186400                                       277   2e-86    
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       276   4e-86    Medicago truncatula
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             276   6e-86    Citrus clementina [clementine]
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               275   9e-86    Medicago truncatula
gb|KHN02055.1|  Serine carboxypeptidase II-2                            274   2e-85    Glycine soja [wild soybean]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       274   2e-85    Glycine max [soybeans]
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             273   3e-85    
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       273   4e-85    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT26558.1|  putative Serine carboxypeptidase II-2                   269   1e-84    
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    270   3e-84    Hordeum vulgare [barley]
dbj|BAJ99024.1|  predicted protein                                      271   3e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          270   5e-84    Zea mays [maize]
dbj|BAK02147.1|  predicted protein                                      269   2e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       268   3e-83    Oryza brachyantha
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            268   4e-83    Brachypodium distachyon [annual false brome]
gb|KJB76659.1|  hypothetical protein B456_012G098600                    268   5e-83    Gossypium raimondii
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          267   7e-83    Amborella trichopoda
gb|ABK24285.1|  unknown                                                 266   8e-83    Picea sitchensis
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    266   1e-82    Cucumis sativus [cucumbers]
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       267   1e-82    Cicer arietinum [garbanzo]
gb|AES66787.2|  serine carboxypeptidase-like protein                    266   2e-82    Medicago truncatula
ref|XP_003596536.1|  Serine carboxypeptidase                            268   2e-82    
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            265   3e-82    Cucumis melo [Oriental melon]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       267   4e-82    Cucumis sativus [cucumbers]
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    263   3e-81    
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         258   3e-79    
ref|XP_006470942.1|  PREDICTED: serine carboxypeptidase II-2-like       253   5e-79    
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         257   8e-79    Brassica rapa
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         257   1e-78    Tarenaya hassleriana [spider flower]
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               256   1e-78    Zea mays [maize]
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    256   1e-78    
gb|ACF79757.1|  unknown                                                 256   1e-78    Zea mays [maize]
emb|CDX68696.1|  BnaC01g07570D                                          257   2e-78    
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         255   3e-78    Brassica rapa
ref|XP_010525795.1|  PREDICTED: serine carboxypeptidase-like 29         249   3e-78    Tarenaya hassleriana [spider flower]
emb|CDY13387.1|  BnaA03g51050D                                          255   4e-78    Brassica napus [oilseed rape]
dbj|BAH20278.1|  AT4G30810                                              251   5e-78    Arabidopsis thaliana [mouse-ear cress]
emb|CDY28217.1|  BnaA01g06320D                                          253   1e-77    Brassica napus [oilseed rape]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         253   2e-77    Nelumbo nucifera [Indian lotus]
emb|CDY23258.1|  BnaA08g12880D                                          253   4e-77    Brassica napus [oilseed rape]
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         252   5e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       252   6e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CDX72270.1|  BnaC07g42920D                                          256   8e-77    
emb|CDY55623.1|  BnaC03g77560D                                          251   1e-76    Brassica napus [oilseed rape]
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         250   2e-76    Sesamum indicum [beniseed]
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          250   2e-76    Sorghum bicolor [broomcorn]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             250   3e-76    Eutrema salsugineum [saltwater cress]
ref|XP_004968265.1|  PREDICTED: serine carboxypeptidase 2-like          251   5e-76    Setaria italica
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    249   5e-76    Arabis alpina [alpine rockcress]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             249   9e-76    
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         248   2e-75    Nelumbo nucifera [Indian lotus]
dbj|BAK06862.1|  predicted protein                                      240   2e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         248   3e-75    
emb|CDY28216.1|  BnaA01g06330D                                          248   3e-75    Brassica napus [oilseed rape]
ref|XP_010541227.1|  PREDICTED: serine carboxypeptidase-like 29         243   4e-75    
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         247   4e-75    Camelina sativa [gold-of-pleasure]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         247   4e-75    Pyrus x bretschneideri [bai li]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         247   4e-75    Brassica rapa
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    246   6e-75    Glycine max [soybeans]
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         246   7e-75    Populus trichocarpa [western balsam poplar]
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         246   7e-75    Malus domestica [apple tree]
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          246   8e-75    Amborella trichopoda
gb|KJB78938.1|  hypothetical protein B456_013G026200                    246   1e-74    Gossypium raimondii
emb|CDX68695.1|  BnaC01g07580D                                          246   1e-74    
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             245   2e-74    Eutrema salsugineum [saltwater cress]
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         245   2e-74    Populus euphratica
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         244   3e-74    Jatropha curcas
gb|AIN39846.1|  hypothetical protein                                    235   3e-74    Zoysia matrella [Japanese carpet grass]
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          244   4e-74    Sorghum bicolor [broomcorn]
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    244   4e-74    Setaria italica
emb|CAN74854.1|  hypothetical protein VITISV_028701                     244   4e-74    Vitis vinifera
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         244   6e-74    Gossypium arboreum [tree cotton]
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         244   7e-74    Populus euphratica
dbj|BAO04184.1|  hypothetical protein                                   243   7e-74    Delphinium grandiflorum
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         243   8e-74    Nicotiana tomentosiformis
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         243   8e-74    Nicotiana sylvestris
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             244   8e-74    Capsella rubella
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         243   1e-73    Vitis vinifera
emb|CDO99730.1|  unnamed protein product                                243   1e-73    Coffea canephora [robusta coffee]
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         243   1e-73    Brachypodium distachyon [annual false brome]
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         243   1e-73    Phoenix dactylifera
ref|XP_006645520.1|  PREDICTED: serine carboxypeptidase II-1-like       241   2e-73    Oryza brachyantha
ref|NP_001044713.1|  Os01g0833500                                       242   2e-73    
ref|XP_007219592.1|  hypothetical protein PRUPE_ppa023509mg             240   2e-73    
ref|NP_001042076.1|  Os01g0158200                                       243   3e-73    
gb|EAY76388.1|  hypothetical protein OsI_04319                          242   3e-73    Oryza sativa Indica Group [Indian rice]
dbj|BAJ99174.1|  predicted protein                                      241   3e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    242   3e-73    Glycine max [soybeans]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         242   3e-73    Glycine soja [wild soybean]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         243   4e-73    Camelina sativa [gold-of-pleasure]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         241   4e-73    Brassica rapa
dbj|BAB08188.1|  unnamed protein product                                242   5e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         241   6e-73    Elaeis guineensis
emb|CDY32091.1|  BnaC04g44750D                                          241   6e-73    Brassica napus [oilseed rape]
emb|CDY40438.1|  BnaA04g20790D                                          241   7e-73    Brassica napus [oilseed rape]
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         241   1e-72    Populus trichocarpa [western balsam poplar]
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    240   1e-72    Solanum tuberosum [potatoes]
tpg|DAA53383.1|  TPA: hypothetical protein ZEAMMB73_784297              237   1e-72    
gb|EMS47606.1|  Serine carboxypeptidase-like 27                         241   1e-72    Triticum urartu
gb|EEC69980.1|  hypothetical protein OsI_00486                          241   1e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             240   1e-72    Phaseolus vulgaris [French bean]
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         240   2e-72    Prunus mume [ume]
ref|XP_006644961.1|  PREDICTED: serine carboxypeptidase-like 27-like    240   2e-72    Oryza brachyantha
gb|KJB76568.1|  hypothetical protein B456_012G094900                    235   2e-72    Gossypium raimondii
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         240   2e-72    Camelina sativa [gold-of-pleasure]
gb|ABK21145.1|  unknown                                                 236   3e-72    Picea sitchensis
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    239   4e-72    
gb|AFK43035.1|  unknown                                                 239   5e-72    Medicago truncatula
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               239   6e-72    Medicago truncatula
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             238   1e-71    Citrus clementina [clementine]
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         238   1e-71    Solanum lycopersicum
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         238   1e-71    Pyrus x bretschneideri [bai li]
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         238   1e-71    Cucumis melo [Oriental melon]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   237   2e-71    Citrus sinensis [apfelsine]
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         239   2e-71    Elaeis guineensis
tpg|DAA53384.1|  TPA: serine carboxypeptidase K10B2.2                   237   3e-71    
ref|XP_003560871.1|  PREDICTED: serine carboxypeptidase 2-like          238   3e-71    Brachypodium distachyon [annual false brome]
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         236   3e-71    Gossypium arboreum [tree cotton]
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         236   3e-71    
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         236   4e-71    Fragaria vesca subsp. vesca
ref|NP_001150676.1|  serine carboxypeptidase K10B2.2 precursor          237   4e-71    Zea mays [maize]
gb|KJB76569.1|  hypothetical protein B456_012G094900                    236   5e-71    Gossypium raimondii
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    236   5e-71    Cicer arietinum [garbanzo]
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         236   6e-71    Elaeis guineensis
gb|KJB76563.1|  hypothetical protein B456_012G094900                    236   6e-71    Gossypium raimondii
ref|XP_008649461.1|  PREDICTED: serine carboxypeptidase 2-like is...    237   7e-71    Zea mays [maize]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         236   7e-71    Tarenaya hassleriana [spider flower]
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    235   1e-70    Cucumis sativus [cucumbers]
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         235   1e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          235   2e-70    Sorghum bicolor [broomcorn]
gb|EMS66624.1|  Serine carboxypeptidase II-1                            231   2e-70    Triticum urartu
ref|XP_006655142.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    234   2e-70    
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     234   3e-70    Eucalyptus grandis [rose gum]
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    234   3e-70    Arabis alpina [alpine rockcress]
ref|XP_002459313.1|  hypothetical protein SORBIDRAFT_02g002260          235   3e-70    Sorghum bicolor [broomcorn]
ref|NP_001151874.1|  LOC100285510 precursor                             234   3e-70    
gb|AAV43957.1|  putative serine carboxypeptidase II                     234   3e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 234   3e-70    
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    234   3e-70    
gb|EMT21139.1|  putative Serine carboxypeptidase II-1                   233   4e-70    
ref|XP_004962519.1|  PREDICTED: serine carboxypeptidase 2-like          235   4e-70    Setaria italica
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    234   4e-70    Setaria italica
emb|CDY35977.1|  BnaA05g29730D                                          234   4e-70    Brassica napus [oilseed rape]
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         234   4e-70    Camelina sativa [gold-of-pleasure]
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    234   4e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            234   5e-70    
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               233   5e-70    
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    233   5e-70    
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    233   5e-70    Brassica rapa
ref|XP_008649460.1|  PREDICTED: serine carboxypeptidase 2-like is...    234   5e-70    Zea mays [maize]
emb|CDY28004.1|  BnaC05g44060D                                          233   6e-70    Brassica napus [oilseed rape]
sp|P55747.1|CBP21_HORVU  RecName: Full=Serine carboxypeptidase II...    229   7e-70    Hordeum vulgare [barley]
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                232   7e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               233   8e-70    Medicago truncatula
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             233   9e-70    Eutrema salsugineum [saltwater cress]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         234   1e-69    Eucalyptus grandis [rose gum]
emb|CDM82001.1|  unnamed protein product                                233   1e-69    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010527107.1|  PREDICTED: serine carboxypeptidase-like 29         224   2e-69    Tarenaya hassleriana [spider flower]
ref|XP_003566533.2|  PREDICTED: serine carboxypeptidase 2-like          232   2e-69    Brachypodium distachyon [annual false brome]
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          232   2e-69    Arabidopsis lyrata subsp. petraea
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         232   2e-69    Camelina sativa [gold-of-pleasure]
ref|NP_187456.1|  serine carboxypeptidase-like 27                       232   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         233   2e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             232   2e-69    
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             231   6e-69    
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         230   9e-69    Camelina sativa [gold-of-pleasure]
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             230   1e-68    Arabidopsis lyrata subsp. lyrata
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         229   1e-68    Camelina sativa [gold-of-pleasure]
dbj|BAK02399.1|  predicted protein                                      229   2e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          232   2e-68    
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         229   3e-68    Camelina sativa [gold-of-pleasure]
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             229   3e-68    Capsella rubella
gb|ACU19747.1|  unknown                                                 223   3e-68    Glycine max [soybeans]
emb|CDP11023.1|  unnamed protein product                                228   8e-68    Coffea canephora [robusta coffee]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         227   2e-67    Camelina sativa [gold-of-pleasure]
gb|EMT12249.1|  Serine carboxypeptidase 2                               226   4e-67    
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    225   6e-67    Phoenix dactylifera
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    224   2e-66    Arabis alpina [alpine rockcress]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    224   5e-66    Glycine max [soybeans]
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         224   5e-66    Glycine soja [wild soybean]
ref|NP_181121.1|  serine carboxypeptidase-like 26                       221   2e-65    Arabidopsis thaliana [mouse-ear cress]
gb|AES62200.2|  serine carboxypeptidase-like protein                    222   3e-65    Medicago truncatula
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    221   3e-65    Fragaria vesca subsp. vesca
emb|CAI64396.1|  serine carboxypeptidase II                             215   3e-65    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    220   6e-65    Fragaria vesca subsp. vesca
gb|KJB76567.1|  hypothetical protein B456_012G094900                    220   1e-64    Gossypium raimondii
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    217   9e-64    Glycine max [soybeans]
ref|XP_008352213.1|  PREDICTED: serine carboxypeptidase 24-like         214   9e-64    
sp|P08819.2|CBP2_WHEAT  RecName: Full=Serine carboxypeptidase 2; ...    217   1e-63    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002440854.1|  hypothetical protein SORBIDRAFT_09g008660          217   3e-63    
ref|XP_007154876.1|  hypothetical protein PHAVU_003G155400g             214   3e-63    Phaseolus vulgaris [French bean]
gb|KDO59486.1|  hypothetical protein CISIN_1g0120681mg                  213   4e-63    Citrus sinensis [apfelsine]
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         216   4e-63    Glycine max [soybeans]
gb|KHN42831.1|  Serine carboxypeptidase 24                              215   8e-63    Glycine soja [wild soybean]
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             215   1e-62    Citrus clementina [clementine]
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          214   1e-62    
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         214   1e-62    Citrus sinensis [apfelsine]
gb|KDP38690.1|  hypothetical protein JCGZ_04043                         208   1e-62    Jatropha curcas
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    214   3e-62    
pdb|1BCR|B  Chain B, Complex Of The Wheat Serine Carboxypeptidase...    204   3e-62    Triticum aestivum [Canadian hard winter wheat]
pdb|1WHT|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    204   4e-62    Triticum aestivum [Canadian hard winter wheat]
pdb|3SC2|B  Chain B, Refined Atomic Model Of Wheat Serine Carboxy...    203   4e-62    unidentified
pdb|1WHS|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    203   4e-62    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              213   6e-62    Pyrus x bretschneideri [bai li]
ref|XP_010656616.1|  PREDICTED: serine carboxypeptidase 24 isofor...    210   6e-62    
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    211   6e-62    Nelumbo nucifera [Indian lotus]
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    212   1e-61    Arabis alpina [alpine rockcress]
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    212   1e-61    Nelumbo nucifera [Indian lotus]
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              212   1e-61    Fragaria vesca subsp. vesca
emb|CAN79972.1|  hypothetical protein VITISV_010072                     210   2e-61    Vitis vinifera
ref|XP_010942076.1|  PREDICTED: serine carboxypeptidase 24 isofor...    208   2e-61    Elaeis guineensis
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         211   2e-61    Nelumbo nucifera [Indian lotus]
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    211   4e-61    Vitis vinifera
emb|CDY39224.1|  BnaA03g50360D                                          210   5e-61    Brassica napus [oilseed rape]
gb|EMT11707.1|  Serine carboxypeptidase-like 27                         213   5e-61    
gb|KJB75608.1|  hypothetical protein B456_012G048700                    211   5e-61    Gossypium raimondii
ref|XP_008230880.1|  PREDICTED: serine carboxypeptidase-like 25         204   5e-61    
emb|CAA70815.1|  serine carboxypeptidase II, CP-MII                     210   8e-61    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             210   8e-61    Capsella rubella
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              209   9e-61    Brassica rapa
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         210   9e-61    Gossypium arboreum [tree cotton]
ref|XP_011009402.1|  PREDICTED: serine carboxypeptidase-like 25 i...    208   1e-60    Populus euphratica
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           209   1e-60    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194790.1|  serine carboxypeptidase 24                            209   1e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007032750.1|  Serine carboxypeptidase-like 25 isoform 3          207   1e-60    
emb|CDP02317.1|  unnamed protein product                                209   2e-60    Coffea canephora [robusta coffee]
gb|KFK32686.1|  hypothetical protein AALP_AA6G275800                    209   2e-60    Arabis alpina [alpine rockcress]
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             209   2e-60    Eutrema salsugineum [saltwater cress]
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         208   2e-60    Solanum lycopersicum
emb|CBI21207.3|  unnamed protein product                                208   3e-60    Vitis vinifera
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         208   3e-60    Vitis vinifera
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...    206   3e-60    Cucumis melo [Oriental melon]
sp|P08818.2|CBP2_HORVU  RecName: Full=Serine carboxypeptidase 2; ...    208   3e-60    Hordeum vulgare [barley]
ref|XP_006404896.1|  hypothetical protein EUTSA_v10000274mg             203   4e-60    
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             207   4e-60    
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...    207   4e-60    
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              208   4e-60    Tarenaya hassleriana [spider flower]
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    208   5e-60    
ref|XP_010108549.1|  Serine carboxypeptidase 24                         208   5e-60    
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         208   5e-60    Fragaria vesca subsp. vesca
ref|XP_006373361.1|  hypothetical protein POPTR_0017s12960g             203   5e-60    
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   207   5e-60    
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    207   6e-60    
emb|CDX76845.1|  BnaC08g34310D                                          206   6e-60    
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...    207   7e-60    
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             207   7e-60    
gb|KCW78823.1|  hypothetical protein EUGRSUZ_C00253                     205   7e-60    
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             207   8e-60    
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...    207   9e-60    
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    207   9e-60    
ref|XP_002451122.1|  hypothetical protein SORBIDRAFT_05g024440          207   1e-59    
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              206   1e-59    
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    206   1e-59    
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         206   1e-59    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    206   1e-59    
gb|KJB07561.1|  hypothetical protein B456_001G032600                    205   2e-59    
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         206   2e-59    
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         206   2e-59    
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    206   2e-59    
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          207   2e-59    
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         206   2e-59    
ref|XP_008810326.1|  PREDICTED: serine carboxypeptidase 24              204   2e-59    
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         206   3e-59    
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    206   3e-59    
ref|XP_010432964.1|  PREDICTED: serine carboxypeptidase 24 isofor...    204   3e-59    
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         207   3e-59    
ref|XP_002529402.1|  serine carboxypeptidase, putative                  206   3e-59    
gb|ACF87497.1|  unknown                                                 201   4e-59    
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                205   4e-59    
emb|CDY34805.1|  BnaA09g41720D                                          206   5e-59    
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             205   5e-59    
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         205   5e-59    
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    205   5e-59    
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             205   6e-59    
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         205   6e-59    
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         205   6e-59    
gb|KJB07559.1|  hypothetical protein B456_001G032600                    205   6e-59    
gb|KJB07564.1|  hypothetical protein B456_001G032600                    205   7e-59    
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             204   7e-59    
gb|KJB07563.1|  hypothetical protein B456_001G032600                    205   7e-59    
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             204   8e-59    
prf||1408163B  CPase II B                                               195   9e-59 
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         204   9e-59    
ref|XP_002878712.1|  hypothetical protein ARALYDRAFT_320208             204   1e-58    
ref|XP_008443851.1|  PREDICTED: serine carboxypeptidase 24-like i...    204   1e-58    
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    204   1e-58    
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    203   1e-58    
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         204   1e-58    
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         204   1e-58    
ref|NP_001077950.1|  serine carboxypeptidase-like 22                    202   2e-58    
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    204   2e-58    
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             204   2e-58    
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         204   2e-58    
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    203   2e-58    
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             204   2e-58    
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         203   3e-58    
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         203   3e-58    
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              203   3e-58    
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    202   4e-58    
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         202   4e-58    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         202   4e-58    
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          202   4e-58    
ref|NP_179978.2|  serine carboxypeptidase-like 22                       202   5e-58    
gb|AAC63669.1|  putative serine carboxypeptidase II                     201   5e-58    
gb|KEH21654.1|  serine carboxypeptidase-like protein                    202   6e-58    
emb|CDP10248.1|  unnamed protein product                                202   6e-58    
ref|XP_011083950.1|  PREDICTED: serine carboxypeptidase 24-like i...    200   7e-58    
ref|NP_179979.4|  serine carboxypeptidase-like 23                       201   7e-58    
gb|AAC63668.1|  putative serine carboxypeptidase II                     202   8e-58    
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         201   8e-58    
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         202   8e-58    
ref|NP_186860.1|  serine carboxypeptidase-like 25                       202   8e-58    
gb|EPS67928.1|  hypothetical protein M569_06845                         201   8e-58    
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         202   8e-58    
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         202   8e-58    
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    201   8e-58    
gb|AAM65698.1|  putative serine carboxypeptidase II                     202   9e-58    
ref|XP_006841720.1|  hypothetical protein AMTR_s00003p00256450          200   1e-57    
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         202   1e-57    
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             201   1e-57    
gb|AFK37459.1|  unknown                                                 201   1e-57    
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         201   1e-57    
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         201   1e-57    
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          201   1e-57    
ref|XP_002527614.1|  serine carboxypeptidase, putative                  200   1e-57    
ref|XP_002325127.2|  BRI1 SUPPRESSOR 1 family protein                   200   1e-57    
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    201   2e-57    
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         201   2e-57    
dbj|BAD19262.1|  putative carboxypeptidase D                            199   2e-57    
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          201   3e-57    
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             200   3e-57    
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          200   3e-57    
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         200   3e-57    
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    200   4e-57    
gb|EMT08964.1|  Serine carboxypeptidase 2                               198   4e-57    
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    200   4e-57    
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         200   4e-57    
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         200   5e-57    
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    199   5e-57    
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    200   5e-57    
ref|XP_010669643.1|  PREDICTED: serine carboxypeptidase-like 28         200   5e-57    
gb|EAY87844.1|  hypothetical protein OsI_09265                          199   9e-57    
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    199   1e-56    
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         199   1e-56    
ref|XP_006648043.1|  PREDICTED: serine carboxypeptidase 24-like         197   1e-56    
ref|NP_001048377.1|  Os02g0794500                                       199   1e-56    
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    198   3e-56    
ref|NP_001150705.1|  LOC100284338 precursor                             198   3e-56    
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    197   3e-56    
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              198   3e-56    
ref|XP_010323186.1|  PREDICTED: serine carboxypeptidase 24 isofor...    198   3e-56    
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    197   3e-56    
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    198   4e-56    
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    197   4e-56    
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                197   5e-56    
ref|XP_001772135.1|  predicted protein                                  196   6e-56    
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                197   6e-56    
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         196   1e-55    
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                196   1e-55    
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         196   1e-55    
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               196   1e-55    
emb|CDY43258.1|  BnaC05g48510D                                          196   2e-55    
dbj|BAJ85578.1|  predicted protein                                      196   2e-55    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         196   3e-55    
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    195   4e-55    
dbj|BAJ92218.1|  predicted protein                                      196   4e-55    
gb|EPS59460.1|  hypothetical protein M569_15347                         189   4e-55    
emb|CDO99728.1|  unnamed protein product                                194   5e-55    
ref|XP_008645971.1|  PREDICTED: serine carboxypeptidase-like 34         185   7e-55    
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             193   1e-54    
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             192   4e-54    
ref|NP_001145702.1|  hypothetical protein                               189   4e-54    
ref|XP_001765233.1|  predicted protein                                  191   5e-54    
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         191   7e-54    
ref|XP_004979757.1|  PREDICTED: p-(S)-hydroxymandelonitrile lyase...    192   7e-54    
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         191   8e-54    
emb|CBI31484.3|  unnamed protein product                                191   1e-53    
dbj|BAD25095.1|  putative carboxypeptidase D                            188   1e-53    
ref|XP_001785856.1|  predicted protein                                  191   1e-53    
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             190   2e-53    
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    191   2e-53    
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         191   2e-53    
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         190   2e-53    
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    191   2e-53    
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         190   3e-53    
gb|KCW76300.1|  hypothetical protein EUGRSUZ_D00674                     184   3e-53    
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         190   4e-53    
ref|XP_004158226.1|  PREDICTED: serine carboxypeptidase-like 34-like    187   5e-53    
ref|XP_001755195.1|  predicted protein                                  188   5e-53    
ref|NP_001152245.1|  lysosomal protective protein precursor             189   5e-53    
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         189   7e-53    
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         189   8e-53    
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         189   9e-53    
emb|CDY65614.1|  BnaCnng47980D                                          184   1e-52    
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    187   1e-52    
gb|KDO52736.1|  hypothetical protein CISIN_1g0420602mg                  184   1e-52    
ref|XP_011022271.1|  PREDICTED: serine carboxypeptidase-like 34         188   1e-52    
ref|NP_001047514.1|  Os02g0634700                                       189   1e-52    
gb|EEC73659.1|  hypothetical protein OsI_08191                          189   1e-52    
gb|ACU21427.1|  unknown                                                 182   2e-52    
gb|AFK36150.1|  unknown                                                 182   2e-52    
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         188   2e-52    
ref|XP_010054359.1|  PREDICTED: serine carboxypeptidase-like 31         184   2e-52    
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    188   2e-52    
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         187   2e-52    
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         187   2e-52    
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    187   3e-52    
ref|XP_009591368.1|  PREDICTED: serine carboxypeptidase-like 31 i...    187   3e-52    
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    187   3e-52    
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...    187   3e-52    
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          187   3e-52    
emb|CAN70886.1|  hypothetical protein VITISV_009829                     185   3e-52    
ref|XP_009800560.1|  PREDICTED: serine carboxypeptidase-like 31 i...    187   4e-52    
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    187   4e-52    
gb|AFK45951.1|  unknown                                                 181   4e-52    
ref|XP_011096266.1|  PREDICTED: serine carboxypeptidase-like 31         187   4e-52    
gb|EMS64875.1|  Serine carboxypeptidase 24                              185   7e-52    
ref|XP_002962533.1|  serine carboxypeptidase-like enzyme                186   1e-51    
ref|XP_002521402.1|  serine carboxypeptidase, putative                  186   1e-51    
gb|EMT14017.1|  Serine carboxypeptidase-like 34                         183   1e-51    
ref|XP_007025718.1|  Serine carboxypeptidase-like 31                    186   1e-51    
gb|ABR16596.1|  unknown                                                 187   1e-51    
gb|EPS66906.1|  hypothetical protein M569_07869                         184   1e-51    
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    185   1e-51    
ref|XP_010933315.1|  PREDICTED: serine carboxypeptidase-like 34         184   2e-51    
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    186   2e-51    
ref|XP_010052354.1|  PREDICTED: serine carboxypeptidase-like 31         185   2e-51    
gb|KEH30582.1|  serine carboxypeptidase-like protein                    185   2e-51    
gb|KJB78939.1|  hypothetical protein B456_013G026200                    184   2e-51    
ref|XP_008803196.1|  PREDICTED: serine carboxypeptidase-like 34         182   4e-51    
ref|XP_006648863.1|  PREDICTED: serine carboxypeptidase-like 34-like    183   4e-51    
ref|XP_010533893.1|  PREDICTED: serine carboxypeptidase-like 31 i...    184   5e-51    
ref|XP_010686577.1|  PREDICTED: serine carboxypeptidase-like 31         184   5e-51    
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               184   6e-51    
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             184   6e-51    
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    184   6e-51    
ref|XP_010533892.1|  PREDICTED: serine carboxypeptidase-like 31 i...    184   7e-51    
ref|XP_010533891.1|  PREDICTED: serine carboxypeptidase-like 31 i...    184   8e-51    
ref|XP_007148207.1|  hypothetical protein PHAVU_006G189100g             183   8e-51    
gb|ABR16997.1|  unknown                                                 184   8e-51    
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         184   8e-51    
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    184   9e-51    
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    184   1e-50    
emb|CDX72256.1|  BnaC07g42780D                                          186   1e-50    
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         183   1e-50    
gb|EYU27945.1|  hypothetical protein MIMGU_mgv1a005674mg                183   1e-50    
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    183   1e-50    
gb|KJB78942.1|  hypothetical protein B456_013G026200                    182   2e-50    
gb|EYU33331.1|  hypothetical protein MIMGU_mgv1a025174mg                182   2e-50    
ref|XP_010067797.1|  PREDICTED: serine carboxypeptidase-like 40 i...    180   2e-50    
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    183   2e-50    
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    182   2e-50    
ref|XP_011460258.1|  PREDICTED: serine carboxypeptidase-like 31         182   2e-50    
ref|XP_007131611.1|  hypothetical protein PHAVU_011G027900g             179   2e-50    
ref|XP_009401001.1|  PREDICTED: serine carboxypeptidase-like 34         182   3e-50    
ref|XP_007159281.1|  hypothetical protein PHAVU_002G224800g             180   3e-50    
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    182   4e-50    
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          182   4e-50    
ref|XP_007043282.1|  Serine carboxypeptidase-like 34 isoform 2          178   4e-50    
gb|KDP20921.1|  hypothetical protein JCGZ_21392                         181   4e-50    
ref|XP_011047847.1|  PREDICTED: serine carboxypeptidase-like 31         181   5e-50    



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   340 bits (871),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 183/207 (88%), Gaps = 1/207 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD A++E+G+ID+YSIFT TCT  FS+++ +LKR +R VG LRR YDPCTE+HS 
Sbjct  265  QCDKILDQANEEVGNIDSYSIFTPTCTAKFSMLNHLLKRSNR-VGHLRRSYDPCTEQHSV  323

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IYFNLPEVQ+ALHVH  NSSF+WV CS+EV   WKD P TVLDVY+ELI +GLRIWVFSG
Sbjct  324  IYFNLPEVQEALHVHKRNSSFKWVACSEEVSSGWKDSPKTVLDVYRELIQSGLRIWVFSG  383

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRYSIDALKLPT+SPWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALH
Sbjct  384  DTDAVIPVTSTRYSIDALKLPTISPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALH  443

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            RPK ALTLV+SFLAG SMP LQ+ISDS
Sbjct  444  RPKQALTLVKSFLAGASMPSLQQISDS  470



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD A++E+G+ID YSIFT TCT  FSI++ +LKR +R VG LRR YDPCTE+HS 
Sbjct  265  QCDKILDQANEEVGNIDFYSIFTQTCTAKFSILNHLLKRSNR-VGHLRRSYDPCTEQHSV  323

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IYFNLPEVQ+ALHVH  NSSF+WV CSDEV   WKD P TVLDVY+ELI +GLRIWVFSG
Sbjct  324  IYFNLPEVQEALHVHKRNSSFKWVACSDEVSSGWKDSPKTVLDVYRELIRSGLRIWVFSG  383

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRYSIDALKLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALH
Sbjct  384  DTDAVIPVTSTRYSIDALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALH  443

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            RPK ALTLV+SFLAG+SMP L+ ISDS
Sbjct  444  RPKQALTLVKSFLAGSSMPSLELISDS  470



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   334 bits (856),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD A++E+G+ID+YSIFT  CT  FSI++ +L R+   +G LRR YDPCTE+HS 
Sbjct  260  QCDKILDQANEEIGNIDSYSIFTPACTAKFSILNHLL-RKSNSIGHLRRSYDPCTEQHSK  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IYFNLPEVQ ALHVH  NSSF+WVTCS+EV   WKD P +VLDVY+ELI +GLRIWVFSG
Sbjct  319  IYFNLPEVQNALHVHKRNSSFKWVTCSEEVSSGWKDSPMSVLDVYRELIKSGLRIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRYSIDALKLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALH
Sbjct  379  DTDAVIPVTSTRYSIDALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALH  438

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            RPK ALTLV+SFLAGTSMP L+ ISDS
Sbjct  439  RPKQALTLVKSFLAGTSMPSLELISDS  465



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+L+ A++E+G+ID+YSIFT  CT  FSI++ +L R+   VG LRR YDPCTE+HS 
Sbjct  260  QCDKILEQANEEIGNIDSYSIFTPACTAKFSILNHLL-RKSNSVGHLRRSYDPCTEQHSK  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IYFNLPEVQ ALHVH  NSSF+WVTCS+EV   WKD P TVLDVY+ELI +GLRIWVFSG
Sbjct  319  IYFNLPEVQSALHVHMRNSSFKWVTCSEEVSSGWKDSPNTVLDVYRELIKSGLRIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRYSI+ALKLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALH
Sbjct  379  DTDAVIPVTSTRYSINALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALH  438

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            RPK ALTLV+SFLAGTSMP L+ ISDS
Sbjct  439  RPKQALTLVKSFLAGTSMPSLELISDS  465



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+  LD A +E+GDID YSIFT  CT + + +SR L R+  KVGLLRR YDPCTE HST
Sbjct  271  QCDNALDLAYEEVGDIDMYSIFTPACTANSTSLSR-LSRKKSKVGLLRRAYDPCTEEHST  329

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHVHT NSS +W TCS+ V + W+D P +VL+VY+ELI +GLR+W+FSG
Sbjct  330  VYFNLPEVQKALHVHTRNSSLKWETCSNTVNENWQDSPKSVLNVYRELIHSGLRVWIFSG  389

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRY+IDALKLPTVSPWR WYD+GQVGGWTQEY+GLTFV VRGAGHEV LH
Sbjct  390  DTDAVIPVTSTRYNIDALKLPTVSPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVPLH  449

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            RPK ALTLV+SFL+G SMP L+ +SDS
Sbjct  450  RPKQALTLVKSFLSGISMPKLELVSDS  476



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 176/206 (85%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K+LD A  E+G+ID YS+FT  CT +FS+M++ LKRR+ KVG LRR YDPCTE+HST+
Sbjct  268  CGKILDIADKEIGNIDQYSVFTPACTANFSVMNQFLKRRN-KVGHLRRAYDPCTEQHSTV  326

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLP+VQ ALHV+  ++SF+W TCSD+VY+ WKD P +VL++Y EL+ AG+RIWVFSGD
Sbjct  327  YFNLPKVQHALHVYNRSNSFKWATCSDDVYNNWKDSPRSVLNIYHELLNAGIRIWVFSGD  386

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+PVTSTRYS+DALKL TV PWRPWYD+GQVGGWTQ+YEGL FV VRGAGHEV LHR
Sbjct  387  TDAVLPVTSTRYSLDALKLRTVGPWRPWYDDGQVGGWTQQYEGLNFVTVRGAGHEVPLHR  446

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTL +SF++G S+P L++ISDS
Sbjct  447  PKQALTLFKSFISGNSLPQLEQISDS  472



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   311 bits (798),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 2/206 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K L  A +E+GDID YSIFT  CT +FS +S   KR +RKVGLLRR YDPCTERHST+
Sbjct  269  CEKALGNADEEIGDIDMYSIFTPPCTANFSRLSHPWKR-NRKVGLLRRAYDPCTERHSTV  327

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ A+HVH+ NS  +W TCSD V + WKD P +VL+VY+EL+ +G+RIW+FSGD
Sbjct  328  YFNLPEVQNAIHVHSKNSPLKWETCSDAVNENWKDSPRSVLNVYRELLHSGIRIWIFSGD  387

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            TDAVIPVTSTRYSIDALKLPTVSPWR WY D+GQVGGWTQEYEGLTFV VRGAGHEV LH
Sbjct  388  TDAVIPVTSTRYSIDALKLPTVSPWRAWYDDDGQVGGWTQEYEGLTFVTVRGAGHEVPLH  447

Query  210  RPKLALTLVESFLAGTSMPGLQRISD  133
            +PK ALTL++S+L+G SMP L+ +SD
Sbjct  448  KPKQALTLIKSYLSGNSMPKLELVSD  473



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+ +LD AS ELG+ID YSI+T  C  + S  +R+LKR   KVG +   YDPCTE HS +
Sbjct  269  CDNILDIASAELGNIDPYSIYTLACPANVSQSNRLLKRM-HKVGRISEKYDPCTEAHSVV  327

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV+  ++  +W TCSD VY  W+D P TVLDVY+ELI +GLRIW+FSGD
Sbjct  328  YFNLPEVQKALHVNPNHAPSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGD  387

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TD+VIPVTSTRYSIDALKLPTV PWRPWYD+GQVGGWTQEY GLTFV+VRGAGHEV LH+
Sbjct  388  TDSVIPVTSTRYSIDALKLPTVKPWRPWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHK  447

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTL+++FL+G+SMP  + +SDS
Sbjct  448  PKQALTLIKAFLSGSSMPSSELVSDS  473



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K++D AS+E+G++D YSIFT  C+      ++++KR  R VG +   YDPCTE+HS +
Sbjct  265  CDKIMDIASEEMGNVDPYSIFTPPCSVKVGFSNQLMKRLIR-VGRISERYDPCTEQHSVV  323

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQ+ALHV+T N+  +W TCSDEV   WKD P TVLDVY+ELI AGLRIW+FSGD
Sbjct  324  YYNLPEVQQALHVYTDNAPSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGD  383

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDA+IPVTSTRYS+DALKLPTV PWR WYD+GQVGGW+QEY GLTFV VRGAGHEV LH+
Sbjct  384  TDAIIPVTSTRYSVDALKLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHK  443

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTL+ +FL GTSMP L++++DS
Sbjct  444  PKQALTLINAFLKGTSMPSLEQLADS  469



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K++D AS+E+G++D YSIFT  C+      ++++KR  R VG +   YDPCTE+HS +
Sbjct  320  CDKIMDIASEEMGNVDPYSIFTPPCSVKVGFSNQLMKRLIR-VGRISERYDPCTEQHSVV  378

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQ+ALHV+T N+  +W TCSDEV   WKD P TVLDVY+ELI AGLRIW+FSGD
Sbjct  379  YYNLPEVQQALHVYTDNAPSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGD  438

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDA+IPVTSTRYS+DALKLPTV PWR WYD+GQVGGW+QEY GLTFV VRGAGHEV LH+
Sbjct  439  TDAIIPVTSTRYSVDALKLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHK  498

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTL+ +FL GTSMP L++++DS
Sbjct  499  PKQALTLINAFLKGTSMPSLEQLADS  524



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+++ AS+ELG+ID YSIFT  C+ + S    +LKRR R VG +   YDPCTE+HS +
Sbjct  272  CDKIMEVASEELGNIDPYSIFTPPCSANVSQSKWLLKRRLR-VGQVSDKYDPCTEKHSEV  330

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV    +  +W TCSD V   WKD P T+LDVY+ELI  GLRIW+FSGD
Sbjct  331  YFNLPEVQKALHVLPEVAPSKWETCSDIVSTNWKDSPRTMLDVYRELIHVGLRIWIFSGD  390

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAVIPVTSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GL FV+VRGAGHEV LHR
Sbjct  391  ADAVIPVTSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLNFVSVRGAGHEVPLHR  450

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLALTLV++FL+GTSMPGL+++SDS
Sbjct  451  PKLALTLVKAFLSGTSMPGLEQVSDS  476



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+ +LD AS ELG+ID YSI+T  C  + S  +R L+++  KVG +   YDPCTE HS +
Sbjct  269  CDNILDIASAELGNIDPYSIYTPACPANVSQSNR-LQKQMHKVGRISEKYDPCTEAHSVV  327

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV+  ++  +W TCSD VY  W+D P TVLDVY+ELI +GLRIW+FSGD
Sbjct  328  YFNLPEVQKALHVNPNHAPSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGD  387

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TD+VIPVTSTRYSIDALKLPTV PWRPWY++GQVGGWTQEY GLTFV+VRGAGHEV LH+
Sbjct  388  TDSVIPVTSTRYSIDALKLPTVKPWRPWYEDGQVGGWTQEYAGLTFVSVRGAGHEVPLHK  447

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTL+++FL+G+SMP  + +SDS
Sbjct  448  PKQALTLIKAFLSGSSMPSSELVSDS  473



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   295 bits (756),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 166/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+ +LD AS ELG+ID YSI+T +C  + S  +R+LKR     G +   YDPCTE+H+ +
Sbjct  266  CDSILDIASAELGNIDPYSIYTPSCPANVSQSNRLLKRM-HVAGRINEKYDPCTEKHTVV  324

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV   ++  +W TCSD VY  WKD P TVLDVY+ELI +GLRIW+FSGD
Sbjct  325  YFNLPEVQKALHVDRHHAPSKWETCSDVVYTTWKDSPRTVLDVYRELIHSGLRIWMFSGD  384

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSID+LKLPTV PWR WYD GQVGGWTQEY GLTFV+VRGAGHEV LH+
Sbjct  385  TDAVIPVTSTRYSIDSLKLPTVKPWRAWYDEGQVGGWTQEYAGLTFVSVRGAGHEVPLHK  444

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLAL L+++FL+G+SMP LQ +SDS
Sbjct  445  PKLALALIKNFLSGSSMPSLQLVSDS  470



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 165/207 (80%), Gaps = 2/207 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C  +L+ A++E+G+ID YSIFT TCT + S+  R++KR   + G +   YDPCTE+HST
Sbjct  281  QCENILEIANNEIGNIDLYSIFTPTCTSNSSLSHRLMKRL--RAGRISEKYDPCTEKHST  338

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHVH   +  +W TCSD V + WKD P TVLD+Y ELI AGLRIW+FSG
Sbjct  339  VYFNLPEVQKALHVHPEVAPTKWETCSDVVNENWKDSPKTVLDIYHELIGAGLRIWIFSG  398

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRYSIDALKLPT+ PWR WYD GQVGGWTQ+Y GL FV+VRGAGHEV LH
Sbjct  399  DTDAVIPVTSTRYSIDALKLPTIGPWRAWYDEGQVGGWTQQYVGLNFVSVRGAGHEVPLH  458

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            +PKLAL+L+++FL+G  MP L   SDS
Sbjct  459  KPKLALSLIKAFLSGRQMPTLTEYSDS  485



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   294 bits (753),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+LD AS+ELG+ID YSI+T  C  + S  +++LKR    VG + + YDPCTE+HST+
Sbjct  291  CDKILDIASEELGNIDPYSIYTPPCHANDSQSNQLLKRM-HMVGRISQKYDPCTEKHSTV  349

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQ+ALHV   ++  +W TCSD VY  WKD PTTVLD+Y ELI + LRIWVFSGD
Sbjct  350  YFNQPEVQRALHVDPDHAPSKWDTCSDLVYSTWKDSPTTVLDIYHELIHSSLRIWVFSGD  409

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIP+TSTRYSIDALKLPTV PWR WYD+G+VGGWTQEYEGLTFV+VRGAGHEV LH+
Sbjct  410  TDAVIPITSTRYSIDALKLPTVCPWRAWYDDGEVGGWTQEYEGLTFVSVRGAGHEVPLHK  469

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTL++SFL+G  MP L  +SDS
Sbjct  470  PKQALTLIKSFLSGLPMPNLNLVSDS  495



>ref|XP_011018073.1| PREDICTED: serine carboxypeptidase II-2-like [Populus euphratica]
Length=371

 Score =   287 bits (735),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ D A+ ELG+ID YSIFT +C+ + S  S +L +R  +VG +   YDPCTE HST+
Sbjct  167  CDKMEDIAAKELGNIDPYSIFTPSCSANVS-QSNLLPKRKHRVGRVSEKYDPCTETHSTV  225

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGD
Sbjct  226  YFNLPEVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGD  285

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH+
Sbjct  286  TDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHK  345

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTLV++FL+GT MP LQ +SDS
Sbjct  346  PKQALTLVKAFLSGTPMPTLQLVSDS  371



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   288 bits (737),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+KVLD A +ELG+ID YSIFT +CT S S  +R+LKR    VG     YDPCTE+HS +
Sbjct  268  CDKVLDVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGHPSEKYDPCTEKHSVV  326

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQKALHV    +  +W TCS  V + W D P TVLD+Y+ELI +GLRIW+FSGD
Sbjct  327  YFNQPEVQKALHVIPAVAPAKWETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGD  386

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDAL LPTV PWR WYD GQVGGWTQEY GLTFV VRGAGHEV LHR
Sbjct  387  TDAVIPVTSTRYSIDALNLPTVKPWRAWYDEGQVGGWTQEYSGLTFVTVRGAGHEVPLHR  446

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTL++SFL+G SMP L+R+S S
Sbjct  447  PKPALTLIKSFLSGRSMPCLKRVSHS  472



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+KVL+ A +ELG+ID YSIFT +CT S S  +R+LKR    VG     YDPCTE+HS +
Sbjct  268  CDKVLEVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVV  326

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQKALHV    +  +W TCS  V + W D P TVLD+Y+ELI +GLRIW+FSGD
Sbjct  327  YFNQPEVQKALHVIPAVAPAKWETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGD  386

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDAL LPTV PWR WYD+GQVGGWTQEY GLTFV VRGAGHEV LHR
Sbjct  387  TDAVIPVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAGLTFVTVRGAGHEVPLHR  446

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTL++SFL+G SMP L+R+S S
Sbjct  447  PKPALTLIKSFLSGRSMPCLERVSHS  472



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 166/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K++D A +E+G+ID YSIFT  C+      ++++K+     G+ R+ YDPCTE+HS +
Sbjct  266  CDKIMDIAREEIGNIDLYSIFTPPCSVKIGFSNQLMKKLIMASGISRK-YDPCTEQHSAV  324

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQ+ALHV+  N++F+W TCSDEV   WKD P +VL++Y+ELI A LRIW+FSGD
Sbjct  325  YYNLPEVQQALHVYVDNATFKWATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGD  384

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDALKLPTVSPWR WYD+GQVGGWTQ+Y GLTFV VRGAGHEV LH+
Sbjct  385  TDAVIPVTSTRYSIDALKLPTVSPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHK  444

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK A TL ++FL+G  MP ++++S S
Sbjct  445  PKQAFTLFKAFLSGAPMPYMEQVSYS  470



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ D A+ ELG+ID YSIFT +C+ + S  S +L +R  +VG +   YDPCTE HST+
Sbjct  274  CDKMEDIAAKELGNIDPYSIFTPSCSANVS-QSNLLPKRKHRVGRVSEKYDPCTETHSTV  332

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGD
Sbjct  333  YFNLPEVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGD  392

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH+
Sbjct  393  TDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHK  452

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTLV++FL+GT MP LQ +SDS
Sbjct  453  PKQALTLVKAFLSGTPMPTLQLVSDS  478



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 166/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K++D A +E+G+ID YSIFT  C+      ++++K+     G+ R+ YDPCTE+HS +
Sbjct  306  CDKIMDIAREEIGNIDLYSIFTPPCSVKIGFSNQLMKKLIMASGISRK-YDPCTEQHSAV  364

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQ+ALHV+  N++F+W TCSDEV   WKD P +VL++Y+ELI A LRIW+FSGD
Sbjct  365  YYNLPEVQQALHVYVDNATFKWATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGD  424

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDALKLPTVSPWR WYD+GQVGGWTQ+Y GLTFV VRGAGHEV LH+
Sbjct  425  TDAVIPVTSTRYSIDALKLPTVSPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHK  484

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK A TL ++FL+G  MP ++++S S
Sbjct  485  PKQAFTLFKAFLSGAPMPYMEQVSYS  510



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+LD AS+ELG+ID YSI+T  CT + S  +R+LK    KVG +   YDPCTE HST+
Sbjct  276  CDKILDIASEELGNIDPYSIYTPPCTANVSGSNRLLKTM-HKVGRVYEKYDPCTEAHSTV  334

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV    +  +W TCSD V + WKD P TVLD+Y ELI +G+RIWVFSGD
Sbjct  335  YFNLPEVQKALHVSKEFAPSKWETCSDLVNNNWKDSPRTVLDIYHELIHSGIRIWVFSGD  394

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDALKL T  PW  WYD+ QVGGWTQEY GL FV VRGAGHEV LHR
Sbjct  395  TDAVIPVTSTRYSIDALKLRTTKPWHAWYDDRQVGGWTQEYAGLAFVVVRGAGHEVPLHR  454

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLALTL+++FL+GTSMP L+ +S S
Sbjct  455  PKLALTLIKAFLSGTSMPTLEPVSSS  480



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 162/201 (81%), Gaps = 2/201 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C + LD A DE+GDID YSIFT  C  +FS  +R+ +++  + G+LRR YDPCTE HST 
Sbjct  242  CEEALDDAYDEIGDIDMYSIFTPPCRTNFSRPNRLDRKKVCRFGILRRQYDPCTEEHSTA  301

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ ALH+ + NS  +W TCSD V + WKD P++VL+VY++L  AGLRIW FSGD
Sbjct  302  YFNLPEVQDALHIRSKNS--QWETCSDLVNENWKDSPSSVLNVYRKLFPAGLRIWFFSGD  359

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TD+VIPV STRYSI+AL+LPTVSPWR WY++GQVGGWT+EYEGLT V VRGAGHEVALH+
Sbjct  360  TDSVIPVASTRYSINALRLPTVSPWRAWYNDGQVGGWTEEYEGLTLVTVRGAGHEVALHK  419

Query  207  PKLALTLVESFLAGTSMPGLQ  145
            PKL+LTLV+SFL G  MP L+
Sbjct  420  PKLSLTLVDSFLRGNPMPKLE  440



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   285 bits (730),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+ +LD A+ ELG+ID YSI+T +C  + S  S  L++R   VG + + YDPCTE HS +
Sbjct  269  CDNILDIANAELGNIDPYSIYTPSCPANVS-QSNGLRKRRNTVGHISQKYDPCTEAHSVV  327

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV   ++  +W TCSD V   WKD P TVLDVY+ELI +GLRIW+FSGD
Sbjct  328  YFNLPEVQKALHVDPDHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGD  387

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAVIP+TSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GLTFV+VRGAGHEV LH+
Sbjct  388  NDAVIPITSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHK  447

Query  207  PKLALTLVESFLAGTSMPGLQRI  139
            PK ALTL++SFL+G+SMP  +++
Sbjct  448  PKQALTLIKSFLSGSSMPASEQL  470



>gb|AFK34001.1| unknown [Medicago truncatula]
Length=239

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 156/201 (78%), Gaps = 4/201 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ D A +E+GDID YSIFT  C     +    L +R    G LR +YDPCTE+HS I
Sbjct  35   CDKIWDIAYEEMGDIDPYSIFTPPC----HVNDNQLDKRKHSFGRLRSVYDPCTEKHSII  90

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQ+ALHV   +   +W TCSD V   WKD PT+VL++Y+ELI  GLRIW+FSG+
Sbjct  91   YFNRPEVQRALHVDPDHKPDKWQTCSDVVGTNWKDSPTSVLNIYRELIPTGLRIWIFSGN  150

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPV STRYSI+ALKLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHR
Sbjct  151  TDAVIPVASTRYSINALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHR  210

Query  207  PKLALTLVESFLAGTSMPGLQ  145
            PKLALTL+++FL GTSMP L+
Sbjct  211  PKLALTLIKAFLEGTSMPTLE  231



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C  +L+ A  ELGDID YSIFT  CT + S  +R+LK+R R VG + + YDPCTE HST+
Sbjct  274  CGAILEVADKELGDIDHYSIFTPPCTTNSSGSNRLLKKRHR-VGHVSKKYDPCTEAHSTV  332

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV       +W TCSD V + WKD P TVL++Y ELI +GLRIW+FSGD
Sbjct  333  YFNLPEVQKALHVSPEFLPSKWETCSDLVNENWKDSPRTVLNIYHELIHSGLRIWMFSGD  392

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDALKLPT  PW  WYD+GQVGGWTQEY GL FV VRGAGHEV LHR
Sbjct  393  TDAVIPVTSTRYSIDALKLPTTKPWHAWYDDGQVGGWTQEYAGLNFVVVRGAGHEVPLHR  452

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLAL L+++FL+G SMP  + +S S
Sbjct  453  PKLALALIKTFLSGVSMPTHELVSAS  478



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+LD AS+ELG+ID YSIFT +C  S +     L +R    G     YDPCTE+HST
Sbjct  267  ECEKILDVASNELGNIDPYSIFTPSCPGSVTFSKNKLLKRLHSFGRAGEKYDPCTEKHST  326

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHV+   +  +W TCSD V + WKDCP +VL +Y ELI  GLRIW+FSG
Sbjct  327  VYFNLPEVQKALHVNPAVAPSKWETCSDIVNENWKDCPRSVLHIYHELIQYGLRIWMFSG  386

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPV STRYS+D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHEV LH
Sbjct  387  DTDAVIPVASTRYSVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLH  446

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            RPK AL L +SFL+G+ MP L    DS
Sbjct  447  RPKQALVLFKSFLSGSPMPTLSEFDDS  473



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   283 bits (725),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+KVLD ASDELGDID YSI+T  C  + S  +R L++R + +G +   YDPCTE HS  
Sbjct  269  CDKVLDIASDELGDIDPYSIYTPLCPVNGSQSNR-LRKRMKVIGHVNEKYDPCTEEHSVK  327

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN  EVQ ALHV+   +  +W TCSD V + WKD P TVLD+Y+EL+  GLRIW+FSGD
Sbjct  328  YFNRAEVQTALHVNKAFAPAKWDTCSDLVSENWKDAPRTVLDIYRELMREGLRIWMFSGD  387

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRY+ID+LKLPTV P+R WYD+G VGGWTQEY GLTFV+VRGAGHEV LHR
Sbjct  388  TDAVIPVTSTRYTIDSLKLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHR  447

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLAL L+++FLAGTSMP LQ +SDS
Sbjct  448  PKLALALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+KVLD ASDELGDID YSI+T  C  + S  +R L++R + +G +   YDPCTE HS  
Sbjct  269  CDKVLDIASDELGDIDPYSIYTPLCPVNGSQSNR-LRKRMKVIGHVNEKYDPCTEEHSVK  327

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN  EVQ ALHV+   +  +W TCSD V + WKD P TVLD+Y+EL+  GLRIW+FSGD
Sbjct  328  YFNRAEVQTALHVNKAFAPAKWDTCSDLVNENWKDAPRTVLDIYRELMREGLRIWMFSGD  387

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRY+ID+LKLPTV P+R WYD+G VGGWTQEY GLTFV+VRGAGHEV LHR
Sbjct  388  TDAVIPVTSTRYTIDSLKLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHR  447

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLAL L+++FLAGTSMP LQ +SDS
Sbjct  448  PKLALALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 165/207 (80%), Gaps = 3/207 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C  +LD AS+ELG+ID YSI+T +CT + S+ +++LKR    +G L   YDPC+E+HS 
Sbjct  272  KCETILDIASNELGNIDPYSIYTPSCTTNSSLPNKLLKRL---IGHLNEAYDPCSEKHSV  328

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQ+ALHV+   +  +W TCS  V   W+D   +VLD+Y EL+ AGLRIW+FSG
Sbjct  329  VYFNQPEVQQALHVNPQFAPVKWETCSGLVNSNWQDSSRSVLDIYHELMDAGLRIWMFSG  388

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRY+IDALKLPT+ PW  WYD+GQVGGWTQEY+GLTFV VRGAGHEV LH
Sbjct  389  DTDAVIPVTSTRYNIDALKLPTIKPWHAWYDDGQVGGWTQEYKGLTFVVVRGAGHEVPLH  448

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            R KL+LTLV+SFLAG SMP L+++SDS
Sbjct  449  RAKLSLTLVKSFLAGESMPTLEQVSDS  475



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 160/203 (79%), Gaps = 1/203 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+  LD A+ ELG+ID YSI+T +C  + S  S  L++R   VG + + YDPCTE HS +
Sbjct  269  CDNXLDIANAELGNIDPYSIYTPSCPANVS-QSNGLRKRRNTVGHISQKYDPCTEAHSVV  327

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALH    ++  +W TCSD V   WKD P TVLDVY+ELI +GLRIW+FSGD
Sbjct  328  YFNLPEVQKALHXDPGHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGD  387

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAVIP+TSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GLTFV+VRGAGHEV LH+
Sbjct  388  NDAVIPITSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHK  447

Query  207  PKLALTLVESFLAGTSMPGLQRI  139
            PK ALTL++SFL+G+SMP  +++
Sbjct  448  PKQALTLIKSFLSGSSMPASEQL  470



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC ++LD A  ELG+ID YSIFT +C  S +     L +R   VG +   YDPCTE+HST
Sbjct  267  ECERILDIADKELGNIDPYSIFTPSCPGSVTFSKNKLLKRRHSVGSIGEKYDPCTEQHST  326

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALH++   +  +W TCSD V + WKD   +VL +Y ELI  GLRIW+FSG
Sbjct  327  VYFNLPEVQKALHINPAFAPSKWETCSDVVNENWKDSARSVLHIYHELIGYGLRIWMFSG  386

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRY+ID+LKLPTV+PW PWYD+GQVGGWTQ Y+GLTFV VRGAGHEV LH
Sbjct  387  DTDAVIPVTSTRYNIDSLKLPTVTPWHPWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLH  446

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            +PKLAL L +SFL+G+SMP    + DS
Sbjct  447  QPKLALVLFKSFLSGSSMPTFTGLDDS  473



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 158/199 (79%), Gaps = 1/199 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CN+++D AS+E+G+ID YSIFT +C+ + S    +LKRR   V  L   YDPCTE+HS +
Sbjct  272  CNEMMDLASEEMGNIDPYSIFTPSCSANASQTKWLLKRR-LMVSQLSEKYDPCTEKHSEV  330

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQK+LHV    +  +W TCSD V   WKD P T+LDVY+ELI  GLRIW+FSGD
Sbjct  331  YFNLPEVQKSLHVLPEAAPSKWETCSDIVNTNWKDSPITMLDVYRELIHEGLRIWIFSGD  390

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIP+TSTRYSIDALKL T+ PWR WYD+GQVGGWTQEYEGL FV+VRGAGHEV LHR
Sbjct  391  TDAVIPITSTRYSIDALKLATMKPWRAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHR  450

Query  207  PKLALTLVESFLAGTSMPG  151
            PK ALTL ++FL+GTSMP 
Sbjct  451  PKQALTLFKAFLSGTSMPA  469



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD AS E G+ID+YSIFT TC  +F+     + +R R VG +   YDPCTE+HST
Sbjct  266  QCDKILDIASKEAGNIDSYSIFTPTCHATFASSKNKVMKRLRSVGKMGEQYDPCTEKHST  325

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV+      +W TCS  V + W DC  +VL +Y ELI  GLRIWVFSG
Sbjct  326  VYFNLAEVQKALHVNPVIGKSKWETCSGVVNNHWGDCERSVLHIYHELIQYGLRIWVFSG  385

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAVIPVTSTRYSIDALKLPTV+PW  WY DNG+VGGW+Q YEGLTFV VRGAGHEV L
Sbjct  386  DTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDNGEVGGWSQGYEGLTFVTVRGAGHEVPL  445

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRPK ALTL++SFLAGT MP
Sbjct  446  HRPKQALTLIKSFLAGTPMP  465



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 156/201 (78%), Gaps = 4/201 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ D A +E+GDID YSIFT  C     +    L +R    G LR +YDPCTE+HS I
Sbjct  269  CDKIWDIAYEEMGDIDPYSIFTPPC----HVNDNQLDKRKHSFGRLRSVYDPCTEKHSII  324

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQ+ALHV   +   +W TCSD V   WKD PT+VL++Y+ELI  GLRIW+FSG+
Sbjct  325  YFNRPEVQRALHVDPDHKPDKWQTCSDVVGTNWKDSPTSVLNIYRELIPTGLRIWIFSGN  384

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPV STRYSI+ALKLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHR
Sbjct  385  TDAVIPVASTRYSINALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHR  444

Query  207  PKLALTLVESFLAGTSMPGLQ  145
            PKLALTL+++FL GTSMP L+
Sbjct  445  PKLALTLIKAFLEGTSMPTLE  465



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+LD AS+ELG ID YSI T +C  + +     L +R    G +   YDPCTE+HST
Sbjct  265  ECEKILDVASNELGTIDPYSILTPSCPGTVTFSKNKLLKRLHSFGRVGEKYDPCTEKHST  324

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IYFNLPEVQKALHV+   +  EW TCSD V + WKD P +VL +Y ELI  GLRIW+FSG
Sbjct  325  IYFNLPEVQKALHVNPVVAPSEWETCSDVVNENWKDSPRSVLHIYHELIHYGLRIWMFSG  384

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPVTSTRY++D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHEV LH
Sbjct  385  DTDAVIPVTSTRYNVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLH  444

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            RPK AL L +SFL+G+ MP L    DS
Sbjct  445  RPKQALVLFKSFLSGSPMPTLSEFVDS  471



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 160/208 (77%), Gaps = 3/208 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR--KVGLLRRIYDPCTERHS  574
            C  + + A  ELG+ID YS+FT  C  + S +SR+++R++R  ++GL    YDPCTERHS
Sbjct  266  CENIWEIADKELGNIDPYSLFTPPCHANVSQLSRLVRRKNRIGRLGLSTE-YDPCTERHS  324

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQ ALHV   +    W TCSD VY  WKD P +VLD+Y ELI  GL+IWVFS
Sbjct  325  IVYFNRPEVQTALHVDLDHKPATWETCSDVVYTNWKDSPRSVLDIYHELIGMGLKIWVFS  384

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            G+TD VIPVTSTRYSI ALKLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV L
Sbjct  385  GNTDVVIPVTSTRYSISALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVIVRGAGHEVPL  444

Query  213  HRPKLALTLVESFLAGTSMPGLQRISDS  130
            H+PKLALTLV++FLAGTSMP L  +S S
Sbjct  445  HKPKLALTLVQTFLAGTSMPNLDLLSTS  472



>gb|ACF84647.1| unknown [Zea mays]
Length=257

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K++D AS E G+ID+YSIFT TC  SF+     + +R    G +   YDPCTE+HST
Sbjct  49   QCDKIMDIASTEAGNIDSYSIFTPTCHASFASSKNKVMKRLHSAGKMGEQYDPCTEKHST  108

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV+T     +W TCS+ V   W DC  +VL +Y ELI  GLRIWVFSG
Sbjct  109  VYFNLAEVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSG  168

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAVIPVTSTRYSIDALKLPT++PW  WY D+G+VGGWTQ Y GL FV VRGAGHEV L
Sbjct  169  DTDAVIPVTSTRYSIDALKLPTITPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPL  228

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRPK ALTL++SFL G+ MP
Sbjct  229  HRPKQALTLIKSFLTGSPMP  248



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 4/204 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C ++L+ A  E+G+ID YSIFT  C  +    ++ +KR++  VG LR +YDPCTE+HSTI
Sbjct  239  CERILEIADKEMGNIDPYSIFTPPCHAN---DNQQIKRKN-SVGRLRGVYDPCTEKHSTI  294

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQ+ LHV       +W TCS  V   WKD P TVLD+Y+ELI  GLRIW+FSG+
Sbjct  295  YFNRPEVQRILHVDPDYKPAKWETCSTVVNTNWKDSPRTVLDIYRELIPTGLRIWIFSGN  354

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRY+I+ALKLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHR
Sbjct  355  TDAVIPVTSTRYTINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHR  414

Query  207  PKLALTLVESFLAGTSMPGLQRIS  136
            PKLALTL+++FLAGTSMP L+ ++
Sbjct  415  PKLALTLIKAFLAGTSMPTLEPLT  438



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 156/203 (77%), Gaps = 1/203 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +CNK+LD ASDE G+ID+YSIFT TC  SF+     + +R   VG +   YDPCTE+HST
Sbjct  276  QCNKILDIASDEAGNIDSYSIFTPTCHASFASSRNKVMKRLHSVGKMGERYDPCTEKHST  335

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV    +  +W TCSD V   WKDC  +VL +Y ELI  GLRIWVFSG
Sbjct  336  VYFNLAEVQKALHVSPIINKSKWETCSDVVNTNWKDCERSVLHIYHELIQYGLRIWVFSG  395

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAV+PVTSTRYSI+ALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV L
Sbjct  396  DTDAVLPVTSTRYSINALKLPTVTPWNAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPL  455

Query  213  HRPKLALTLVESFLAGTSMPGLQ  145
            HRPK AL L++SFLAG+ MP +Q
Sbjct  456  HRPKQALILIKSFLAGSPMPSVQ  478



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 4/204 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C ++L+ A  E+G+ID YSIFT  C  +    ++ +KR++  VG LR +YDPCTE+HSTI
Sbjct  270  CERILEIADKEMGNIDPYSIFTPPCHAN---DNQQIKRKN-SVGRLRGVYDPCTEKHSTI  325

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQ+ LHV       +W TCS  V   WKD P TVLD+Y+ELI  GLRIW+FSG+
Sbjct  326  YFNRPEVQRILHVDPDYKPAKWETCSTVVNTNWKDSPRTVLDIYRELIPTGLRIWIFSGN  385

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRY+I+ALKLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHR
Sbjct  386  TDAVIPVTSTRYTINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHR  445

Query  207  PKLALTLVESFLAGTSMPGLQRIS  136
            PKLALTL+++FLAGTSMP L+ ++
Sbjct  446  PKLALTLIKAFLAGTSMPTLEPLT  469



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 162/223 (73%), Gaps = 18/223 (8%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+KVL+ A +ELG+ID YSIFT +CT S S  +R+LKR    VG     YDPCTE+HS +
Sbjct  268  CDKVLEVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVV  326

Query  567  YFNLPEVQKALHVHTTNSSFEWVTC-----------------SDEVYDFWKDCPTTVLDV  439
            YFN PEVQKALHV    +  +W TC                 S  V + W D P TVLD+
Sbjct  327  YFNQPEVQKALHVIPAVAPAKWETCRWHQQYTLVISLFLLLCSGVVNNNWLDSPRTVLDI  386

Query  438  YQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEG  259
            Y+ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV PWR WYD+GQVGGWTQEY G
Sbjct  387  YRELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAG  446

Query  258  LTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  130
            LTFV VRGAGHEV LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  447  LTFVTVRGAGHEVPLHRPKPALTLIKSFLSGRSMPCLERVSHS  489



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 155/201 (77%), Gaps = 4/201 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C ++L+ A  E+G+ID +SIFT  C E+         RR    G LR +YDPCTE HS I
Sbjct  269  CERILEIADKEMGNIDPFSIFTPPCHEN----DNQPDRRKHSFGRLRGVYDPCTENHSNI  324

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQ+ALHV+  +   +W TCSD V   WKD P +VL++Y+ELI  GLRIW+FSG+
Sbjct  325  YFNRPEVQRALHVNPDHKPDKWQTCSDVVGTNWKDSPRSVLNIYRELIPTGLRIWIFSGN  384

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDA+IPVTSTRYSI+ALKLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHR
Sbjct  385  TDAIIPVTSTRYSINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHR  444

Query  207  PKLALTLVESFLAGTSMPGLQ  145
            PKLALTL+++FL GTSMP L+
Sbjct  445  PKLALTLIKAFLEGTSMPTLE  465



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTES-FSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            C K+ + A++ELG+ID YS+FT  C  +  S +SR+++R+ R +G L   YDPCTE+HS 
Sbjct  264  CEKIWEIANEELGNIDPYSLFTPPCQHANVSQLSRLVRRKHR-IGRLSAEYDPCTEKHSI  322

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN P+VQ  LHV   +    W TCSDEV+  WKD P TVL++Y ELI  GLRIWVFSG
Sbjct  323  VYFNRPDVQTVLHVDPDHKPATWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSG  382

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            +TD VIPVTSTRYSI AL LPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH
Sbjct  383  NTDVVIPVTSTRYSIKALDLPTVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLH  442

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
             PKLALTL ++FLAGTSMP L+ +  S
Sbjct  443  SPKLALTLFKAFLAGTSMPNLELVGAS  469



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTES-FSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            C K+ + A++ELG+ID YS+FT  C  +  S +SR+++R+ R +G L   YDPCTE+HS 
Sbjct  278  CEKIWEIANEELGNIDPYSLFTPPCQHANVSQLSRLVRRKHR-IGRLSAEYDPCTEKHSI  336

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN P+VQ  LHV   +    W TCSDEV+  WKD P TVL++Y ELI  GLRIWVFSG
Sbjct  337  VYFNRPDVQTVLHVDPDHKPATWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSG  396

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            +TD VIPVTSTRYSI AL LPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH
Sbjct  397  NTDVVIPVTSTRYSIKALDLPTVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLH  456

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
             PKLALTL ++FLAGTSMP L+ +  S
Sbjct  457  SPKLALTLFKAFLAGTSMPNLELVGAS  483



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 156/206 (76%), Gaps = 13/206 (6%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ D A+ ELG+ID YSIFT +C+ +             +VG +   YDPCTE H+T+
Sbjct  274  CDKMEDIATKELGNIDPYSIFTPSCSAN-------------RVGRVSEKYDPCTETHTTV  320

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGD
Sbjct  321  YFNLPEVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIHSGLHVWVFSGD  380

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH+
Sbjct  381  TDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHK  440

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PK ALTLV++FL+GT MP LQ +SDS
Sbjct  441  PKQALTLVKAFLSGTPMPTLQLVSDS  466



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 156/199 (78%), Gaps = 0/199 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+LD AS+ELG+ID YSIFT +CT SF++    L +R    G + + YDPCTE+HS 
Sbjct  269  ECQKILDIASNELGNIDPYSIFTPSCTGSFTLSKNKLLKRLHSAGRIGKKYDPCTEKHSM  328

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQK LHV+   +  +WVTCSD V   +KD   +VL +Y+ELI+ GLRIW+FSG
Sbjct  329  VYFNLPEVQKVLHVNPAFAPSKWVTCSDFVDKNYKDSSRSVLPIYRELISHGLRIWMFSG  388

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPV STRY+IDALKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHE++L 
Sbjct  389  DTDAVIPVASTRYNIDALKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEISLL  448

Query  210  RPKLALTLVESFLAGTSMP  154
            RPK AL L+++FL+G  MP
Sbjct  449  RPKSALVLIKAFLSGNPMP  467



>gb|EMT26558.1| putative Serine carboxypeptidase II-2 [Aegilops tauschii]
Length=389

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD AS E G+ID+YSIFT TC  SF+     + +R R  G +   YDPCTE+HS 
Sbjct  181  QCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSAGKMGEQYDPCTEQHSI  240

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV+      +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSG
Sbjct  241  VYFNLHEVQKALHVNPVIGKSKWETCSEVINTNWKDCDRSVLHIYHELIQYGLRIWMFSG  300

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAVIPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV L
Sbjct  301  DTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPL  360

Query  213  HRPKLALTLVESFLAGTSMPGLQRI  139
            HRPK ALTL++SFLAG+ MP L  +
Sbjct  361  HRPKQALTLIKSFLAGSPMPVLSDL  385



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD AS E G+ID+YSIFT TC  SF+     + +R R VG +   YDPCTE+HS 
Sbjct  228  QCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEKHSI  287

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV+      +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSG
Sbjct  288  VYFNLHEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSG  347

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAVIPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV L
Sbjct  348  DTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPL  407

Query  213  HRPKLALTLVESFLAGTSMPGLQRI  139
            HRPK ALTL++SFLAG  MP L  +
Sbjct  408  HRPKQALTLIKSFLAGRPMPVLSDL  432



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 156/205 (76%), Gaps = 1/205 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD AS E G+ID+YSIFT TC  SF+     + +R R VG +   YDPCTE+HS 
Sbjct  261  QCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEQHSI  320

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV+      +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSG
Sbjct  321  VYFNLHEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSG  380

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAVIPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV L
Sbjct  381  DTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPL  440

Query  213  HRPKLALTLVESFLAGTSMPGLQRI  139
            HRPK ALTL++SFLAG+ MP L  +
Sbjct  441  HRPKQALTLIKSFLAGSPMPVLSDL  465



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K++D AS E G+ID+YSIFT TC  SF+     + +R    G +   YDPCTE+HST
Sbjct  266  QCDKIMDIASTEAGNIDSYSIFTPTCHASFASSKNKVMKRLHSAGKMGEQYDPCTEKHST  325

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV+T     +W TCS+ V   W DC  +VL +Y ELI  GLRIWVFSG
Sbjct  326  VYFNLAEVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSG  385

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAVIPVTSTRYSIDALKLPT++PW  WY D+G+VGGWTQ Y GL FV VRGAGHEV L
Sbjct  386  DTDAVIPVTSTRYSIDALKLPTITPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPL  445

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRPK ALTL++SFL G+ MP
Sbjct  446  HRPKQALTLIKSFLTGSPMP  465



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD AS E G+ID+YSIFT TC  SF+     + +R R VG +   YDPCTE+HS 
Sbjct  261  QCDKILDVASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEQHSI  320

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV+      +W TCS+ +   WKDC  +VL +Y ELI  GL IW+FSG
Sbjct  321  VYFNLHEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLHIWMFSG  380

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAVIPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV L
Sbjct  381  DTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPL  440

Query  213  HRPKLALTLVESFLAGTSMPGLQRI  139
            HRPK ALTL++SFLAG+ MP L  +
Sbjct  441  HRPKQALTLIKSFLAGSPMPVLSDL  465



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 152/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +CNK+LD AS E G+ID+YSIFT TC  SF+     + +R   VG +   YDPCTE+HST
Sbjct  276  QCNKILDIASTEAGNIDSYSIFTPTCHSSFAASRNKVMKRLHSVGKMGERYDPCTEKHST  335

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALH     +  +W TCSD V   WKDC  +VL +Y ELI  GLRIWVFSG
Sbjct  336  VYFNLAEVQKALHASPIINKSKWETCSDIVNTNWKDCERSVLHIYHELIQYGLRIWVFSG  395

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAV+PVTSTRYSIDALKL TV+PW  WYD +G+VGGWTQ Y+GL FV+VRGAGHEV L
Sbjct  396  DTDAVLPVTSTRYSIDALKLLTVTPWSAWYDEDGEVGGWTQGYKGLNFVSVRGAGHEVPL  455

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRPK AL L++SFLAG +MP
Sbjct  456  HRPKQALILIKSFLAGRAMP  475



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+K+LD AS E G+ID+YSIFT TC  SF+     + +R R VG +   YDPCTE+HS 
Sbjct  266  QCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVMKRLRSVGKMGEQYDPCTEKHSI  325

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNL EVQKALHV+      +W TCS  + + W D   +VL +Y ELI  GLRIW+FSG
Sbjct  326  VYFNLAEVQKALHVNPVIGKSKWETCSGVINNNWGDSERSVLHIYHELIQYGLRIWMFSG  385

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            DTDAVIPVTSTRYSI+ALKLPTV+PW  WY D+G+VGGWTQ Y+GLTFV VRGAGHEV L
Sbjct  386  DTDAVIPVTSTRYSINALKLPTVAPWHAWYDDDGEVGGWTQGYQGLTFVTVRGAGHEVPL  445

Query  213  HRPKLALTLVESFLAGTSMPGLQRI  139
            HRPK ALTL++SFLAG+ MP L  +
Sbjct  446  HRPKQALTLIKSFLAGSPMPVLSDL  470



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CN+++D AS+E+G+ID YSIFT +C+ + S    +LKRR   V  L   YDPCTE+HS +
Sbjct  272  CNEMMDVASEEMGNIDPYSIFTPSCSANASQTKWLLKRR-HMVSQLSEKYDPCTEKHSEV  330

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQK+LHV    +  +W TCSD V   WKD P T+LDVY+EL   GLRI +FSGD
Sbjct  331  YFNLPEVQKSLHVLPEAAPSKWETCSDIVNTNWKDSPITMLDVYRELTREGLRICIFSGD  390

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAVIP+TSTRYSIDALKL TV PW  WYD+GQVGGWTQEYEGL FV+VRGAGHEV LHR
Sbjct  391  TDAVIPITSTRYSIDALKLATVKPWHAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHR  450

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++FL+GTSM
Sbjct  451  PKQALALFKAFLSGTSM  467



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C+KV+D A +ELG ID YS+FT TC +  S +S  L+ +    G +   YDPCTE+HST
Sbjct  266  QCDKVIDQAYEELGGIDPYSVFTITC-QGNSTLSNKLRSKSNSFGRIGEQYDPCTEKHST  324

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALHV+   +  +W TCSD V   W+D   ++L +Y ELI  GLRIW+FSG
Sbjct  325  VYFNQPEVQKALHVNPAFAPSKWKTCSDVVGVNWRDSVKSILPIYHELIHEGLRIWMFSG  384

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDA+IPVTSTRY+IDAL+LPTV+PW  WYDNGQVGGWTQ Y+GLTFV VRGAGHEVALH
Sbjct  385  DTDAIIPVTSTRYNIDALRLPTVTPWHAWYDNGQVGGWTQVYKGLTFVTVRGAGHEVALH  444

Query  210  RPKLALTLVESFLAGTSMPGLQRI  139
            +P+LAL L+++FL G+ MP L  +
Sbjct  445  KPRLALRLIKAFLVGSPMPTLASL  468



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   266 bits (681),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 151/209 (72%), Gaps = 7/209 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERH  577
            CN  LD A  E+G+ID YSI+T  C  S    +   +++ RK    R +   YDPCTE+H
Sbjct  245  CNMALDKADVEMGEIDPYSIYTPPCLNS----TGTYRKQHRKRYPWRHLFGEYDPCTEKH  300

Query  576  STIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVF  397
            S IYFNLPEVQKALH + T   + W TCSD V D W D P ++L +YQELI AGLRIW+F
Sbjct  301  SEIYFNLPEVQKALHANVTGIPYRWTTCSDAVADHWGDSPRSMLPIYQELIKAGLRIWMF  360

Query  396  SGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVA  217
            SGDTDAVIPVTSTRYSI+ALKLPTV+ W PWYDNGQVGGWTQ YEGLTFV VRGAGHEV 
Sbjct  361  SGDTDAVIPVTSTRYSINALKLPTVTQWHPWYDNGQVGGWTQVYEGLTFVTVRGAGHEVP  420

Query  216  LHRPKLALTLVESFLAGTSMPGLQRISDS  130
            LH P+ A T+ ESFL G  MP   ++ D+
Sbjct  421  LHEPRKAFTVFESFLEGKPMPVSPKLVDT  449



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+++L+ A  E+G+ID YSIFT  C+E+    S  L++R   +G +   YDPCTE+HS  
Sbjct  266  CDEILEVADKEIGNIDHYSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDPCTEKHSVA  322

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGD
Sbjct  323  YFNLPEVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGD  382

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+P+TSTRYS+DALKLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH+
Sbjct  383  TDAVLPITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQ  442

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLAL L++SFLAG S+  LQ  SD+
Sbjct  443  PKLALQLIKSFLAGNSLSPLQLHSDT  468



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 153/203 (75%), Gaps = 4/203 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K+L+ A DELG++D YSI+T  C  +         +R   +G LR  YDPCTE+HS  
Sbjct  282  CEKILEIADDELGNLDPYSIYTPPCHGN----DNHKVKRKHSIGRLRATYDPCTEKHSIK  337

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQ+ LHV   +   +W TCSD V   WKD P TVLD+Y+ELI  GLRIW+FSG+
Sbjct  338  YFNQPEVQRILHVDPHHKPEKWETCSDLVNINWKDSPRTVLDIYRELIPTGLRIWMFSGN  397

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TD+VIPVTSTRY+IDALKLPTVSPWR WYD+G+VGGW QEY GLTFV +RGAGHEV LH+
Sbjct  398  TDSVIPVTSTRYTIDALKLPTVSPWRAWYDDGEVGGWIQEYAGLTFVTIRGAGHEVPLHK  457

Query  207  PKLALTLVESFLAGTSMPGLQRI  139
            PKLALTL ++FLAGTSMP L+ +
Sbjct  458  PKLALTLFKAFLAGTSMPTLEPL  480



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 151/201 (75%), Gaps = 4/201 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K+ + A  ELG+ID YSIF   C  + + M +   R    VG LR +YDPCT +HST 
Sbjct  270  CEKIWEIAEKELGNIDPYSIFATPCHANDNQMVKGKHR----VGNLRTVYDPCTSKHSTT  325

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ LHVH  +   +W TCS  V   WKD P TVL++Y+ELI  GLRIW+FSG+
Sbjct  326  YFNLPEVQRILHVHPDHRPAKWQTCSVVVAINWKDSPRTVLNIYRELIPTGLRIWMFSGN  385

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+PVTSTRYSIDALKLPTVSPWR WYD+G+V GWTQEY GLTFV VRGAGHEV LHR
Sbjct  386  TDAVLPVTSTRYSIDALKLPTVSPWRAWYDDGEVAGWTQEYAGLTFVNVRGAGHEVPLHR  445

Query  207  PKLALTLVESFLAGTSMPGLQ  145
            PKLAL L +SFLAGTSM  L+
Sbjct  446  PKLALALFKSFLAGTSMQTLE  466



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 152/201 (76%), Gaps = 4/201 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K+ + +  ELG+ID Y+IFT  C  +       L +R  +VG LR +YDPCT +HST 
Sbjct  358  CEKIWEISEKELGNIDPYNIFTTPCHAN----DNQLVKRKHRVGNLRTVYDPCTSKHSTT  413

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ LHVH  +   +W TCS  V   WKD P TVL++Y+ELI  GLRIW+FSG+
Sbjct  414  YFNLPEVQRILHVHPDHRPAKWQTCSVVVAINWKDSPRTVLNIYRELIPTGLRIWMFSGN  473

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+PVTSTRYSIDALKLPTVSPWR WYD+G+V GWTQEY GLTFV VRGAGHEV LHR
Sbjct  474  TDAVLPVTSTRYSIDALKLPTVSPWRAWYDDGEVAGWTQEYAGLTFVNVRGAGHEVPLHR  533

Query  207  PKLALTLVESFLAGTSMPGLQ  145
            PKLAL L +SFLAGTSM  L+
Sbjct  534  PKLALALFKSFLAGTSMQTLE  554



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+++L+ A  E+G+ID YSIFT  C+E   + S  L++R   VG +   YDPCTE+HS  
Sbjct  266  CDEILEVADKEIGNIDHYSIFTPPCSE---VSSNRLRKRMHMVGRIGERYDPCTEQHSVA  322

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGD
Sbjct  323  YFNLPEVQQALHVDPKFAPSKWETCSYVINGNWKDSAGSVLDIYRELIQAGLRIWVFSGD  382

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+P+TSTRYS+DALKLP + PWR WYD GQVGGW QEYEG+T V+VRGAGHEV LH+
Sbjct  383  TDAVLPITSTRYSVDALKLPVIGPWRAWYDEGQVGGWIQEYEGVTLVSVRGAGHEVPLHQ  442

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLAL L ++FLAG S+  LQ  SD+
Sbjct  443  PKLALQLFKAFLAGNSLSPLQLHSDT  468



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+++L+ A  E+G+ID YSIFT  C+E+    S  L++R   +G +   YDPCTE+HS  
Sbjct  340  CDEILEVADKEIGNIDHYSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDPCTEKHSVA  396

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGD
Sbjct  397  YFNLPEVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGD  456

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+P+TSTRYS+DALKLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH+
Sbjct  457  TDAVLPITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQ  516

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLAL L++SFLAG S+  LQ  SD+
Sbjct  517  PKLALQLIKSFLAGNSLSPLQLHSDT  542



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+++L+ A  E+G+ID YSIFT  C+E+    S  L++R   +G +   YD CTE+HS  
Sbjct  266  CDEILEVADKEIGNIDHYSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDLCTEKHSVA  322

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGD
Sbjct  323  YFNLPEVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGD  382

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+P+TSTRYS+DALKLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH+
Sbjct  383  TDAVLPITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQ  442

Query  207  PKLALTLVESFLAGTSMPGLQRISDS  130
            PKLAL L++SFLAG S+  LQ  SD+
Sbjct  443  PKLALQLIKSFLAGNSLSPLQLHSDT  468



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 151/210 (72%), Gaps = 17/210 (8%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ D A+ ELG+ID YSIFT +C+ +             +VG +   YDPCTE H+T+
Sbjct  274  CDKMEDIATKELGNIDPYSIFTPSCSAN-------------RVGRVSEKYDPCTETHTTV  320

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEV----YDFWKDCPTTVLDVYQELITAGLRIWV  400
            YFNLPEVQKALHV    +   W TC             D P TVLD+Y+ELI +GL +WV
Sbjct  321  YFNLPEVQKALHVSPEFAPARWETCRGATCPHHLTLIFDSPRTVLDIYKELIHSGLHVWV  380

Query  399  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  220
            FSGDTDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV
Sbjct  381  FSGDTDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEV  440

Query  219  ALHRPKLALTLVESFLAGTSMPGLQRISDS  130
             LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  441  PLHKPKQALTLVKAFLSGTPMPTLQLVSDS  470



>ref|XP_006470942.1| PREDICTED: serine carboxypeptidase II-2-like [Citrus sinensis]
Length=315

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 154/234 (66%), Gaps = 29/234 (12%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+KVLD A +ELG+ID YSIFT +CT S S  +R+LKR    VG     YDPCTE+HS +
Sbjct  81   CDKVLDVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVV  139

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCS------------------DEVYDFWKDCPTTVLD  442
            YFN PEVQKALHV    +  +W TC                     V + W D P  VLD
Sbjct  140  YFNQPEVQKALHVIPAVALAKWETCRWHQQHALMIFFIFTALQWGVVNNNWLDSPRIVLD  199

Query  441  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGG------  280
            +Y ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV PWR WYD GQV        
Sbjct  200  IYHELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAWYDEGQVNYTTKPFI  259

Query  279  ----WTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  130
                WTQEY GLT V VRGA HEV LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  260  TYILWTQEYAGLTLVTVRGADHEVPLHRPKPALTLIKSFLSGRSMPCLERVSLS  313



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   257 bits (656),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 149/197 (76%), Gaps = 0/197 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C KVL  A  E+G+ID YS+FT  C  + S  S +L ++   V  L R+YDPCT++HS +
Sbjct  279  CKKVLKIADKEMGNIDRYSVFTPACVTNSSQSSMLLNKKRPFVSDLSRVYDPCTKKHSKV  338

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLP+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD
Sbjct  339  YFNLPKVQKALHVPPKVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGD  398

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DA++PVTSTRYSI+AL L T+SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALHR
Sbjct  399  ADAIVPVTSTRYSINALNLSTISPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHR  458

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  459  PKEALALFKAFISGTPL  475



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C +VLDTA  E+G+ID YS+FT TC  + +    +LK+R   +G +   YDPCTE+HS +
Sbjct  270  CIEVLDTADKEIGNIDQYSVFTPTCPGNVTQTKFLLKKRP-ILGRVSENYDPCTEKHSIM  328

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ ALHV    +  +W TCSD V + WKD P +VL++Y ELI AGL IWVFSGD
Sbjct  329  YFNLPEVQTALHVPPELAPSKWETCSDTVGNHWKDSPRSVLNIYHELIAAGLHIWVFSGD  388

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDAL L  ++PWRPWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  389  ADAVVPVTSTRYSIDALNLRPLNPWRPWYIDGQVGGWTQQYVGLNFVTVRGAGHEVPLHR  448

Query  207  PKLALTLVESFLAGTSMP  154
            PK AL L ++F++G S+P
Sbjct  449  PKQALALFKAFVSGNSLP  466



>gb|ACG38162.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG38177.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=463

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            ECNKV D A  E G+ID YSI+T TC ++     R+++ R      L R YDPCTE++ST
Sbjct  259  ECNKVFDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYST  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y+NLPEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSG
Sbjct  316  KYYNLPEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D D+V+P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGHEV LH
Sbjct  376  DADSVVPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+  L L E FL G  MP
Sbjct  436  RPRQGLKLFEHFLRGEPMP  454



>ref|XP_008654560.1| PREDICTED: uncharacterized protein LOC100273202 isoform X1 [Zea 
mays]
 gb|ACF86547.1| unknown [Zea mays]
 gb|AFW80078.1| serine carboxypeptidase K10B2.2 [Zea mays]
Length=463

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            ECNKV D A  E G+ID YSI+T TC ++     R+++ R      L R YDPCTE++ST
Sbjct  259  ECNKVFDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYST  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y+NLPEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSG
Sbjct  316  KYYNLPEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D D+V+P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGHEV LH
Sbjct  376  DADSVVPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+  L L E FL G  MP
Sbjct  436  RPRQGLKLFEHFLRGEPMP  454



>gb|ACF79757.1| unknown [Zea mays]
Length=463

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            ECNKV D A  E G+ID YSI+T TC ++     R+++ R      L R YDPCTE++ST
Sbjct  259  ECNKVFDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYST  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y+NLPEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSG
Sbjct  316  KYYNLPEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D D+V+P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGHEV LH
Sbjct  376  DADSVVPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+  L L E FL G  MP
Sbjct  436  RPRQGLKLFEHFLRGEPMP  454



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 149/197 (76%), Gaps = 0/197 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C KVL  A  E+G+ID YS+FT  C  + S  S +L ++   V  L R+YDPCT++HS +
Sbjct  303  CKKVLKIADKEIGNIDRYSVFTPACVTNSSQSSMLLNKKGPFVSDLSRVYDPCTKKHSKV  362

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLP+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD
Sbjct  363  YFNLPKVQKALHVPPQVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGD  422

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DA++PVTSTRYSI+AL L T+SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALHR
Sbjct  423  ADAIVPVTSTRYSINALNLSTLSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHR  482

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  483  PKEALALFKAFISGTPL  499



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 147/197 (75%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K LD    E+GDID YS+FT  C  + S    +LK+R R  G +   YDPCT +HS +
Sbjct  263  CLKALDIMDMEIGDIDQYSVFTPACVANASQAKMLLKKR-RVGGRVSEQYDPCTMKHSKV  321

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W  CSD+V   WKD P++VL++Y ELI AGLRIWVFSGD
Sbjct  322  YFNLPEVQEALHVPPGLAPSKWDVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGD  381

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LHR
Sbjct  382  ADAVVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHR  441

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GTS+
Sbjct  442  PKEALALFQAFISGTSL  458



>ref|XP_010525795.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=277

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 147/204 (72%), Gaps = 1/204 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C KVLDTA  E+G+ID YS+FT TC  + S    +LK+R    G +   YDPCTE+HS +
Sbjct  58   CQKVLDTADKEMGNIDQYSVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRV  116

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV    +  +W  CSD V + W D P +VL++Y ELI AGLRIWVFSGD
Sbjct  117  YFNLPEVQKALHVPPEFAPSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGD  176

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVT+TRYSI+AL L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LHR
Sbjct  177  ADAVVPVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHR  236

Query  207  PKLALTLVESFLAGTSMPGLQRIS  136
            PK +L L ++F++G  +P  ++ S
Sbjct  237  PKQSLELFKAFVSGNPLPTSEKNS  260



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 146/197 (74%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K LD    E+GDID YS+FT  C  + S    +LK+R R  G +   YDPCT +HS +
Sbjct  263  CLKALDIMDMEIGDIDQYSVFTPACVANASQAKMLLKKR-RVGGRVSEQYDPCTMKHSKV  321

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W  CSD+V   WKD P++VL++Y ELI AGLRIWVFSGD
Sbjct  322  YFNLPEVQEALHVPPGLAPSKWDVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGD  381

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LHR
Sbjct  382  ADAVVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHR  441

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F+ GTS+
Sbjct  442  PKEALALFQAFITGTSL  458



>dbj|BAH20278.1| AT4G30810 [Arabidopsis thaliana]
Length=373

 Score =   251 bits (642),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +CNK+L+ A  E+G+ID YS+FT  C  + S  + +LK+R      +   YDPCTE+H+T
Sbjct  159  QCNKILEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTT  217

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHV    +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSG
Sbjct  218  VYFNLPEVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSG  277

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH
Sbjct  278  DADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLH  337

Query  210  RPKLALTLVESFLAGTSM  157
            RPK AL L ++F++GT +
Sbjct  338  RPKQALALFKAFISGTPL  355



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRK-VGLLRRIYDPCTERHST  571
            C KVL  A  E+G+ID YS+FT  C  + S  S +L  + R  V  L R+YDPCT++HS 
Sbjct  266  CKKVLKIADKEMGNIDRYSVFTPACVVTNSSQSSMLLNKKRPFVSDLSRVYDPCTKKHSK  325

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLP+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSG
Sbjct  326  VYFNLPKVQKALHVPPKVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSG  385

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D DA++PVTSTRYSI+AL L T SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALH
Sbjct  386  DADAIVPVTSTRYSINALNLSTTSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALH  445

Query  210  RPKLALTLVESFLAGTSM  157
            RPK AL L ++F++GT +
Sbjct  446  RPKEALALFKAFISGTPL  463



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K LD A  E GDID YSIFT  C  + S+   +          + R YDPCTER+ST+
Sbjct  264  CIKALDAADKEDGDIDPYSIFTRPCNNTASLRHNLRGHYP----WMTRAYDPCTERYSTM  319

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQK+LH + T  S+ W TCSD V D+W D P ++L +YQELI AGLRIWVFSGD
Sbjct  320  YFNQPEVQKSLHANVTGISYPWKTCSDIVGDYWADSPLSMLPIYQELIAAGLRIWVFSGD  379

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLTFV V GAGHEV LHR
Sbjct  380  TDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHR  439

Query  207  PKLALTLVESFLAGTSMP  154
            P+ A  L +SFL    MP
Sbjct  440  PREAFILFKSFLENKPMP  457



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+L+TA  E+G+ID YS+FT  C  + S  + +LK+R R    +   YDPCTE+HS +
Sbjct  265  CDKILETADKEIGNIDQYSVFTPACIANASQSNMLLKKRPR-TSRVSEQYDPCTEKHSKV  323

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TCSD V + WKD  ++VL++Y ELI AGLRIWVFSGD
Sbjct  324  YFNLPEVQEALHVPPGLAPSKWDTCSDVVNEHWKDSSSSVLNIYHELIAAGLRIWVFSGD  383

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  384  ADAVVPVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHR  443

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  444  PKEALALFKAFISGTQL  460



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CN  L+ A  E G+ID YSI+T  C  + S M R L  R      + R YDPCTER+ST 
Sbjct  259  CNTALEAADSEFGNIDPYSIYTRPCKSTAS-MKRSLNGR---YPWMSRAYDPCTERYSTE  314

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN P+VQ ALH ++T  S+ W TCSD V ++W + P T+L +YQELI AGLRIWV+SGD
Sbjct  315  YFNRPDVQLALHANSTKISYPWSTCSDIVGNYWSESPLTMLPIYQELIAAGLRIWVYSGD  374

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+P+T+TRYSIDALKLPTV+ W PWYDNG+VGGW+Q YEGLTFV ++GAGHEV LHR
Sbjct  375  TDAVVPITATRYSIDALKLPTVTNWYPWYDNGRVGGWSQVYEGLTFVTIKGAGHEVPLHR  434

Query  207  PKLALTLVESFLAGTSMP  154
            P+ A  L   FL   SMP
Sbjct  435  PRQAFILFNHFLKNKSMP  452



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   252 bits (643),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +CNK+L+ A  E+G+ID YS+FT  C  + S  + +LK+R      +   YDPCTE+H+T
Sbjct  265  QCNKILEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTT  323

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHV    +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSG
Sbjct  324  VYFNLPEVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSG  383

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH
Sbjct  384  DADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLH  443

Query  210  RPKLALTLVESFLAGTSM  157
            RPK AL L ++F++GT +
Sbjct  444  RPKQALALFKAFISGTPL  461



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   256 bits (655),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C K LD    E+G+ID YS+FT TC  + S    +LK+R    G +   YDPCT +HS +
Sbjct  263  CLKALDIMDMEIGEIDQYSVFTPTCVANASQAKMLLKKRAVG-GRVSEQYDPCTMKHSKV  321

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W  CSD V + WKD P++VL++Y ELI AGLRIWVFSGD
Sbjct  322  YFNLPEVQEALHVPPGLAPSKWDVCSDVVSENWKDSPSSVLNIYHELIAAGLRIWVFSGD  381

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LHR
Sbjct  382  ADAVVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHR  441

Query  207  PKLALTLVESFLAGTSMP  154
            PK AL L ++F++GTS+P
Sbjct  442  PKEALALFQAFISGTSLP  459



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 147/197 (75%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ + A  E+G+ID YS+FT  C  + S    +LK+R R    +   YDPCTE+HS +
Sbjct  264  CDKIQEIADKEIGNIDQYSVFTPACIANASQSKMLLKKRPR-TSRVSEQYDPCTEKHSKV  322

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TCSD V + WKDC ++VL++Y ELI AGLRIWVFSGD
Sbjct  323  YFNLPEVQEALHVPPGLAPSKWDTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGD  382

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  383  ADAVVPVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHR  442

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  443  PKEALALFKAFISGTPL  459



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C K LD A  E+G+ID YSI+T  C  + S     L+RR R     + R YDPCTER+S
Sbjct  266  DCVKSLDLADKEMGNIDPYSIYTRPCNSASS-----LRRRLRGHYPWMSRAYDPCTERYS  320

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             IYFNLPEVQ ALH + T  S+ W +CSD V ++W D P +VL +YQELI AG RIWVFS
Sbjct  321  EIYFNLPEVQNALHANVTRISYPWQSCSDIVGNYWADTPLSVLPIYQELIAAGHRIWVFS  380

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+Q Y+GLT V V GAGHEV L
Sbjct  381  GDTDAVVPVTATRYSIDALKLPTITKWYPWYDNGKVGGWSQVYKGLTLVTVTGAGHEVPL  440

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L  SFL    MP
Sbjct  441  HRPRQAFILFRSFLENKPMP  460



>ref|XP_002457307.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
 gb|EES02427.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
Length=463

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 145/199 (73%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            ECNK+   A  E G+ID YSI+T TC ++     R+++ R      L R YDPCTE++ST
Sbjct  259  ECNKMFGIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYST  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y+NLPEVQKALH + T   + WVTCSD VYDFWKD P ++L +Y+ELI AGLRIWVFSG
Sbjct  316  KYYNLPEVQKALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGLRIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +VGGW Q Y+GLT V +RGAGHEV LH
Sbjct  376  DADSVVPLTATRYSIDALFLPTVTNWYPWYDDEEVGGWCQVYKGLTLVTIRGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+  L L E FL    MP
Sbjct  436  RPRQGLKLFEHFLRDEPMP  454



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNKVL+TA  E+G+ID YS+FT  C  + S  S++L  + R    +   YDPCTE+HS +
Sbjct  267  CNKVLETADKEIGNIDQYSVFTPACVANAS-QSKMLLNKRRMTSRVSEQYDPCTEKHSKV  325

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEV++ALHV    +S +W TCS+ V + W D P++VL++Y ELI AGLRIWVFSGD
Sbjct  326  YFNLPEVKEALHVPPGLASSKWDTCSNVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGD  385

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVT+TRYSIDAL L  +S + PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  386  ADAVVPVTATRYSIDALNLRPLSTYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHR  445

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  446  PKEALALFKAFISGTPL  462



>ref|XP_004968265.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=523

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            ECNK+ D A  E G ID YSI+T TC ++     R ++ R      L R YDPCTE++S 
Sbjct  319  ECNKINDIAEAEHGSIDAYSIYTPTCKKTSLHKRRQIRGR---TPWLPRGYDPCTEKYSE  375

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y+NLPEVQKALH + T   + WV CSD +YD+WKD P ++L +Y+ELI AG+RIWVFSG
Sbjct  376  KYYNLPEVQKALHANVTGIPYAWVACSDPIYDYWKDSPKSMLPIYRELIAAGIRIWVFSG  435

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D D+V+P+T+TRYSIDAL LPTV+ W PWYDNG+VGGW Q Y+GLT V VRGAGHEVALH
Sbjct  436  DADSVVPLTATRYSIDALSLPTVTNWYPWYDNGEVGGWCQVYKGLTLVTVRGAGHEVALH  495

Query  210  RPKLALTLVESFLAGTSM  157
            RP+  L L E FL    M
Sbjct  496  RPRQGLKLFEHFLRDEPM  513



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 146/197 (74%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ + A  E+G+ID YS+FT  C  + S    +LK+R      +   YDPCTE+HS +
Sbjct  263  CNKIQEIADKEIGNIDQYSVFTPACLANASQTKMLLKKRPM-TSRVSEQYDPCTEKHSKV  321

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEV+ ALHV +  +S +W TCSD V + WKDC ++VL++Y ELI AGLRIWVFSGD
Sbjct  322  YFNLPEVKTALHVPSRLASAKWDTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGD  381

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  382  ADAVVPVTSTRYSIDALNLRPLSTYGPWYMDGQVGGWTQQYAGLNFVTVRGAGHEVPLHR  441

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  442  PKEALALFKAFISGTQL  458



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 146/197 (74%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+L+ A  E+G+ID YS+FT  C  + S  + +LK+R      +   YDPCTE+H+T+
Sbjct  266  CNKILEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTV  324

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALHV    +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSGD
Sbjct  325  YFNLPEVQKALHVPAGLAPSKWDTCSDVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGD  384

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHR
Sbjct  385  ADAVVPVTSTRYSIDALNLRPLSVYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHR  444

Query  207  PKLALTLVESFLAGTSM  157
            PK A  L ++F++GT +
Sbjct  445  PKQAFALFKAFISGTPL  461



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 142/199 (71%), Gaps = 6/199 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHST  571
            C K  D A  E G ID YSIFT  C+ + S     L+R  R     + R YDPCTER+S 
Sbjct  264  CIKAFDVADKEQGSIDPYSIFTRPCSSAIS-----LRRNLRGHYPWMPRAYDPCTERYSI  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IYFN PEVQKALH + T  S+ W TCSD V D+W D P ++L +Y+ELI AGLRIWVFSG
Sbjct  319  IYFNRPEVQKALHANLTAISYPWKTCSDIVGDYWADSPLSMLPIYEELIAAGLRIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLTFV VRGAGHEV LH
Sbjct  379  DTDAVVPLTATRYSIDALKLPTVMNWYPWYDHGKVGGWSQVYKGLTFVTVRGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+  L L + FL    MP
Sbjct  439  RPRQVLILFKYFLENKPMP  457



>dbj|BAK06862.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ AS E G+ID YS++T  C  S S+   +  R       L R YDPCTER+S 
Sbjct  32   ECVKNLNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSRAYDPCTERYSN  87

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI AG+RIWVFSG
Sbjct  88   IYYNLPEVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSG  147

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  148  DTDAVVPITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  207

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL  T MP
Sbjct  208  RPRQALILFRHFLKDTPMP  226



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 147/197 (75%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ +TA  E+G+ID YS+FT  C  + S  + +LK+R R    +   YDPCTE+HS +
Sbjct  264  CDKIQETADKEIGNIDQYSVFTPACIANASQSNMLLKKRPR-TSRVSEQYDPCTEKHSKV  322

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TCSD V + WKD  ++VL++Y ELI AGLRIWVFSGD
Sbjct  323  YFNLPEVQEALHVPPGLAPSKWDTCSDVVNENWKDSSSSVLNIYHELIAAGLRIWVFSGD  382

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  383  ADAVVPVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHR  442

Query  207  PKLALTLVESFLAGTSM  157
            PK  L L ++F++GT +
Sbjct  443  PKEGLALFKAFISGTPL  459



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 144/197 (73%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CN  L+ +  E+G+ID YS+FT  C  S S    +LKRR     +  + YDPCTE+HS +
Sbjct  267  CNNALEISYKEMGNIDHYSVFTPACVASASQSRMLLKRRPVNSRVSEQ-YDPCTEKHSKV  325

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD
Sbjct  326  YFNLPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGD  385

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDAL L T SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  386  ADAVVPVTSTRYSIDALNLSTTSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHR  445

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  446  PKEALALFKAFISGTPL  462



>ref|XP_010541227.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=346

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 144/204 (71%), Gaps = 1/204 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C KVLDTA  E+G+ID Y +FT TC  + S    +LK+R    G +   YDPCTE+HS +
Sbjct  127  CQKVLDTADKEMGNIDQYIVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRV  185

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQKALHV    +  +W  CSD V + W D P +VL++Y ELI  GLRIWVFSGD
Sbjct  186  YFNPPEVQKALHVPPEFAPSKWDICSDTVSEHWNDSPPSVLNIYHELIAVGLRIWVFSGD  245

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVT+TRYSI+AL L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LHR
Sbjct  246  ADAVVPVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHR  305

Query  207  PKLALTLVESFLAGTSMPGLQRIS  136
            PK +L L ++F++G  +P  ++ S
Sbjct  306  PKQSLELFKAFVSGNPLPTSEKNS  329



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 146/198 (74%), Gaps = 1/198 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            ECNK+ + A  E+G+ID YS+FT  C  + S  + +LK+R    G +   YDPCTE+H+ 
Sbjct  265  ECNKIAEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TGRVSEQYDPCTEKHTK  323

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHV    +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSG
Sbjct  324  VYFNLPEVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSG  383

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH
Sbjct  384  DADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLKFVTVRGAGHEVPLH  443

Query  210  RPKLALTLVESFLAGTSM  157
            RPK AL L ++F++GT +
Sbjct  444  RPKQALALFKAFISGTPL  461



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 146/200 (73%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC + L  A  E G+ID YSI+T  C  + S     LKR  R     + R YDPCTER+S
Sbjct  260  ECMRALKIAETEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYS  314

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWVFS
Sbjct  315  EVYFNRPDVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSILPIYRELIAAGLRIWVFS  374

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TRYSIDALKLPT++ W PW +NG+VGGW+Q Y+GLTFV V GAGHEV L
Sbjct  375  GDTDSVVPVTATRYSIDALKLPTITNWYPWNNNGKVGGWSQVYKGLTFVTVTGAGHEVPL  434

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+LA+ L  SFLA  +MP
Sbjct  435  HRPRLAVILFRSFLASKAMP  454



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 144/197 (73%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CN  L+ +  E+G+ID YS+FT  C  S S    +LKRR     +  + YDPCTE+HS +
Sbjct  267  CNNALEISYKEMGNIDHYSVFTPACVASASQSRMLLKRRPVNSRVSEQ-YDPCTEKHSKV  325

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD
Sbjct  326  YFNLPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGD  385

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDAL L + SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  386  ADAVVPVTSTRYSIDALNLSSTSPYGPWYTDGQVGGWTQQYAGLNFVTVRGAGHEVPLHR  445

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  446  PKEALALFKAFISGTPL  462



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 144/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A+ E G+ID YS++T  C  + S + R LK R      + R YDPCTER+S 
Sbjct  263  QCMQALRVATVEQGNIDPYSVYTQPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSD  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W  CSD V ++W D P ++L +YQELI+AGLRIWV+SG
Sbjct  319  LYFNRPEVQKALHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYQELISAGLRIWVYSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LH
Sbjct  379  DTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL   SMP
Sbjct  439  RPRQAFILFRSFLENKSMP  457



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 141/200 (71%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L  A  E G+ID YSIFT  C  + ++   +          + R YDPCTER+S 
Sbjct  262  ECIKALMLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSK  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCSD V D+W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  318  VYFNHPEVQKALHANVTGIPYPWKTCSDIVGDYWADSPLSMLPIYKELIAAGLRIWVYSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GL+FV V GAGHEV LH
Sbjct  378  DTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMPG  151
            RP+ A  L  SFL   SMPG
Sbjct  438  RPRQAFILFRSFLKNKSMPG  457



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC + L  A  E G+ID YSI+T  C  + S     LKR  R     + R YDPCTER+S
Sbjct  260  ECMRALKIAETEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYS  314

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWVFS
Sbjct  315  EVYFNRPDVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSMLPIYKELIAAGLRIWVFS  374

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGGW+Q Y+GLTFV V GAGHEV L
Sbjct  375  GDTDSVVPVTATRYSIDALKLPTITNWYPWNDNGKVGGWSQVYKGLTFVTVTGAGHEVPL  434

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+LA  L  SFL   +MP
Sbjct  435  HRPRLAFILFRSFLGSKAMP  454



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 144/200 (72%), Gaps = 8/200 (4%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC K LD A+ E G+ID YSI++  C  S       LK + R     + R YDPCTERHS
Sbjct  265  ECIKALDLANLEQGNIDPYSIYSPPCNAS-----ATLKNKPRGHYPWMSRAYDPCTERHS  319

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFNLPEVQKALH + T   + W TCSD V + W+D P ++L +YQELI AG RIWVFS
Sbjct  320  KVYFNLPEVQKALHANVTGIPYPWATCSDVVGNNWQDSPKSMLPIYQELIAAGFRIWVFS  379

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TRYS+DALKLPT++ W PWYDNG+VGGW+Q Y GLTFV + GAGHEV L
Sbjct  380  GDTDSVVPVTATRYSLDALKLPTLTNWYPWYDNGKVGGWSQVYRGLTFVTITGAGHEVPL  439

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L +SFL   +MP
Sbjct  440  HRPRQAFILFKSFL--QNMP  457



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC   L+ A  E G+ID YSIFT  C ++ S     L+R  R     + R +DPCTER+S
Sbjct  261  ECTTALEVAEAEQGNIDPYSIFTQPCADTTS-----LRRNLRGHYPWMSRAFDPCTERYS  315

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
              YFN PEVQKALH + T   ++W TCSD V   W D P ++L +YQELI AG+RIWV+S
Sbjct  316  KEYFNRPEVQKALHANVTGIPYQWETCSDVVGYNWTDSPLSMLPIYQELIAAGIRIWVYS  375

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+QEY+GLTFV V GAGHEV L
Sbjct  376  GDTDAVVPVTATRYSIDALKLPTINKWHPWYDNGKVGGWSQEYKGLTFVTVTGAGHEVPL  435

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L  SFL   SMP
Sbjct  436  HRPRQAFILFRSFLENKSMP  455



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 143/197 (73%), Gaps = 1/197 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CN  L+ +  E+G+ID YS+FT  C  S S  SR+L  R      +   YDPCTE+HS +
Sbjct  267  CNNALEISYKEMGNIDHYSVFTPACVASAS-QSRMLLNRRPVNSRVSEQYDPCTEQHSKV  325

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD
Sbjct  326  YFNLPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGD  385

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDAL L T SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHR
Sbjct  386  ADAVVPVTSTRYSIDALNLSTTSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHR  445

Query  207  PKLALTLVESFLAGTSM  157
            PK AL L ++F++GT +
Sbjct  446  PKEALALFKAFISGTPL  462



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC+K ++ A  E G ID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S
Sbjct  254  ECSKAMEAADKEQGGIDPYSIYTITCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYS  310

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
            + YFN PEVQKA+H +TT  +++W TCSD V + W D P ++L +Y+ELI AG+RIWVFS
Sbjct  311  STYFNSPEVQKAMHANTTGLAYQWKTCSDIVGEKWSDSPLSMLPIYKELIAAGIRIWVFS  370

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT TRYSI ALKLP VS W PWYDNGQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  371  GDTDSVVPVTGTRYSIRALKLPPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPL  430

Query  213  HRPKLALTLVESFLAGTSM  157
            HRP+    L +SFLA   M
Sbjct  431  HRPRRGFLLFKSFLANKPM  449



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 142/200 (71%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L  A  E G+ID YSIFT  C  + ++   +          + R YDPCT+R+S 
Sbjct  262  ECIKALMLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTDRYSK  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   ++W TCSD V D+W D P ++L +Y+EL+ AGLRIWV+SG
Sbjct  318  VYFNHPEVQKALHANVTGIPYQWKTCSDIVGDYWADSPLSMLPIYKELMAAGLRIWVYSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GL+FV V GAGHEV LH
Sbjct  378  DTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMPG  151
            RP+ A  L  SFL   SMPG
Sbjct  438  RPRQAFILFRSFLENKSMPG  457



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K L  A  E G+ID YSIFT  C  + S+   +          + R YDPCTER+S 
Sbjct  261  DCIKALYLAQLEQGNIDPYSIFTRPCNNTASLRHNLRGHYP----WMSRAYDPCTERYSK  316

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWV+SG
Sbjct  317  LYFNRPEVQKALHANATGISYPWKTCSDIVGNYWADAPLSMLPIYKELIAAGLKIWVYSG  376

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+Q Y+GLTFV V GAGHEV LH
Sbjct  377  DTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWSQVYKGLTFVTVTGAGHEVPLH  436

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L +SFL    MP
Sbjct  437  RPRQAFILFKSFLENKPMP  455



>gb|AIN39846.1| hypothetical protein [Zoysia matrella]
Length=172

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = -2

Query  636  RRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCP  457
            +R   VG +   YDPCTE+HS +YFNLPEVQKALHV    S  +W TCS+ V   W DC 
Sbjct  2    KRLHSVGKMGEQYDPCTEKHSIVYFNLPEVQKALHVSPVISKSKWETCSEVVNTHWGDCE  61

Query  456  TTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGG  280
             +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYS+DALKLPTV+PW  WYD +G+VGG
Sbjct  62   RSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSVDALKLPTVTPWHAWYDEDGEVGG  121

Query  279  WTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  154
            WT+ YEGLTFV VRGAGHEV LHRPK ALTL++SFLAG+ MP
Sbjct  122  WTEGYEGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMP  163



>ref|XP_002457308.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
 gb|EES02428.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
Length=467

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 146/199 (73%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+ + A DE GDID YS++T TC ++  +  R ++ R   +  L R YDPCTE + T
Sbjct  263  ECQKIYEVAYDEQGDIDFYSLYTPTCKKTSLLKRRQIRGR---MPWLPRGYDPCTELYFT  319

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y+NLPEVQ+A H + T   + W+ CSD VY++W+D P ++L +Y+ELI+AGLRIWVFSG
Sbjct  320  KYYNLPEVQEAFHANVTGIPYAWIGCSDPVYEYWQDSPRSMLPIYRELISAGLRIWVFSG  379

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHEV LH
Sbjct  380  DTDSVVPLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLH  439

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+  L L+E FL G  MP
Sbjct  440  RPRQGLKLLEHFLQGEPMP  458



>ref|XP_004968264.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=463

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+L+ AS E G IDTYSI+T TC ++     R+++ R      L R YDPCT ++ST
Sbjct  259  ECEKILEVASAEQGKIDTYSIYTPTCKKTSLHRHRLIRGR---TPWLPRGYDPCTTQYST  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y+NLPEVQKALH + T   + WV CSD +Y +WKD P ++L +Y+ELI AG RIWVFSG
Sbjct  316  KYYNLPEVQKALHANVTGIPYAWVACSDPIYKYWKDSPRSMLPIYRELIAAGKRIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D DAV+P+  TRYSIDAL LPT+S W  WYD G+VGGW Q Y+GLT V +RGAGHEV LH
Sbjct  376  DADAVVPLPGTRYSIDALFLPTISNWYAWYDQGEVGGWCQVYKGLTLVTIRGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+L L L E FL    MP
Sbjct  436  RPRLGLKLFEHFLRDEPMP  454



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC K L+ A  E G+ID YSIFT  C ++ S     L+R+ R     + R YDPCTER+S
Sbjct  257  ECTKALNLAEAEQGNIDPYSIFTRPCNDTSS-----LRRKLRGHYPWMSRAYDPCTERYS  311

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFNLPEVQ ALH + T  S+ W TCS+ V  +W D P ++L +YQELI AGLRIWVFS
Sbjct  312  EVYFNLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFS  371

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+PVT+TRYSIDALKLPT++ W  WYDN +VGGW+Q Y+GLTFV V GAGHEV L
Sbjct  372  GDTDAVVPVTATRYSIDALKLPTITNWYXWYDNHKVGGWSQVYKGLTFVTVTGAGHEVPL  431

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L  SFL    MP
Sbjct  432  HRPRQAYILFRSFLENKPMP  451



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC   L+ A  E G+ID YSIFT  C ++ S     L+R  R     + R +DPCTER+S
Sbjct  261  ECTTALEVAEAEQGNIDPYSIFTQPCADTTS-----LRRNLRGHYPWMSRAFDPCTERYS  315

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
              YFN PEVQKALH + T   ++W TCSD +   W D P ++L +YQELI AG+RIWV+S
Sbjct  316  KEYFNRPEVQKALHANVTGIPYQWETCSDVIGYNWTDSPLSMLPIYQELIAAGIRIWVYS  375

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+PVT+TRYSIDALKLPT++ W PWY+NG+VGGW+QEY+GLTFV V GAGHEV L
Sbjct  376  GDTDAVVPVTATRYSIDALKLPTINKWHPWYENGKVGGWSQEYKGLTFVTVTGAGHEVPL  435

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L  SFL   SMP
Sbjct  436  HRPRQAFILFRSFLENKSMP  455



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 140/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L  A  E G+ID YSIFT  C  + ++   +          + R YDPCTER+S 
Sbjct  262  ECMKALKLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSK  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCS+ V D+W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  318  VYFNRPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y GLTFV V GAGHEV LH
Sbjct  378  DTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMPG  151
            RP+ A  L  SFL   SMPG
Sbjct  438  RPRQAFILFMSFLGNKSMPG  457



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K +D A  E G+ID YSIFT TC+ + S    + K R R    +   YDPCTE+HST+
Sbjct  262  CDKTMDIAYVEQGNIDAYSIFTPTCSATISQRRNLRKIRPR----ISVPYDPCTEKHSTV  317

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQKALH + T   + W TC+D + D WKD P ++L +Y+ELI AG+RIWVFSGD
Sbjct  318  YFNLPEVQKALHANVTGIPYPWATCNDIIGDNWKDSPRSMLPIYRELIAAGIRIWVFSGD  377

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TD+V+PVT+TRYS+D L+LPT+  W PWYDNGQ+GGW++ Y+GL+ + VRGAGHEV LH 
Sbjct  378  TDSVVPVTATRYSLDTLELPTLVKWHPWYDNGQMGGWSEVYDGLSLIVVRGAGHEVPLHA  437

Query  207  PKLALTLVESFLAGTSMP  154
            P+ A  + +SFL    MP
Sbjct  438  PRKAYIMFKSFLENKPMP  455



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C K L  A  E G+ID YSI+T  C  + S     L+R  R     + R YDPCTER+S
Sbjct  261  DCTKALLLAEQEQGNIDPYSIYTRPCASTSS-----LRRNLRGHYPWMSRAYDPCTERYS  315

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             IYFNLPEVQKA H + T  ++ W TCSD V ++W D P ++L +YQELI AGLRIWVFS
Sbjct  316  EIYFNLPEVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVFS  375

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V V GAGHEV L
Sbjct  376  GDTDSVVPVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLTLVTVTGAGHEVPL  435

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L+ SFL    MP
Sbjct  436  HRPRQAFILLRSFLENKPMP  455



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C K L  A  E G+ID YSI+T  C  + S     L+R  R     + R YDPCTER+S
Sbjct  261  DCTKALLLAEQEQGNIDPYSIYTRPCASTSS-----LRRNLRGHYPWMSRAYDPCTERYS  315

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFNLPEVQKA H + T  ++ W TCSD V ++W D P ++L +YQELI+AGLRIWVFS
Sbjct  316  EVYFNLPEVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQELISAGLRIWVFS  375

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V V GAGHEV L
Sbjct  376  GDTDSVVPVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLTLVTVTGAGHEVPL  435

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L+ SFL    MP
Sbjct  436  HRPRQAFILLRSFLENKPMP  455



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 146/203 (72%), Gaps = 1/203 (0%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ + A  E+G+ID YS+FT  C  + S  + +LK+R      +R  YDPCTE+H+ +
Sbjct  266  CNKIEEIAEKEIGNIDQYSVFTPACLSNASQSNMLLKKRTM-TSRVREQYDPCTEKHTKV  324

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFNLPEVQ+ALHV    +  +W TCSD V + W D  ++VL++Y ELI AGLRIWVFSGD
Sbjct  325  YFNLPEVQRALHVPPGLAPSKWDTCSDVVNEHWNDSSSSVLNIYHELIAAGLRIWVFSGD  384

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHR
Sbjct  385  ADAVVPVTSTRYSIDALNLRPLSAYGPWYSDGQVGGWSQQYAGLNFVTVRGAGHEVPLHR  444

Query  207  PKLALTLVESFLAGTSMPGLQRI  139
            PK AL L ++F++G  +   + I
Sbjct  445  PKQALELFKAFISGAPLSTHENI  467



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC K L+ A  E G+ID YSIFT  C ++ S     L+R  R     + R YDPCTER+S
Sbjct  261  ECTKALNLAEAEQGNIDPYSIFTRPCNDTSS-----LRRNLRGHYPWMSRAYDPCTERYS  315

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFNLPEVQ ALH + T  S+ W TCS+ V  +W D P ++L +YQELI AGLRIWVFS
Sbjct  316  EVYFNLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFS  375

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+PVT+TRYSIDALKLPT++ W  WYDN +VGGW+Q Y+GLTFV V GAGHEV L
Sbjct  376  GDTDAVVPVTATRYSIDALKLPTITNWYAWYDNHKVGGWSQVYKGLTFVTVTGAGHEVPL  435

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L  SFL    MP
Sbjct  436  HRPRQAYILFRSFLENKPMP  455



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C K L  A  E G+ID YSI+T  C  S S     L+RR R     + R YDPCTERHS
Sbjct  265  DCVKSLLQAEKEQGNIDPYSIYTPPCNASSS-----LRRRFRVHFPWMPRAYDPCTERHS  319

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
            T+YFNLPEVQ+A H +TT   + W TCSD V  +W D P +VL +YQ L+ AGL+IWVFS
Sbjct  320  TVYFNLPEVQEAFHANTTGIPYPWKTCSDTVGIYWTDAPLSVLPIYQGLMAAGLKIWVFS  379

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GL FV V GAGHEV L
Sbjct  380  GDTDSVVPITATRYSIDALKLPTITNWYPWYDNKRVGGWSQVYKGLIFVTVTGAGHEVPL  439

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+LA  L  SFL    MP
Sbjct  440  HRPRLAYILFRSFLENEPMP  459



>ref|XP_003564543.1| PREDICTED: serine carboxypeptidase-like 27 [Brachypodium distachyon]
Length=451

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ AS E G+ID YS++T  C  S S+   +  R       L R YDPCTER++ 
Sbjct  255  ECVKNLNLASSEEGNIDPYSLYTKPCNNSASLKLGLGGRYP----WLSRAYDPCTERYAN  310

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +Y+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSG
Sbjct  311  VYYNLPEVQMALHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSG  370

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  371  DTDAVVPVTATRYSIKALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLH  430

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL  T MP
Sbjct  431  RPRQALILFRHFLKDTPMP  449



>ref|XP_008805039.1| PREDICTED: serine carboxypeptidase-like 27 [Phoenix dactylifera]
Length=461

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ AS E G+ID YSI+T  C +S S + R L+ R      + R YDPCT+R++ 
Sbjct  266  ECVKNLNVASTEQGNIDPYSIYTSPCNDS-SALKRNLRGR---YPWMSRAYDPCTDRYAK  321

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +Y+N PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI AG+RIWVFSG
Sbjct  322  VYYNRPEVQRALHANVTGIHYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSG  381

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLTFV + GAGHEV LH
Sbjct  382  DTDAVVPVTATRYSIDALKLPTLLRWYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLH  441

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL    MP
Sbjct  442  RPRQALILFRHFLQNKPMP  460



>ref|XP_006645520.1| PREDICTED: serine carboxypeptidase II-1-like [Oryza brachyantha]
Length=412

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C+K+ + A  E G+ID YSI+T TC ++  +  R++K     +  L R YDPCTE++ST 
Sbjct  209  CDKIYEVAEAEQGNIDAYSIYTPTCKKTSFLKRRLIKG---NMPWLPRGYDPCTEKYSTK  265

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD
Sbjct  266  YYNLPEVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGD  325

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  326  ADSVVPLTATRYSIDALHLPTVTNWYPWYDDDEVAGWCQVYQGLTLVTIRGAGHEVPLHR  385

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  386  PRQALKLFEHFLQDNPMP  403



>ref|NP_001044713.1| Os01g0833500 [Oryza sativa Japonica Group]
 dbj|BAD73778.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
 dbj|BAF06627.1| Os01g0833500 [Oryza sativa Japonica Group]
 gb|EAZ14049.1| hypothetical protein OsJ_03974 [Oryza sativa Japonica Group]
 dbj|BAG93392.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ AS E G+ID YS++T  C  + S+   +  R       L R YDPCTER+S+
Sbjct  258  ECLKNLNLASSEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSRAYDPCTERYSS  313

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSG
Sbjct  314  IYYNRPEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSG  373

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LH
Sbjct  374  DTDAVVPVTATRYSIDALKLPTMVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLH  433

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL  T MP
Sbjct  434  RPREALILFRHFLQNTPMP  452



>ref|XP_007219592.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
 gb|EMJ20791.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
Length=397

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC + L  A  E G+ID YSIFT  C  + S+   +          + R YDPCTER+S 
Sbjct  202  ECMRALKMAEMEQGNIDPYSIFTRPCNSTESLKHNLRGHYP----WMSRAYDPCTERYSE  257

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQ+A H + T  S+ W TCSD V  +W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  258  VYFNHPEVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYRELIAAGLRIWVYSG  317

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW Q Y+GLTFV V GAGHEV LH
Sbjct  318  DTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLTFVTVTGAGHEVPLH  377

Query  210  RPKLALTLVESFLAGTSM  157
            RP+ A  + +SFL G  M
Sbjct  378  RPRQAFIVFKSFLEGKPM  395



>ref|NP_001042076.1| Os01g0158200 [Oryza sativa Japonica Group]
 dbj|BAD61439.1| putative carboxypeptidase D [Oryza sativa Japonica Group]
 dbj|BAF03990.1| Os01g0158200 [Oryza sativa Japonica Group]
 gb|EAZ10621.1| hypothetical protein OsJ_00453 [Oryza sativa Japonica Group]
 dbj|BAG92359.1| unnamed protein product [Oryza sativa Japonica Group]
Length=471

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ + A  E G+ID YSI+T TC ++ S + R L R +     L R YDPCTE++ST 
Sbjct  268  CNKIYEVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGNSP--WLPRGYDPCTEKYSTK  324

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD
Sbjct  325  YYNLPEVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGD  384

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  385  ADSVVPLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHR  444

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  445  PRQALKLFEHFLQDKPMP  462



>gb|EAY76388.1| hypothetical protein OsI_04319 [Oryza sativa Indica Group]
Length=454

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ AS E G+ID YS++T  C  + S+   +  R       L R YDPCTER+S+
Sbjct  258  ECLKNLNLASSEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSRAYDPCTERYSS  313

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSG
Sbjct  314  IYYNRPEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSG  373

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LH
Sbjct  374  DTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLH  433

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL  T MP
Sbjct  434  RPREALILFRHFLQNTPMP  452



>dbj|BAJ99174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ AS E G+ID YS++T  C  S S+   +  R       L R YDPCTER+S 
Sbjct  248  ECVKNLNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSRAYDPCTERYSN  303

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI AG+RIWVFSG
Sbjct  304  IYYNLPEVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSG  363

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  364  DTDAVVPITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  423

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL  T MP
Sbjct  424  RPRQALILFRHFLKDTPMP  442



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A+ E G+ID YS++T  C  + S + R LK R      + R YDPCTER+S 
Sbjct  263  QCMQALRVATVEQGNIDPYSVYTRPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSD  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKA H + T   + W  CSD V ++W D P ++L +Y+ELI+AGLRIWV+SG
Sbjct  319  LYFNRPEVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYRELISAGLRIWVYSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LH
Sbjct  379  DTDAVVPMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL   SMP
Sbjct  439  RPRQAFILFRSFLENKSMP  457



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A+ E G+ID YS++T  C  + S + R LK R      + R YDPCTER+S 
Sbjct  262  QCMQALRVATVEQGNIDPYSVYTRPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSD  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKA H + T   + W  CSD V ++W D P ++L +Y+ELI+AGLRIWV+SG
Sbjct  318  LYFNRPEVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYRELISAGLRIWVYSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LH
Sbjct  378  DTDAVVPMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL   SMP
Sbjct  438  RPRQAFILFRSFLENKSMP  456



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   243 bits (620),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 145/198 (73%), Gaps = 1/198 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+ + A  E+G+ID YS+FT  C  + S  + +LK+R    G +   YDPCTE+H+ 
Sbjct  284  ECTKIEEIADKEIGNIDHYSVFTPACVANASQSNMLLKKRPI-TGRVSEQYDPCTEKHTK  342

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHV    +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSG
Sbjct  343  VYFNLPEVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSG  402

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH
Sbjct  403  DADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLH  462

Query  210  RPKLALTLVESFLAGTSM  157
            RPK AL L ++F++GT +
Sbjct  463  RPKQALALFKAFISGTPL  480



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC+K ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S
Sbjct  252  ECSKAIEAADKEQGDIDPYSIYTVTCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYS  308

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  309  GMYFNSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFS  368

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT TRYSI ALKL  VS W PWYDNGQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  369  GDTDSVVPVTGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPL  428

Query  213  HRPKLALTLVESFLAGTSM  157
            HRP+    L +SFL    M
Sbjct  429  HRPRRGFLLFQSFLNNKPM  447



>dbj|BAB08188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=490

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ + A  E G+ID YSI+T TC ++ S + R L R +     L R YDPCTE++ST 
Sbjct  268  CNKIYEVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGNSP--WLPRGYDPCTEKYSTK  324

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD
Sbjct  325  YYNLPEVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGD  384

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  385  ADSVVPLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHR  444

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  445  PRQALKLFEHFLQDKPMP  462



>ref|XP_010908844.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=462

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 144/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ A  E G+ID YSI+T  C +S S + R LK R      + R YDPCT+R++ 
Sbjct  267  ECVKNLNIAGSEQGNIDPYSIYTRPCNDS-SALKRNLKGR---YPWMSRAYDPCTDRYAK  322

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +Y+N PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI AG+RIWVFSG
Sbjct  323  VYYNRPEVQRALHANVTGIRYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSG  382

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDAL+LPT+  W PWYD+G+VGGW+Q Y+GLTFV + GAGHEV LH
Sbjct  383  DTDAVVPVTATRYSIDALELPTLRRWYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLH  442

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL    MP
Sbjct  443  RPRQALILFRHFLQNKPMP  461



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC+K ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S
Sbjct  252  ECSKAIEAADKEQGDIDPYSIYTVTCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYS  308

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  309  GMYFNSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFS  368

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T TRYSI ALKL  VS W PWYDNGQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  369  GDTDSVVPITGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPL  428

Query  213  HRPKLALTLVESFLAGTSM  157
            HRP+    L +SFL    M
Sbjct  429  HRPRRGFLLFQSFLNNKPM  447



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC+K ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S
Sbjct  252  ECSKAIEAADKEQGDIDPYSIYTVTCKREAAALRSRFLRVRHP---WMWRAYDPCTERYS  308

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  309  GMYFNSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFS  368

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT TRYSI ALKL  VS W PWYDNGQVGGW+Q Y GLT V + GAGHEV L
Sbjct  369  GDTDSVVPVTGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYNGLTLVTIHGAGHEVPL  428

Query  213  HRPKLALTLVESFLAGTSM  157
            HRP+    L +SFL    M
Sbjct  429  HRPRRGFLLFQSFLNNKPM  447



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 139/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L  A  E G+ID YSIFT  C  + ++   +          + R YDPCTER+S 
Sbjct  262  ECMKALKLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSK  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCS+ V D+W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  318  VYFNRPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y GLTFV V GAGHEV L 
Sbjct  378  DTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAGHEVPLR  437

Query  210  RPKLALTLVESFLAGTSMPG  151
            RP+ A  L  SFL   SMPG
Sbjct  438  RPRQAFILFMSFLGNKSMPG  457



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K L  A  E G+ID YSI+T  C  S + + R L+        + R YDPCTER+S 
Sbjct  261  DCTKALLIAEHEQGNIDPYSIYTRPCA-STNALHRNLRGH---YPWMSRAYDPCTERYSD  316

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKA H + T  ++ W TCSD V D+W D P ++L +YQELI AGLRIWVFSG
Sbjct  317  VYFNLPEVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYQELIAAGLRIWVFSG  376

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V + GAGHEV LH
Sbjct  377  DTDSVVPLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQLYKGLTLVTITGAGHEVPLH  436

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  437  RPRQAFILFRSFLENKPMP  455



>tpg|DAA53383.1| TPA: hypothetical protein ZEAMMB73_784297 [Zea mays]
Length=340

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 142/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+ + A  E G+ID YSI+T TC ++ S+  R L R   ++  L R YDPCTE + T
Sbjct  136  ECQKIYEVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYIT  192

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y NLPEVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSG
Sbjct  193  KYCNLPEVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSG  252

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHEV LH
Sbjct  253  DTDSVVPLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLH  312

Query  210  RPKLALTLVESFLAGTSMP  154
            RP   L L E FL G  MP
Sbjct  313  RPPQGLKLFEHFLRGEPMP  331



>gb|EMS47606.1| Serine carboxypeptidase-like 27 [Triticum urartu]
Length=470

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ AS E G+ID YS++T  C  S S+   +  R       L R YDPCTER+S 
Sbjct  274  ECVKNLNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSRAYDPCTERYSN  329

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI AG++IWVFSG
Sbjct  330  IYYNLPEVQAALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIKIWVFSG  389

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  390  DTDAVVPVTATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  449

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL  T MP
Sbjct  450  RPRQALILFRHFLKDTPMP  468



>gb|EEC69980.1| hypothetical protein OsI_00486 [Oryza sativa Indica Group]
Length=474

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ + A  E G+ID YSI+T TC ++ S + R L R +  +  L R YDPCTE++S  
Sbjct  271  CNKIYEVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGN--LPWLPRGYDPCTEKYSMK  327

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD
Sbjct  328  YYNLPEVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGD  387

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  388  ADSVVPLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHR  447

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  448  PRQALKLFEHFLQDKPMP  465



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A+ E G+ID YS++T  C  + S + R LK R      + R YDPCTER+S 
Sbjct  263  QCMQALRVATVEQGNIDPYSVYTQPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSD  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             YFN PEVQKA H + T   +EW  CSD V ++W D P ++L +YQELI AG RIWV+SG
Sbjct  319  SYFNRPEVQKAFHANVTGIPYEWKACSDIVGNYWTDSPLSMLPIYQELIRAGYRIWVYSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V VRGAGHEV LH
Sbjct  379  DTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTMVTVRGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL   SMP
Sbjct  439  RPREAFILFSSFLQNKSMP  457



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 138/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC + L  A  E G+ID YSIFT  C  + S+   +          + R YDPCTER+S 
Sbjct  260  ECMRALKIAEMEQGNIDPYSIFTRPCNSTESLKHNLRGHYP----WMSRAYDPCTERYSE  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQ+A H + T  S+ W TCSD V  +W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  316  VYFNHPEVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYRELIAAGLRIWVYSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW Q Y+GLTFV V GAGHEV LH
Sbjct  376  DTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLTFVTVTGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSM  157
            RP+ A  +  SFL G  M
Sbjct  436  RPRQAFIVFRSFLEGKPM  453



>ref|XP_006644961.1| PREDICTED: serine carboxypeptidase-like 27-like [Oryza brachyantha]
Length=455

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ AS E G+ID YS++T  C  + S+   +  R       L R YDPCTER+S 
Sbjct  259  ECAKNLNIASTEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSRAYDPCTERYSN  314

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSG
Sbjct  315  IYYNRPEVQIAMHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSG  374

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  375  DTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLH  434

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L   FL    MP
Sbjct  435  RPREALILFRHFLQNIPMP  453



>gb|KJB76568.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=304

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 137/199 (69%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C   L  A  E G+ID YSIFT  C ++    S +          + R YDPCTER+S 
Sbjct  109  QCMNALRAAQIEQGNIDPYSIFTQPCKDT----STLRHNMRGHYPWMSRAYDPCTERYSK  164

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  165  VYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSG  224

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  225  DTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLH  284

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  285  RPRQAFILFRSFLENKLMP  303



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (73%), Gaps = 1/198 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            ECNK+ + A  E+G+ID YS+FT  C    S  + +LK+R    G +   YDPCTE+H+ 
Sbjct  266  ECNKIEEIADKEIGNIDQYSVFTPACVAKASQSNMLLKKRPI-TGRVSEQYDPCTEKHTK  324

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHV    +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSG
Sbjct  325  VYFNLPEVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSG  384

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D DAV+PVTSTR+SIDAL L  +S + PWY + QVGGW+Q+Y GL FV VRGAGHEV LH
Sbjct  385  DADAVVPVTSTRHSIDALNLHPLSVYGPWYLDEQVGGWSQQYAGLNFVTVRGAGHEVPLH  444

Query  210  RPKLALTLVESFLAGTSM  157
            RPK AL L ++F++GT +
Sbjct  445  RPKQALALFKAFISGTPL  462



>gb|ABK21145.1| unknown [Picea sitchensis]
Length=343

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRD-RKVGLLRRIYDPCTERHS  574
            +C + +D A  ELG+ID YSI+T +C  S S   ++      R  G     YDPCTE +S
Sbjct  140  QCQRAMDLADLELGNIDQYSIYTPSCNISGSQRHKLRSHHPWRSYG-----YDPCTESYS  194

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA H + T+ S+ W TCSD +  +W+D P ++L +YQEL+ AG+RIWVFS
Sbjct  195  ALYFNRPEVQKAFHANVTSISYSWTTCSDILEKYWQDSPRSMLPIYQELLRAGIRIWVFS  254

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+PVT+TRYSIDAL+L T+  W PWYDN +VGGWTQ Y+GLT V +RGAGHEV L
Sbjct  255  GDTDAVVPVTATRYSIDALRLRTIVNWYPWYDNQEVGGWTQIYKGLTLVTIRGAGHEVPL  314

Query  213  HRPKLALTLVESFLAGTSMP  154
            H+P+ A  L ++FL G  MP
Sbjct  315  HQPRKAFILFKAFLKGKPMP  334



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 142/199 (71%), Gaps = 6/199 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHST  571
            C KVL+ A++ELG+ID YSI+T  C E+       LKR+ R     + R YDPCTE ++ 
Sbjct  277  CLKVLEAAANELGNIDPYSIYTRACNET-----TTLKRKLRGHYPWMSRAYDPCTENYAE  331

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +Y+N PEVQ ALH + T   + W TCS+ V + W D P ++L +Y+ELI AGLRIWVFSG
Sbjct  332  VYYNRPEVQMALHANVTGIPYPWNTCSNIVGNHWADSPRSMLPIYRELIAAGLRIWVFSG  391

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+PVT+TRYSIDAL L TV  W PWYDNG+VGGWTQ YEGLTFV V GAGHEV LH
Sbjct  392  DTDSVVPVTATRYSIDALNLSTVISWYPWYDNGKVGGWTQVYEGLTFVTVXGAGHEVPLH  451

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L + FL    MP
Sbjct  452  RPRQALVLFKHFLQNRPMP  470



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSI+T  C  + S+ S +  R       + R YDPCTERHS 
Sbjct  262  QCFQALRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSD  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSG
Sbjct  318  VYFNCPEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V +RGAGHEV LH
Sbjct  378  DTDSVVPLTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMP  154
            +P+ A  L  SFL    MP
Sbjct  438  KPREAFILFRSFLENKDMP  456



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSI+T  C  + S+ S +  R       + R YDPCTERHS 
Sbjct  262  QCFQALRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSD  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSG
Sbjct  318  VYFNRPEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V +RGAGHEV LH
Sbjct  378  DTDSVVPLTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMP  154
            +P+ A  L  SFL    MP
Sbjct  438  KPREAFILFRSFLENKDMP  456



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C K L +A  E G+ID YSIFT  C  + S     L+R  R     + R YDPCTER+S
Sbjct  261  DCMKALKSAEMEQGNIDPYSIFTRPCNGTAS-----LRRNLRGHYPWMSRAYDPCTERYS  315

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKALH + T  S+ W TCS+ V D W D P ++L +Y+ELI AGL+IWVFS
Sbjct  316  EVYFNHPEVQKALHANVTWISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFS  375

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+PVT+TRYSIDALKLPTV  W PWYDN +VGGW+Q Y+GLTFV V GAGHEV L
Sbjct  376  GDTDAVVPVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLTFVTVTGAGHEVPL  435

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L  SFL    MP
Sbjct  436  HRPRQAFILFRSFLENKPMP  455



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K L  A  E G+ID YSI+T  C  S + + R L+        + R YDPCTER+S 
Sbjct  261  DCTKALLLADHEQGNIDPYSIYTRPCA-STNALHRNLRGH---YPWMSRAYDPCTERYSD  316

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKA H + T  ++ W TCSD V D+W D P ++L +Y ELI AGLRIWVFSG
Sbjct  317  VYFNLPEVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYHELIAAGLRIWVFSG  376

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V + GAGHEV LH
Sbjct  377  DTDSVVPLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQIYKGLTLVTITGAGHEVPLH  436

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  437  RPRQAFILFRSFLENKPMP  455



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC +VL  A  E G+ID YSI+T  C  + S     LKR  R     + R YDPCTER+S
Sbjct  260  ECMRVLKLAEMEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYS  314

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWVFS
Sbjct  315  EVYFNRPDVQKALHANVTKVSYPWQTCSDIVGNYWADSPLSMLPIYKELIAAGLKIWVFS  374

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGG  Q Y+GLTFV V GAGHEV L
Sbjct  375  GDTDSVVPVTATRYSIDALKLPTITNWFPWNDNGKVGGRCQIYKGLTFVTVTGAGHEVPL  434

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+LA  L  SFL    MP
Sbjct  435  HRPRLAFILFRSFLESKPMP  454



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L  A  E G+ID YSI+T  C  + S+   +          + R YDPCTER+S 
Sbjct  262  ECKKALTVAEFEQGNIDPYSIYTRPCNSTASLRHNLRGHYP----WMSRAYDPCTERYSV  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             YFN P+VQKA H + T  ++ W TCSD V ++W D P ++L +YQELI +G+RIWVFSG
Sbjct  318  AYFNHPDVQKAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQELIVSGIRIWVFSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+PVT+TRYSIDALKLPT+S W PWYD+G+VGGW+Q Y+GLTFV V GAGHEV LH
Sbjct  378  DTDSVVPVTATRYSIDALKLPTISNWYPWYDHGKVGGWSQIYKGLTFVTVAGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    +P
Sbjct  438  RPREAFILFRSFLEDKPLP  456



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 140/200 (70%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C   L +A  E G+ID YSIFT  C  + S     L+R  R     + R YDPCTER+S
Sbjct  261  DCMTALKSAEMEQGNIDPYSIFTRPCNGTAS-----LRRNLRGHYPWMSRAYDPCTERYS  315

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKALH + T  S+ W TCS+ V D W D P ++L +Y+ELI AGL+IWVFS
Sbjct  316  EVYFNHPEVQKALHANVTGISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFS  375

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+PVT+TRYSIDALKLPTV  W PWYDN +VGGW+Q Y+GLTFV V GAGHEV L
Sbjct  376  GDTDAVVPVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLTFVTVTGAGHEVPL  435

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L  SFL    MP
Sbjct  436  HRPRQAFILFRSFLENKPMP  455



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            EC KVLD A+ E G ID YSI+T  CT++ S     LKR+ R     + R YDPCTE ++
Sbjct  282  ECVKVLDAATIEQGHIDPYSIYTSPCTDATS-----LKRKIRGHYPWMSRAYDPCTENYA  336

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +Y+N PEVQKALH + T   + W TCS+ V  +W D P ++L +Y+ELI AGLRIWVFS
Sbjct  337  RVYYNHPEVQKALHANVTGIPYPWDTCSNIVGIYWADSPRSMLPIYRELIAAGLRIWVFS  396

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T+TRYSIDAL L TV  W PWYD+G+VGGWTQ YEGLTFV VRGAGHEV L
Sbjct  397  GDTDSVVPLTATRYSIDALNLSTVISWYPWYDHGKVGGWTQVYEGLTFVTVRGAGHEVPL  456

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ AL L   FL    MP
Sbjct  457  HRPRQALILFRHFLQDKLMP  476



>tpg|DAA53384.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 142/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+ + A  E G+ID YSI+T TC ++ S+  R L R   ++  L R YDPCTE + T
Sbjct  270  ECQKIYEVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYIT  326

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y NLPEVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSG
Sbjct  327  KYCNLPEVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSG  386

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHEV LH
Sbjct  387  DTDSVVPLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLH  446

Query  210  RPKLALTLVESFLAGTSMP  154
            RP   L L E FL G  MP
Sbjct  447  RPPQGLKLFEHFLRGEPMP  465



>ref|XP_003560871.1| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=482

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 143/207 (69%), Gaps = 8/207 (4%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIM---SRVLKRRDRKVG----LLRRIYDPC  589
            C      +S+E G+ID YSI+T TC  + S +   S V+ RR    G    +    YDPC
Sbjct  268  CLAAFRASSEEQGNIDAYSIYTPTCNTNASALPTPSSVVSRRQHPKGRYPWMTGGSYDPC  327

Query  588  TERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLR  409
            TER+ST Y+N PEVQKALH + T  ++ W  CSD +   W D P ++L +Y+E+I AGLR
Sbjct  328  TERYSTAYYNRPEVQKALHANVTGINYAWAACSDTINGNWSDSPRSMLSIYKEIIQAGLR  387

Query  408  IWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGLTFVAVRGA  232
            IWVFSGDTD+V+P T+TRYSIDAL LPT + W PWYD+ Q VGGW+Q YEGLT V VRGA
Sbjct  388  IWVFSGDTDSVVPSTATRYSIDALVLPTTTDWYPWYDDNQEVGGWSQVYEGLTLVTVRGA  447

Query  231  GHEVALHRPKLALTLVESFLAGTSMPG  151
            GHEVALHRP+ AL L ++FL G  MPG
Sbjct  448  GHEVALHRPRQALILFQNFLQGKPMPG  474



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 138/199 (69%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC   L  A  E G+ID YSIFT  C ++ ++   +          + R YDPCTER+S 
Sbjct  257  ECMNALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSK  312

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  313  VYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSG  372

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  373  DTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLH  432

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  433  RPRQAFILFRSFLENKLMP  451



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C + L  A  E G+ID YSI+T  C  + S     LKR  R     + R YDPCTER+S
Sbjct  260  DCMRALXLAEMEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYS  314

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWVFS
Sbjct  315  EVYFNRPDVQKALHANVTKVSYPWQTCSDXVGNYWADSPLSMLPIYKELIAAGLKIWVFS  374

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGG +Q Y+GLTFV V GAGHEV L
Sbjct  375  GDTDSVVPVTATRYSIDALKLPTITNWFPWNDNGKVGGRSQIYKGLTFVTVTGAGHEVPL  434

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+LA  L  SFL    MP
Sbjct  435  HRPRLAFILFRSFLESKPMP  454



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 140/199 (70%), Gaps = 6/199 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHST  571
            C + L  A  E G+ID YSIFT  C+ +       LKR  R     + R YDPCTER+S 
Sbjct  264  CMEALKLADSEQGNIDPYSIFTRPCSSA-----AALKRNLRGHYPWMSRAYDPCTERYSE  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             YFN PEVQKALH + T  S+ W TCSD V ++W D P ++L +YQELI AGL+IWV+SG
Sbjct  319  KYFNHPEVQKALHANVTGLSYPWKTCSDFVGNYWSDSPRSMLPIYQELIAAGLKIWVYSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT++ W PW D+G+VGGW+Q Y+GLT V + GAGHEV LH
Sbjct  379  DTDAVVPVTATRYSIDALKLPTINNWSPWSDSGKVGGWSQIYKGLTLVTITGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L +SFL    MP
Sbjct  439  RPREAFILFKSFLENKPMP  457



>ref|NP_001150676.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39970.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=484

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 142/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+ + A  E G+ID YSI+T TC ++ S+  R L R   ++  L R YDPCTE + T
Sbjct  280  ECQKIYEVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYIT  336

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             Y NLPEVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSG
Sbjct  337  KYCNLPEVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSG  396

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHEV LH
Sbjct  397  DTDSVVPLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLH  456

Query  210  RPKLALTLVESFLAGTSMP  154
            RP   L L E FL G  MP
Sbjct  457  RPPQGLKLFEHFLRGEPMP  475



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 138/199 (69%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C   L  A  E G+ID YSIFT  C ++ ++   +          + R YDPCTER+S 
Sbjct  256  QCMNALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSK  311

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  312  VYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSG  371

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  372  DTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLH  431

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  432  RPRQAFILFRSFLENKLMP  450



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C   L  A  E G+ID YSI+T  C ++ S + R L  R      + R YDPCTER+S 
Sbjct  264  QCMTALRVAVAEQGNIDPYSIYTPPCNDTAS-LRRGLNGR---YPWMSRAYDPCTERYSD  319

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T  S+ W TCSD V ++W D P ++L +YQELI A LRIWV+SG
Sbjct  320  LYFNRPEVQKALHANVTGISYPWKTCSDIVGNYWTDSPLSMLPIYQELINASLRIWVYSG  379

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TR+SIDALKLPT+  W PWYD+G+VGGW+Q Y+GLTFV VRGAGHEV LH
Sbjct  380  DTDAVVPLTATRHSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTFVTVRGAGHEVPLH  439

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ +  L  SFL    MP
Sbjct  440  RPRESFILFRSFLENKYMP  458



>ref|XP_010937832.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=470

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C KVL+ AS+E+G+ID YSI+T  C ++       LKR+ R     + R YDPCTE ++
Sbjct  273  DCMKVLEAASNEMGNIDPYSIYTRPCNDA-----TTLKRKLRGHYPWMSRAYDPCTENYA  327

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +Y+N PEVQKALH + T   + W TCS+ V  +W D P ++L +Y+ELI AGLRIWVFS
Sbjct  328  NVYYNRPEVQKALHANVTGIPYPWDTCSNIVGKYWTDSPRSMLPIYRELIAAGLRIWVFS  387

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T+TRYSIDAL L TV  W  WYD G VGGWTQ Y+GLTFV VRGAGHEV L
Sbjct  388  GDTDSVVPLTATRYSIDALNLSTVISWYAWYDQGMVGGWTQVYKGLTFVTVRGAGHEVPL  447

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ AL L + FL    MP
Sbjct  448  HRPRQALVLFKHFLQNRPMP  467



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 138/199 (69%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C   L  A  E G+ID YSIFT  C ++ ++   +          + R YDPCTER+S 
Sbjct  257  QCMNALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSK  312

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  313  VYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSG  372

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  373  DTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLH  432

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  433  RPRQAFILFRSFLENKLMP  451



>ref|XP_008649461.1| PREDICTED: serine carboxypeptidase 2-like isoform X2 [Zea mays]
 gb|AFW77518.1| hypothetical protein ZEAMMB73_509500 [Zea mays]
Length=491

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 142/214 (66%), Gaps = 15/214 (7%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTE  583
             CN   D A+ E GDID YSI+T TC ++ +  S    RR R  G    +    YDPCTE
Sbjct  271  RCNAAYDKATAEQGDIDPYSIYTPTCNQTSTSSSSSTPRRMRLKGRYPWMRGSSYDPCTE  330

Query  582  RHSTIYFNLPEVQKALHVHTTNSS-----FEWVTCSDEVYDFWKDCPTTVLDVYQELITA  418
            RHST+Y+N PEVQ+ALH + T  +     + W TCSD + + W D P +VL +Y+ELI A
Sbjct  331  RHSTVYYNRPEVQRALHANVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAA  390

Query  417  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD------NGQVGGWTQEYEGL  256
            GLRIWVFSGDTDAV+P+T+TRYSIDAL LPTV  W PWYD        +VGGW+Q YEGL
Sbjct  391  GLRIWVFSGDTDAVVPLTATRYSIDALNLPTVVSWYPWYDAKEQKQQQEVGGWSQVYEGL  450

Query  255  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  154
            T V VRGAGHEV LHRP+ AL L   FL G  MP
Sbjct  451  TLVTVRGAGHEVPLHRPRQALILFRHFLRGKPMP  484



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L TA  E G+ID YSIFT  C  + ++   ++ R       + R YDPCTER+S 
Sbjct  261  QCMEALRTAELEQGNIDPYSIFTRPCNNTVTLKRFLMGRYP----WMSRAYDPCTERYSN  316

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             YFN P VQKALH + T   + W  CSD V  +W D P ++L +Y+ELI AG++IWVFSG
Sbjct  317  SYFNRPNVQKALHANVTRLPYPWKACSDIVGSYWTDSPVSMLPIYKELIAAGVKIWVFSG  376

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSI+ALKLPT++ W PWYD G+VGGW+Q Y+GLTFV+V GAGHEV LH
Sbjct  377  DTDAVVPVTATRYSINALKLPTITNWYPWYDQGKVGGWSQVYKGLTFVSVAGAGHEVPLH  436

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  437  RPRQAFILFRSFLEDKPMP  455



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L  A  E G+ID YSI+T  C  + S+   +          + R YDPCTER+S 
Sbjct  260  ECKKALTIAEFEQGNIDPYSIYTRPCNSTASLRHNLRGHYP----WMSRAYDPCTERYSV  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
             YFN P+VQ+A H + T  ++ W TCSD V ++W D P ++L +YQELI +G+RIWVFSG
Sbjct  316  AYFNHPDVQEAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQELIGSGIRIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+PVT+TRYSIDALKLPT+S W PWYD+G+VGGW+Q Y+GLTFV V GAGHEV LH
Sbjct  376  DTDSVVPVTATRYSIDALKLPTLSNWYPWYDHGKVGGWSQIYKGLTFVTVAGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    +P
Sbjct  436  RPREAFILFRSFLENKPLP  454



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 140/199 (70%), Gaps = 6/199 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHST  571
            C K LD A  E+G+ID YSI+T  C ++ S     L+R  R     + R YDPCTER+S 
Sbjct  278  CIKALDDADTEMGNIDPYSIYTLPCNDTGS-----LRRNLRGHYPWMSRAYDPCTERYSM  332

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +Y+N PEVQKALH + T   + W TCSD + D W D P +VL +Y ELI AGLRIWVFSG
Sbjct  333  VYYNRPEVQKALHANVTGIPYSWETCSDTIGDNWGDSPKSVLPIYHELIAAGLRIWVFSG  392

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDALKL T+  W PWY +G+VGGW+Q YEGLTFV V GAGHEV LH
Sbjct  393  DTDSVVPLTATRYSIDALKLKTLKNWYPWYYDGKVGGWSQIYEGLTFVTVTGAGHEVPLH  452

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL L + FL    MP
Sbjct  453  RPRQALILFKRFLKNKPMP  471



>ref|XP_002458719.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
 gb|EES03839.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
Length=467

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K L+ AS E G+ID YS+ T  C ++ S+   +  R       L R YDPCTER+++
Sbjct  271  DCVKNLNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSRAYDPCTERYAS  326

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSG
Sbjct  327  IYYNRPEVQMAMHANTTGLHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSG  386

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LH
Sbjct  387  DTDAVVPVTATRYSIDALKLPTVVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLH  446

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL +   FL    MP
Sbjct  447  RPRQALIMFRHFLQNKPMP  465



>gb|EMS66624.1| Serine carboxypeptidase II-1 [Triticum urartu]
Length=357

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ D A  E G ID YSI+T TC ++     R +K R      L R YDPCTE++ST 
Sbjct  154  CNKIYDVAEAEEGLIDAYSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTK  210

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA   + T   + W  CSD ++++WKD P ++L +Y+ELI AG+RIWVFSGD
Sbjct  211  YYNLPEVQKAFRANVTGIPYAWTGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGD  270

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  271  ADSVVPLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHR  330

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  331  PRQALKLFEHFLQDKPMP  348



>ref|XP_006655142.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 2-like 
[Oryza brachyantha]
Length=469

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 140/209 (67%), Gaps = 3/209 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVG---LLRRIYDPCTERH  577
            C   L+ ++ E GDID YS++T TC E+ S  +R  ++R  K G    +   YDPCTE +
Sbjct  256  CLAALNASTAEQGDIDMYSLYTPTCNETSSPAARARQQRRLKRGHYPWMTGSYDPCTEIY  315

Query  576  STIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVF  397
            ST Y+N PEVQ ALH + T  ++ W TCSD + + W+D P TVL +Y ELI AGLRIWVF
Sbjct  316  STAYYNRPEVQTALHANVTGINYTWATCSDILNNNWRDSPRTVLPIYHELIAAGLRIWVF  375

Query  396  SGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVA  217
            SGDTDAV+P+T TRYSIDAL LPT   W PWYD  +VGGW+Q Y+GLT V VRGAGHEV 
Sbjct  376  SGDTDAVVPLTGTRYSIDALGLPTTINWYPWYDAIKVGGWSQVYKGLTLVTVRGAGHEVP  435

Query  216  LHRPKLALTLVESFLAGTSMPGLQRISDS  130
            LHRP+ A  L   FL G  MP    I  +
Sbjct  436  LHRPRQAFILFNHFLKGKPMPNAPTIKSA  464



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 137/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K LD AS E G+ID YSIFT  C  + S+   +          + R YDPCTER+S 
Sbjct  272  DCMKALDAASVEQGNIDPYSIFTRPCNSTSSLRHNLRGHYP----WMSRAYDPCTERYSE  327

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +YQELI AGLRIWV+SG
Sbjct  328  VYFNKPEVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSG  387

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT++RYSIDALKL TV  W PW DNG+VGGW+Q Y+GLTFV V GAGHEV L 
Sbjct  388  DTDAVVPVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLTFVTVTGAGHEVPLL  447

Query  210  RPKLALTLVESFLAGTSM  157
            RP+ A  L  SFL    M
Sbjct  448  RPRQAFILFRSFLENKPM  465



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSIFT  C  +   + R LK R      + R YDPCTER+S 
Sbjct  265  QCMEALRNAELEQGNIDPYSIFTKPCNNTVQ-LKRFLKGR---YPWMSRAYDPCTERYSN  320

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T   + W +CSD V  +W D P ++L +Y+ELITAGL+IWVFSG
Sbjct  321  VYFNRVEVQKALHANVTRLPYPWKSCSDIVGSYWTDSPVSMLPIYRELITAGLKIWVFSG  380

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  381  DTDAVVPVTATRYSIDALKLETITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  440

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  441  RPRQAFILFRSFLENKPMP  459



>ref|XP_002459313.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
 gb|EER95834.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
Length=478

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 140/205 (68%), Gaps = 7/205 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSR-------VLKRRDRKVGLLRRIYDPC  589
            CN   D A+ E GDID YSI+T  C ++ S  ++       ++ R       +   YDPC
Sbjct  268  CNTATDVAAVEQGDIDMYSIYTPLCGQTSSSSTKRSSQSSPLIGRHYHHPWRMGGSYDPC  327

Query  588  TERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLR  409
            TE HST+Y+N PEVQ+ALH + T  ++ W TCSD +   W D P ++L +Y+ELI AGLR
Sbjct  328  TESHSTVYYNRPEVQRALHANLTGINYPWATCSDLINTNWGDSPKSMLPIYKELIAAGLR  387

Query  408  IWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAG  229
            IWVFSGDTDAVIP+TSTRYS+DAL LPT + W PWYD  QVGGW+Q YEGLT V VRGAG
Sbjct  388  IWVFSGDTDAVIPLTSTRYSVDALGLPTTTSWYPWYDKKQVGGWSQVYEGLTLVTVRGAG  447

Query  228  HEVALHRPKLALTLVESFLAGTSMP  154
            HEV LHRP+ AL L + FL G  MP
Sbjct  448  HEVPLHRPRQALILFQQFLKGEPMP  472



>ref|NP_001151874.1| LOC100285510 precursor [Zea mays]
 gb|ACG44727.1| virulence-related protein Nf314 [Zea mays]
Length=467

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K L+ AS E G+ID YS+ T  C ++ S+   +  R       L R YDPCTER+++
Sbjct  271  DCVKNLNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSRAYDPCTERYAS  326

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSG
Sbjct  327  IYYNRPEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSG  386

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT + + GAGHEV LH
Sbjct  387  DTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAGHEVPLH  446

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL +   FL    MP
Sbjct  447  RPRQALIMFRHFLQNKPMP  465



>gb|AAV43957.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
Length=483

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVG---LLRRIYDPCTERH  577
            C   L+ ++ E GDID YS++T TC E+ S  S   ++R  K G    +   YDPCTER+
Sbjct  274  CLAALNASTVEQGDIDMYSLYTPTCNET-STSSAAARQRRLKQGHYPWMTGSYDPCTERY  332

Query  576  STIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVF  397
            ST Y+N PEVQ+ALH + T  ++ W TCSD + D W+D P +VL +Y ELI AGLRIWVF
Sbjct  333  STEYYNRPEVQRALHANVTGINYTWATCSDILNDNWRDSPRSVLPIYHELIAAGLRIWVF  392

Query  396  SGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVA  217
            SGDTDAV+P+T+TRYSIDAL LPT   W PWYD  +VGGW+Q Y+GL+ V VRGAGHEV 
Sbjct  393  SGDTDAVVPLTATRYSIDALGLPTTVSWYPWYDAMKVGGWSQVYKGLSLVTVRGAGHEVP  452

Query  216  LHRPKLALTLVESFLAGTSMP  154
            LHRP+ AL L + FL G  MP
Sbjct  453  LHRPRQALILFKHFLQGKPMP  473



>ref|XP_008673013.1| PREDICTED: LOC100285510 isoform X1 [Zea mays]
 gb|ACR34277.1| unknown [Zea mays]
 tpg|DAA56985.1| TPA: virulence protein Nf314 [Zea mays]
Length=467

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K L+ AS E G+ID YS+ T  C ++ S+   +  R       L R YDPCTER+++
Sbjct  271  DCVKNLNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSRAYDPCTERYAS  326

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSG
Sbjct  327  IYYNRPEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSG  386

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT + + GAGHEV LH
Sbjct  387  DTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAGHEVPLH  446

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL +   FL    MP
Sbjct  447  RPRQALIMFRHFLQNKPMP  465



>ref|XP_009410600.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 141/202 (70%), Gaps = 4/202 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ A+ E G+ID YSI+T  C  S S+ S +    + +   + R YDPCT+R++ 
Sbjct  262  ECVKNLNAATAEQGNIDPYSIYTQPCNSSRSLKSSL----NGRYPWMSRAYDPCTDRYAK  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +Y+N PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI AGLRIW+FSG
Sbjct  318  VYYNRPEVQRALHANVTGIQYPWDTCSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDAL L T+  W PWYD G+VGGW+Q Y+GLTFV + GAGHEV LH
Sbjct  378  DTDAVVPVTATRYSIDALNLQTLISWYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMPGLQ  145
             P+ A+ L   FL    MP  Q
Sbjct  438  HPRQAMILFRQFLKNRPMPRCQ  459



>gb|EMT21139.1| putative Serine carboxypeptidase II-1 [Aegilops tauschii]
Length=419

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ D A  E G ID YSI+T TC ++     R +K R      L R YDPCTE++ST 
Sbjct  216  CNKIYDVAEAEEGLIDAYSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTK  272

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA   + T   + W +CSD ++++WKD P ++L +Y ELI AG+RIWVFSGD
Sbjct  273  YYNLPEVQKAFRANVTGIPYAWTSCSDVLFEYWKDSPRSMLPIYHELIAAGIRIWVFSGD  332

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  333  ADSVVPLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHR  392

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  393  PRQALKLFEHFLQDKPMP  410



>ref|XP_004962519.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=490

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 138/199 (69%), Gaps = 1/199 (1%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTE-SFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            C+   D A+ E GDID YSI+T TC + S S  +R   R       +R  YDPCTE HST
Sbjct  286  CDAAYDAATVEQGDIDPYSIYTPTCNQTSSSTTARKNWRLKGHYPWMRGSYDPCTEMHST  345

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +Y+N PEVQ+ALH + T  ++ W TCS  +   W D P ++L +Y+ELI AGLRIWV+SG
Sbjct  346  VYYNRPEVQRALHANVTGINYTWTTCSGIINTNWGDSPRSMLPIYKELIAAGLRIWVYSG  405

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+P+T+TRYSIDAL LPTV  W PWYD  +VGGW+Q Y+GLT V +RGAGHEV LH
Sbjct  406  DTDSVVPLTATRYSIDALGLPTVVSWYPWYDKKEVGGWSQVYKGLTLVTIRGAGHEVPLH  465

Query  210  RPKLALTLVESFLAGTSMP  154
            RPK AL L   FL G  MP
Sbjct  466  RPKQALILFRHFLHGKPMP  484



>ref|XP_004970465.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=457

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K L+ AS E G+ID YS+ T  C  + S+   +  R       L R YDPCTER+++
Sbjct  261  DCVKNLNLASAEEGNIDPYSLNTKPCNYTASLKVSLGGRYP----WLSRAYDPCTERYAS  316

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSG
Sbjct  317  IYYNRPEVQMALHANTTGIHYPWQTCSDIVGTYWADSPRSMLPIYQELIAAGMKIWVFSG  376

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LH
Sbjct  377  DTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLH  436

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ AL +   FL    MP
Sbjct  437  RPRQALIMFRHFLKNKPMP  455



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L +A  E G+ID YSIFT  C  +  + S  LK R      + R YDPCTER+S 
Sbjct  263  QCMEALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSN  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSG
Sbjct  319  VYFNRVEVQKALHANVTRLSYSWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  379  DTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  +  SFL    MP
Sbjct  439  RPRQAFIIFRSFLENKPMP  457



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSIFT  C  +   + R LK R      + R YDPC+ER+S 
Sbjct  263  QCMEALRNAELEQGNIDPYSIFTKPCNNTVQ-LKRFLKGR---YPWMSRAYDPCSERYSN  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSG
Sbjct  319  VYFNRVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  379  DTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  439  RPRQAFILFRSFLENKPMP  457



>ref|XP_009410601.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K L+ A+ E G+ID YSI+T  C  S S+ S +  R       + R YDPCT+R++ 
Sbjct  262  ECVKNLNAATAEQGNIDPYSIYTQPCNSSRSLKSSLNGRYP----WMSRAYDPCTDRYAK  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +Y+N PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI AGLRIW+FSG
Sbjct  318  VYYNRPEVQRALHANVTGIQYPWDTCSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDAL L T+  W PWYD G+VGGW+Q Y+GLTFV + GAGHEV LH
Sbjct  378  DTDAVVPVTATRYSIDALNLQTLISWYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMP  154
             P+ A+ L   FL    MP
Sbjct  438  HPRQAMILFRQFLKNRPMP  456



>ref|XP_003566409.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
 ref|XP_003568700.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
Length=469

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 139/198 (70%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CN++ D A  E G ID YSI+T TC ++     R++K R      L R YDPCTE++ST 
Sbjct  266  CNQIYDVAEAEEGLIDAYSIYTPTCKKASLRKRRLIKGRRP---WLPRGYDPCTEKYSTK  322

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA H + T   + W  CSD++++ WKD P ++L +Y ELI AG+RIWVFSGD
Sbjct  323  YYNLPEVQKAFHANVTGMPYAWNPCSDDLFEHWKDSPRSMLPIYHELIAAGIRIWVFSGD  382

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T+TRYSIDAL LPTV+ W PWY+  +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  383  ADSVVPLTATRYSIDALYLPTVTNWYPWYEEEEVAGWCQVYKGLTLVTIRGAGHEVPLHR  442

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  443  PQQALKLFEHFLQDKPMP  460



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 140/201 (70%), Gaps = 6/201 (3%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSI+T  C  + S+ S +  R       + R YDPCTERHS 
Sbjct  262  QCFQALRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSD  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSG
Sbjct  318  VYFNRPEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ--VGGWTQEYEGLTFVAVRGAGHEVA  217
            DTD+V+P+T+TRYSIDALKLPT+  W PWYD+G+  VGGW+Q Y+GLT V +RGAGHEV 
Sbjct  378  DTDSVVPLTATRYSIDALKLPTIINWYPWYDSGKVGVGGWSQVYKGLTLVTIRGAGHEVP  437

Query  216  LHRPKLALTLVESFLAGTSMP  154
            LH+P+ A  L  SFL    MP
Sbjct  438  LHKPREAFILFRSFLENKDMP  458



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L +A  E G+ID YSIFT  C  +  + S  LK R      + R YDPCTER+S 
Sbjct  254  QCMEALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSN  309

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSG
Sbjct  310  VYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSG  369

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  370  DTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLH  429

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  +  SFL    MP
Sbjct  430  RPRQAFIIFRSFLENKPMP  448



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L +A  E G+ID YSIFT  C  +  + S  LK R      + R YDPCTER+S 
Sbjct  263  QCMEALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSN  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSG
Sbjct  319  VYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  379  DTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  +  SFL    MP
Sbjct  439  RPRQAFIIFRSFLENKPMP  457



>ref|XP_008649460.1| PREDICTED: serine carboxypeptidase 2-like isoform X1 [Zea mays]
Length=492

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 142/215 (66%), Gaps = 16/215 (7%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTE  583
             CN   D A+ E GDID YSI+T TC ++ +  S    RR R  G    +    YDPCTE
Sbjct  271  RCNAAYDKATAEQGDIDPYSIYTPTCNQTSTSSSSSTPRRMRLKGRYPWMRGSSYDPCTE  330

Query  582  RHSTIYFNLPEVQKALHVHTTNSS-----FEWVTCSDEVYDFWKDCPTTVLDVYQELITA  418
            RHST+Y+N PEVQ+ALH + T  +     + W TCSD + + W D P +VL +Y+ELI A
Sbjct  331  RHSTVYYNRPEVQRALHANVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAA  390

Query  417  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-------NGQVGGWTQEYEG  259
            GLRIWVFSGDTDAV+P+T+TRYSIDAL LPTV  W PWYD         +VGGW+Q YEG
Sbjct  391  GLRIWVFSGDTDAVVPLTATRYSIDALNLPTVVSWYPWYDAKEQQKQQQEVGGWSQVYEG  450

Query  258  LTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  154
            LT V VRGAGHEV LHRP+ AL L   FL G  MP
Sbjct  451  LTLVTVRGAGHEVPLHRPRQALILFRHFLRGKPMP  485



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L +A  E G+ID YSIFT  C  +  + S  LK R      + R YDPCTER+S 
Sbjct  263  QCMEALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSN  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSG
Sbjct  319  VYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  379  DTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  +  SFL    MP
Sbjct  439  RPRQAFIIFRSFLENKPMP  457



>sp|P55747.1|CBP21_HORVU RecName: Full=Serine carboxypeptidase II-1; AltName: Full=CP-MII.1; 
Contains: RecName: Full=Serine carboxypeptidase II-1 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-1 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31591.1| CP-MII.1=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 324 aa]
 emb|CAB58992.1| serine carboxypeptidase II-1 [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ + A  E G ID YSI+T TC ++     R++K R      L R YDPCTE++ST 
Sbjct  121  CNKINNVAEAEEGLIDAYSIYTPTCKKTSLHRRRLIKGRR---PWLPRGYDPCTEQYSTK  177

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA   + T   + W  CSD + D WKD P ++L +Y+ELI AG+RIWVFSGD
Sbjct  178  YYNLPEVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGD  237

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T+TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  238  ADSVVPLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHR  297

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  298  PQQALKLFEHFLQDKPMP  315



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   232 bits (592),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 139/198 (70%), Gaps = 25/198 (13%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +CNK+L+ A  E+G+ID YS+FT  C  + S                   YDPCTE+H+T
Sbjct  235  QCNKILEIADKEIGNIDQYSVFTPACVANAS----------------HEQYDPCTEKHTT  278

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALH+        W+ CSD V + W D P++VL++Y ELI AGLRIWVFSG
Sbjct  279  VYFNLPEVQKALHL--------WL-CSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSG  329

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            D DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LH
Sbjct  330  DADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLH  389

Query  210  RPKLALTLVESFLAGTSM  157
            RPK AL L ++F++GT +
Sbjct  390  RPKQALALFKAFISGTPL  407



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 137/199 (69%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSI T  C  + S+ S +  R       + R YDPC ER+S 
Sbjct  262  QCLQALTVAITEQGNIDGYSINTPPCNNTASLRSGLHDRYP----WMYRAYDPCAERYSD  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T  S+ W  CS  V+D+W D P ++L +YQELI A LRIWV+SG
Sbjct  318  VYFNRPEVQKALHANVTGISYAWKACSGTVWDYWTDSPLSMLPIYQELINADLRIWVYSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIP+T+TRYSI ALKLPT+  W PWYDNG+V GW+Q Y+GLT V VRGAGHEV LH
Sbjct  378  DTDAVIPLTATRYSIGALKLPTIMNWYPWYDNGKVCGWSQVYKGLTLVTVRGAGHEVPLH  437

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL   +MP
Sbjct  438  RPREAFILFRSFLENKNMP  456



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 138/199 (69%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C   L  A  E G+ID YSIFT  C  +  + S +  R       + R YDPCTER+S 
Sbjct  260  QCMVALRNAELEQGNIDPYSIFTKPCNNTVQLKSFLRGRYP----WMSRAYDPCTERYSN  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T   + W +CSD V  +W+D P ++L +Y+ELITAGL+IWVFSG
Sbjct  316  VYFNRVEVQKALHANVTRLPYPWKSCSDIVGSYWRDSPVSMLPIYRELITAGLKIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  376  DTDAVVPVTATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  436  RPRQAFILFRSFLESKPMP  454



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 137/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C K LD AS E G+ID YSIFT  C  + S+   +          + R YDPCTER+S 
Sbjct  333  DCMKALDAASVEQGNIDPYSIFTRPCNSTSSLRHNLRGHYP----WMSRAYDPCTERYSE  388

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +YQELI AGLRIWV+SG
Sbjct  389  VYFNKPEVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSG  448

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT++RYSIDALKL TV  W PW DNG+VGGW+Q Y+GLTFV V GAGHEV L 
Sbjct  449  DTDAVVPVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLTFVTVTGAGHEVPLL  508

Query  210  RPKLALTLVESFLAGTSM  157
            RP+ A  L  SFL    M
Sbjct  509  RPRQAFILFRSFLENKPM  526



>emb|CDM82001.1| unnamed protein product [Triticum aestivum]
Length=463

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ D A  E G ID YSI+T TC ++     R +K R      L R YDPCTE++ST 
Sbjct  260  CNKIYDVAEAEEGPIDAYSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTK  316

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA   + T   + W  CSD ++++WKD P ++L +Y+ELI AG+RIWVFSGD
Sbjct  317  YYNLPEVQKAFRANVTGIPYAWTGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGD  376

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  377  ADSVVPLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHR  436

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  437  PRQALKLFEHFLQDKPMP  454



>ref|XP_010527107.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=207

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 134/190 (71%), Gaps = 1/190 (1%)
 Frame = -2

Query  705  IDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVH  526
            +D Y +FT TC  + S    +LK+R    G +   YDPCTE+HS +YFN PEVQKALHV 
Sbjct  2    VDQYIVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNPPEVQKALHVP  60

Query  525  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  346
               +  +W  CSD V + W D P +VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSI
Sbjct  61   PEFAPSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSI  120

Query  345  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAG  166
            +AL L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LHRPK +L L ++F++G
Sbjct  121  EALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSG  180

Query  165  TSMPGLQRIS  136
              +P  ++ S
Sbjct  181  NPLPTSEKNS  190



>ref|XP_003566533.2| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=466

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CN   DTA+ E G+ID YS++T  C ++ S+ SR   R   +   +   YDPCTER+ST+
Sbjct  263  CNAAQDTAATEQGNIDMYSLYTPVCNQTASV-SR--PRPRGRYPWMSGSYDPCTERYSTV  319

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+N PEVQ+ALH + T  ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGD
Sbjct  320  YYNRPEVQRALHANVTGINYTWATCSDTINKNWGDAPRSMLPIYKELIQAGLRIWVFSGD  379

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+P+T+TRYSIDAL LPT   W PW D+ +VGGW+Q Y+GLT V +RGAGHEV LHR
Sbjct  380  TDAVVPLTATRYSIDALDLPTTIGWYPWSDSKEVGGWSQVYKGLTLVTIRGAGHEVPLHR  439

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL + ++FL G  +P
Sbjct  440  PRQALIMFQNFLRGMPLP  457



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 143/200 (72%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC+K ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      + R YDPCT+R+S
Sbjct  253  ECSKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTDRYS  309

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H + T  S+ W TCSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  310  GMYFNSPEVQKAMHANITGLSYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFS  369

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T TRYSI ALKLP +S W PW D+GQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  370  GDTDSVVPITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPL  429

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L +SFL    +P
Sbjct  430  HRPRRAYLLFQSFLDNKPLP  449



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSIFT  C  +  + S  LK R      + R YDPC+ER+S 
Sbjct  263  QCMEALRNAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCSERYSN  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSG
Sbjct  319  VYFNRVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  379  DTDAVVPITATRYSIDALKLTTITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  439  RPRQAFILFRSFLENKPMP  457



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C   L  A  E G+ID YSIFT  C  + + + R LK R      + R YDPCTER+S 
Sbjct  263  QCMVALRNAELEQGNIDPYSIFTKPCNSTVA-LKRFLKGR---YPWMSRAYDPCTERYSN  318

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  +VQKALH + T  S+ W  CSD V  +W D P ++L +Y+ELITAGL+IWVFSG
Sbjct  319  VYFNRLDVQKALHANVTRLSYPWKACSDIVGSYWDDSPLSMLPIYKELITAGLKIWVFSG  378

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  379  DTDAVVPITATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  438

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  439  RPRQAFILFRSFLESKPMP  457



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 140/200 (70%), Gaps = 5/200 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHST  571
            C   LDTA  E+G+ID YSI+T  C +      R LKR  R     + R YDPCTER+S 
Sbjct  277  CVNALDTADSEMGNIDPYSIYTLPCNDH----PRSLKRNLRGHYPWMSRAYDPCTERYSR  332

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IY+N  +VQ+A+H + T   + W TCSD + + W D P ++L +Y+ELI AGLRIWVFSG
Sbjct  333  IYYNRADVQRAMHANVTGIPYGWDTCSDTISENWGDSPKSMLPIYRELIAAGLRIWVFSG  392

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDAL+L T+  W PWYD+G+VGGW+Q Y+GLT+V V GAGHEV LH
Sbjct  393  DTDAVVPLTATRYSIDALRLRTLEKWYPWYDHGKVGGWSQIYKGLTYVTVTGAGHEVPLH  452

Query  210  RPKLALTLVESFLAGTSMPG  151
            RP+ AL L E FL    MP 
Sbjct  453  RPRQALMLFEHFLKNKPMPA  472



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSIFT  C  + ++ +  LK R      + R YDPCTER+S 
Sbjct  264  QCMEALRNAELEQGNIDPYSIFTKPCNNTVALKT-FLKGR---YPWMSRAYDPCTERYSN  319

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T   + W  CSD V  +W D P ++L +Y+ELITAGL+IWVFSG
Sbjct  320  VYFNRVEVQKALHANVTRLRYPWKACSDIVGSYWTDSPMSMLPIYRELITAGLKIWVFSG  379

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  380  DTDAVVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  439

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L +SFL    MP
Sbjct  440  RPRQAFILFKSFLENKPMP  458



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC+K ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      + R YDPCT+R+S
Sbjct  253  ECSKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTDRYS  309

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H + T  S+ W  CSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  310  GMYFNSPEVQKAMHANITGLSYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFS  369

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T TRYSI ALKLP +S W PW D+GQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  370  GDTDSVVPITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPL  429

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+ A  L +SFL    +P
Sbjct  430  HRPRRAFLLFQSFLDNKPLP  449



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSIFT  C  +  + S  LK R      + R YDPC+ER+S 
Sbjct  261  QCMEALRNAELEQGNIDPYSIFTKPCNNTVELKS-FLKGR---YPWMSRAYDPCSERYSN  316

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSG
Sbjct  317  VYFNRVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSG  376

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+P+T+TRYSIDALKL T++ W PWYD+G+V GW+Q Y+GLT V V GAGHEV LH
Sbjct  377  DTDAVVPITATRYSIDALKLATITNWYPWYDHGKVAGWSQVYKGLTLVTVAGAGHEVPLH  436

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  437  RPRQAFILFRSFLENKPMP  455



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C   L  A  E G+ID YSIFT  C  + ++ S  LK R      + R YDPCTER+S 
Sbjct  260  QCMVALRNAELEQGNIDPYSIFTKPCNSTVALKS-FLKGR---YPWMSRAYDPCTERYSN  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN  +VQKALH + T   + W  CSD V  +W+D P ++L +Y+ELITAGL+IW+FSG
Sbjct  316  VYFNRADVQKALHANVTRLPYPWKACSDIVGSYWEDSPLSMLPIYRELITAGLKIWIFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAV+PVT+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LH
Sbjct  376  DTDAVVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            RP+ A  L  SFL    MP
Sbjct  436  RPRQAFILFRSFLDSKPMP  454



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 139/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC KV++ A  E G ID YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S
Sbjct  256  ECKKVMEAADLEQGSIDPYSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYS  312

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H + T  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  313  GMYFNSPEVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFS  372

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T TRYSI ALKL  +S W PW DNGQVGGW Q Y+GLT V + GAGHEV L
Sbjct  373  GDTDSVVPITGTRYSIRALKLQPLSKWYPWNDNGQVGGWIQVYKGLTLVTIHGAGHEVPL  432

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+    L +SFL    +P
Sbjct  433  HRPRRGFLLFQSFLDNKPLP  452



>dbj|BAK02399.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 137/198 (69%), Gaps = 3/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            CNK+ + A  E G ID YSI+T TC ++     R++K R      L R YDPCTE++ST 
Sbjct  260  CNKINNVAEAEEGLIDAYSIYTPTCKKTSLHRRRLIKGRRP---WLPRGYDPCTEQYSTK  316

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            Y+NLPEVQKA   + T   + W  CSD + D WKD P ++L +Y+ELI AG+RIWVFSGD
Sbjct  317  YYNLPEVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGD  376

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
             D+V+P+T+TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHR
Sbjct  377  ADSVVPLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHR  436

Query  207  PKLALTLVESFLAGTSMP  154
            P+ AL L E FL    MP
Sbjct  437  PQQALKLFEHFLQDKPMP  454



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 141/233 (61%), Gaps = 39/233 (17%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHS  574
            +C   L  A  E G+ID YSIFT  C ++       LKR  R     + R YDPCTER+S
Sbjct  324  QCMSALRVAEVEQGNIDPYSIFTQPCKDT-----ATLKRNMRGHYPWMSRAYDPCTERYS  378

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFNLPEVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AG RIWV+S
Sbjct  379  KVYFNLPEVQKALHANVTGISYPWQTCSDLVGNYWADAPLSMLPIYKELIAAGFRIWVYS  438

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNG--------------------------  292
            GDTDAV+PVT+TRYSIDALKLPTV+ W PWYDNG                          
Sbjct  439  GDTDAVVPVTATRYSIDALKLPTVTNWYPWYDNGKVSTDNVIQFLELVSVEIGLHRCLSH  498

Query  291  -------QVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  154
                   QVGGW+Q Y GLTFV V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  499  QISHFLIQVGGWSQAYRGLTFVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  551



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 139/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC KV++ A  E G ID YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S
Sbjct  254  ECKKVMEAADLEQGSIDPYSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYS  310

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  311  GMYFNSPEVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFS  370

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T TRYSI ALKL  +S W PW DNGQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  371  GDTDSVVPITGTRYSIRALKLQPLSKWYPWNDNGQVGGWSQVYKGLTLVTIHGAGHEVPL  430

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+    L +SFL    +P
Sbjct  431  HRPRRGFLLFQSFLDNKPLP  450



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 138/200 (69%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC+  +  A  E G ID YSI+T TCT E+ ++ SR  + R      + R YDPCTER+S
Sbjct  254  ECSNAMKAADLEQGKIDPYSIYTITCTKEAAALRSRFSRVRHP---WMWRAYDPCTERYS  310

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  311  GMYFNSPEVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFS  370

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT TRYSI ALKL  VS W PW DNGQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  371  GDTDSVVPVTGTRYSIRALKLQPVSKWYPWNDNGQVGGWSQVYQGLTLVTIHGAGHEVPL  430

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+    L +SFL    +P
Sbjct  431  HRPRRGFLLFQSFLDNKPLP  450



>gb|ACU19747.1| unknown [Glycine max]
Length=282

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 136/199 (68%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
             C + L+ A+ E G+ID YSI+T  C +  +I  R+  R       L R YDPCTER+ST
Sbjct  49   NCVEALELATLEQGNIDPYSIYTPVCNDIAAIKRRLGGRYP----WLSRAYDPCTERYST  104

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W  C+D + + W D P ++L +YQELI  G+RIWVFSG
Sbjct  105  LYFNRPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLSIYQELIEGGIRIWVFSG  164

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT V VRGAGHEV LH
Sbjct  165  DTDSVVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLH  224

Query  210  RPKLALTLVESFLAGTSMP  154
            +P+    L ++FL   +MP
Sbjct  225  KPRQGFILFKTFLEDKNMP  243



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 149/206 (72%), Gaps = 3/206 (1%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC    + A++E+G ID YS++T  CT S S  S +L +R   + L  + YDPCTE HS 
Sbjct  284  ECGNAHNFAANEIGRIDYYSVYTPKCTSSSSTTSNLLSKRWPTL-LRSQGYDPCTEAHSI  342

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            IYFNLPEVQ+ALHV    S  +W TC   V+  WKD   ++L+  +EL T+G+RIW++SG
Sbjct  343  IYFNLPEVQQALHVR--GSPVKWETCGLTVHYAWKDSARSLLNTIKELTTSGIRIWIYSG  400

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            +TDAVIP+TSTRYS+ AL LPTV  + PWY++GQVGGWTQ+YEGLTFVAV  AGHEV LH
Sbjct  401  NTDAVIPITSTRYSLRALNLPTVGSYLPWYEDGQVGGWTQQYEGLTFVAVNAAGHEVPLH  460

Query  210  RPKLALTLVESFLAGTSMPGLQRISD  133
            +PK ALT+ ++FLAGT +   ++ SD
Sbjct  461  KPKQALTIFKAFLAGTPLATSKQFSD  486



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 140/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            EC+K ++ A  E G ID YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S
Sbjct  257  ECSKAMEAADLEQGHIDPYSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYS  313

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H + T  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  314  GMYFNSPEVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFS  373

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T TRYSI ALKL  +S W PW D+GQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  374  GDTDSVVPITGTRYSIRALKLQPLSKWYPWNDSGQVGGWSQVYKGLTLVTIHGAGHEVPL  433

Query  213  HRPKLALTLVESFLAGTSMP  154
            HRP+    L +SFL    +P
Sbjct  434  HRPRRGFLLFQSFLDNKPLP  453



>gb|EMT12249.1| Serine carboxypeptidase 2 [Aegilops tauschii]
Length=468

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 142/201 (71%), Gaps = 4/201 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHST  571
            C+   D A+ E G+ID YS++T  C  + S  S + +RR R +   L   YDPCTER+ST
Sbjct  262  CDAATDVATAEQGNIDMYSLYTPVCNITSS--SSLSQRRPRGRYPWLTGSYDPCTERYST  319

Query  570  IYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFS
Sbjct  320  AYYNRRDVQMALHANVTGAMNYTWTTCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFS  379

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV L
Sbjct  380  GDTDAVVPLTATRYSIGALGLPTTTSWHPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPL  439

Query  213  HRPKLALTLVESFLAGTSMPG  151
            HRP+ AL L + FL G  MPG
Sbjct  440  HRPRQALVLFQYFLQGKPMPG  460



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 132/207 (64%), Gaps = 32/207 (15%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            EC K+LD AS+ELG+ID YSIFT +C  S +     L +R    G     YDPCTE+HST
Sbjct  267  ECEKILDVASNELGNIDPYSIFTPSCPGSVTFSKNKLLKRLHSFGRAGEKYDPCTEKHST  326

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFNLPEVQKALHV+   +  +W TCS                                G
Sbjct  327  VYFNLPEVQKALHVNPAVAPSKWETCS--------------------------------G  354

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTDAVIPV STRYS+D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHEV LH
Sbjct  355  DTDAVIPVASTRYSVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLH  414

Query  210  RPKLALTLVESFLAGTSMPGLQRISDS  130
            RPK AL L +SFL+G+ MP L    DS
Sbjct  415  RPKQALVLFKSFLSGSPMPTLSEFDDS  441



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            +C+K ++ A +E G+ID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S
Sbjct  254  KCSKAMEAAYNEQGNIDPYSIYTITCKKEAEALRSRFLRVRHP---WMWRAYDPCTERYS  310

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN  EVQKA+H + T  S+ W +CSD V   W D P ++L +Y+ELI AGLRIWVFS
Sbjct  311  GMYFNSLEVQKAMHANRTGISYPWTSCSDIVGAKWADSPLSMLPIYKELIAAGLRIWVFS  370

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT TRYSI +LKL  +S W PWYDN QVGGW Q Y+GLT V + GAGHEV L
Sbjct  371  GDTDSVVPVTGTRYSIRSLKLQPISKWYPWYDNEQVGGWCQVYKGLTLVTIHGAGHEVPL  430

Query  213  HRPKLALTLVESFLAGTSM  157
             RP+ A  L +SFL    M
Sbjct  431  FRPRRAFLLFKSFLENKPM  449



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 137/199 (69%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
             C + L+ A+ E G+ID YSI+T  C +    ++ + +R   +   L R YDPCTER+ST
Sbjct  260  NCVEALELATLEQGNIDPYSIYTPVCND----IAAIKRRLGGRYPWLSRAYDPCTERYST  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W  C+D + + W D P ++L +YQELI  G+RIWVFSG
Sbjct  316  LYFNRPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLPIYQELIEGGIRIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT V VRGAGHEV LH
Sbjct  376  DTDSVVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            +P+    L ++FL   +MP
Sbjct  436  KPRQGFILFKTFLEDKNMP  454



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 137/199 (69%), Gaps = 4/199 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
             C + L+ A+ E G+ID YSI+T  C +    ++ + +R   +   L R YDPCTER+ST
Sbjct  260  NCVEALELATLEQGNIDPYSIYTPVCND----IAAIKRRLGGRYPWLSRAYDPCTERYST  315

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W  C+D + + W D P ++L +YQELI  G+RIWVFSG
Sbjct  316  LYFNRPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLPIYQELIEGGIRIWVFSG  375

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  211
            DTD+V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT V VRGAGHEV LH
Sbjct  376  DTDSVVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLH  435

Query  210  RPKLALTLVESFLAGTSMP  154
            +P+    L ++FL   +MP
Sbjct  436  KPRQGFILFKTFLEDKNMP  454



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 139/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            +C K ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      + R YDPCTE++S
Sbjct  255  KCTKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTEKYS  311

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
             +YFN PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFS
Sbjct  312  GMYFNSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFS  371

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+P+T TRYSI ALKL  +S W PW D+GQVGGW+Q Y+GLT V + GAGHEV L
Sbjct  372  GDTDSVVPITGTRYSIRALKLQPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPL  431

Query  213  HRPKLALTLVESFLAGTSMP  154
             RP+ A  L +SFL    +P
Sbjct  432  FRPRRAFLLFQSFLDNKPLP  451



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 140/231 (61%), Gaps = 36/231 (16%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C + L  A  E G+ID YSI+T  C  + S+ S +  R       + R YDPCTERHS 
Sbjct  262  QCFQALRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSD  317

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  391
            +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSG
Sbjct  318  VYFNRPEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSG  377

Query  390  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNG---------------------------  292
            DTD+V+P+T+TRYSIDALKLPT+  W PWYD+G                           
Sbjct  378  DTDSVVPLTATRYSIDALKLPTIINWYPWYDSGKVGANFCKEKLFKFILIGMNSGKFDTK  437

Query  291  -----QVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  154
                 +VGGW+Q Y+GLT V +RGAGHEV LH+P+ A  L  SFL    MP
Sbjct  438  IYSSVKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLENKDMP  488



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 134/198 (68%), Gaps = 7/198 (4%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C + L+ A  E G+ID  SIFT  C  + ++   +        G   R YDPC ER+S  
Sbjct  264  CTEALELADSEFGNIDPTSIFTRPCGSAAALKGNL-------SGHYSRAYDPCAERYSEK  316

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQKALH + T  S+ W TCSD + + W D P ++L +YQELI AGL+IWV+SGD
Sbjct  317  YFNHPEVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQELIAAGLKIWVYSGD  376

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+PVT+TRYSIDALKLPT++ W PWYD+G+VGG +Q Y+GLT V + GAGH V L R
Sbjct  377  TDAVVPVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLVTITGAGHLVPLLR  436

Query  207  PKLALTLVESFLAGTSMP  154
            P+ A  L +SFL    MP
Sbjct  437  PREAFILFKSFLENKPMP  454



>emb|CAI64396.1| serine carboxypeptidase II [Triticum aestivum]
Length=260

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 138/205 (67%), Gaps = 6/205 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCT-----ESFSIMSRVLKRRDRKVGLLRRIYDPCTE  583
            C+   D A+ E G+ID YS++T  C       S S      +R   +   L   YDPCTE
Sbjct  48   CDAATDVATAEQGNIDMYSLYTPVCNITSSSSSSSSSLSQQRRSRGRYPWLTGSYDPCTE  107

Query  582  RHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  406
            R+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI AGLRI
Sbjct  108  RYSTAYYNRRDVQTALHANVTGAMNYTWSTCSDTINTHWHDAPRSMLPIYRELIAAGLRI  167

Query  405  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  226
            WVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGH
Sbjct  168  WVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGH  227

Query  225  EVALHRPKLALTLVESFLAGTSMPG  151
            EV LHRP+ AL L + FL G  MPG
Sbjct  228  EVPLHRPRQALVLFQYFLQGKPMPG  252



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 134/198 (68%), Gaps = 4/198 (2%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  568
            C + L+ A  E G+ID  SIFT  C  + ++   +      K     R YDPC ER+S  
Sbjct  264  CTEALELADSEFGNIDPTSIFTRPCGSAAALKGNLSGHYPWK----SRAYDPCAERYSEK  319

Query  567  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  388
            YFN PEVQKALH + T  S+ W TCSD + + W D P ++L +YQELI AGL+IWV+SGD
Sbjct  320  YFNHPEVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQELIAAGLKIWVYSGD  379

Query  387  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  208
            TDAV+PVT+TRYSIDALKLPT++ W PWYD+G+VGG +Q Y+GLT V + GAGH V L R
Sbjct  380  TDAVVPVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLVTITGAGHLVPLLR  439

Query  207  PKLALTLVESFLAGTSMP  154
            P+ A  L +SFL    MP
Sbjct  440  PREAFILFKSFLENKPMP  457



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 138/229 (60%), Gaps = 34/229 (15%)
 Frame = -2

Query  750  ECNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHST  571
            +C   L  A  E G+ID YSIFT  C ++ ++   +          + R YDPCTER+S 
Sbjct  257  QCMNALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSK  312

Query  570  IYFNLPEVQKALHVHTTNSSFEWVTC------------------------------SDEV  481
            +YFN  EVQKALH + T  S+ W TC                              SD V
Sbjct  313  VYFNRLEVQKALHANVTALSYPWQTCRYDHFLNTSRIFKIFVSNIYFIRICKSLFYSDIV  372

Query  480  YDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY  301
             ++W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWY
Sbjct  373  GNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWY  432

Query  300  DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  154
            DNG+VGGW+Q Y+GLT V V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  433  DNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKLMP  481



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 138/200 (69%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            +C+ V   A + E G+ID YSI+T TCT S +   R ++ ++     L   YDPCTE ++
Sbjct  263  KCDDVYSYAVNYEFGNIDQYSIYTPTCTTSQNNTVRHMRFKNLH---LISGYDPCTENYA  319

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
              Y+NLPEVQ A+H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGLRIWVFS
Sbjct  320  EKYYNLPEVQIAMHANVTNIPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFS  379

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TR+S++ L L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L
Sbjct  380  GDTDSVVPVTATRFSLNHLNLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPL  439

Query  213  HRPKLALTLVESFLAGTSMP  154
             +PK A  L +SFLAG  +P
Sbjct  440  FQPKRAYILFKSFLAGNELP  459



>ref|XP_008352213.1| PREDICTED: serine carboxypeptidase 24-like, partial [Malus domestica]
Length=332

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 7/203 (3%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTE  583
            +C+  ++ A+D + GDID YSI+T  C    +   R L+ ++    LLRR    YDPCTE
Sbjct  130  QCDDAINYATDHDFGDIDPYSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPCTE  186

Query  582  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  403
             ++  Y+N P+VQKA+H + T   ++W  CSD +Y++W D   +VL  Y+ELI AGLRIW
Sbjct  187  NYAEKYYNRPDVQKAMHANVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIW  246

Query  402  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  223
            VFSGDTD+V+PVT+TR+S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHE
Sbjct  247  VFSGDTDSVVPVTATRFSLNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHE  306

Query  222  VALHRPKLALTLVESFLAGTSMP  154
            V L + +  LTL +SFLAG  +P
Sbjct  307  VPLIQAERGLTLFKSFLAGKKLP  329



>sp|P08819.2|CBP2_WHEAT RecName: Full=Serine carboxypeptidase 2; AltName: Full=CPDW-II; 
Short=CP-WII; AltName: Full=Carboxypeptidase D; AltName: 
Full=Serine carboxypeptidase II; Contains: RecName: Full=Serine 
carboxypeptidase 2 chain A; AltName: Full=Serine carboxypeptidase 
II chain A; Contains: RecName: Full=Serine carboxypeptidase 
2 chain B; AltName: Full=Serine carboxypeptidase II 
chain B; Flags: Precursor [Triticum aestivum]
Length=444

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 138/205 (67%), Gaps = 6/205 (3%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCT-----ESFSIMSRVLKRRDRKVGLLRRIYDPCTE  583
            C+   D A+ E G+ID YS++T  C       S S      +R   +   L   YDPCTE
Sbjct  234  CDAATDVATAEQGNIDMYSLYTPVCNITSSSSSSSSSLSQQRRSRGRYPWLTGSYDPCTE  293

Query  582  RHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  406
            R+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI AGLRI
Sbjct  294  RYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRI  353

Query  405  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  226
            WVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGH
Sbjct  354  WVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGH  413

Query  225  EVALHRPKLALTLVESFLAGTSMPG  151
            EV LHRP+ AL L + FL G  MPG
Sbjct  414  EVPLHRPRQALVLFQYFLQGKPMPG  438



>ref|XP_002440854.1| hypothetical protein SORBIDRAFT_09g008660 [Sorghum bicolor]
 gb|EES19284.1| hypothetical protein SORBIDRAFT_09g008660 [Sorghum bicolor]
Length=495

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 139/216 (64%), Gaps = 18/216 (8%)
 Frame = -2

Query  747  CNKVLDTASDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTER  580
            CN   D A+ E GDID YS++T TC ++ S  S    RR R++      +R  YD CTER
Sbjct  274  CNAAYDAATAEQGDIDPYSMYTPTCNQTSSSSSSSTPRRIRRLKGRYPWMRASYDTCTER  333

Query  579  HSTIYFNLPEVQKALHVHTTNSSFEW-------------VTCSDEVYDFWKDCPTTVLDV  439
            HST+Y+N PEVQ+ALH + T                      SD + + W D P ++L +
Sbjct  334  HSTVYYNRPEVQRALHANVTGIKLHMGHLQFGAYMHVLLNDSSDTISNNWGDSPKSMLHI  393

Query  438  YQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDN-GQVGGWTQEYE  262
            Y+ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL LPTV  W PWYD+  +VGGW++ Y 
Sbjct  394  YKELIAAGLRIWVFSGDTDSVVPLTATRYSIDALDLPTVVSWYPWYDDIKEVGGWSKVYN  453

Query  261  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  154
            GLT V VRGAGHEV LHRP+ AL L + FL G  MP
Sbjct  454  GLTLVTVRGAGHEVPLHRPRQALMLFQHFLNGEPMP  489



>ref|XP_007154876.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
 gb|ESW26870.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
Length=371

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 133/200 (67%), Gaps = 6/200 (3%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            +C+     A + E G ID YSI+T TCT S ++     K      G     YDPCTE ++
Sbjct  175  KCDDAYSYAVNYEFGKIDQYSIYTPTCTTSQTVRHIRFKNLHMISG-----YDPCTENYA  229

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
              Y+NLPEVQKA+H + TN  ++W  CS+ +   WKD   +VL +Y+ELI AGL+IWVFS
Sbjct  230  EKYYNLPEVQKAMHANLTNIPYKWTACSEVLLKNWKDSEISVLPIYKELIAAGLKIWVFS  289

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TR+S++ L L   + W PWY  GQVGGWT+ Y GLTF  VRGAGHEV L
Sbjct  290  GDTDSVVPVTATRFSLNHLNLSIKTRWYPWYSGGQVGGWTEVYNGLTFATVRGAGHEVPL  349

Query  213  HRPKLALTLVESFLAGTSMP  154
             +PK A TL +SFLAG  +P
Sbjct  350  FQPKRAYTLFKSFLAGKELP  369



>gb|KDO59486.1| hypothetical protein CISIN_1g0120681mg, partial [Citrus sinensis]
Length=381

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 140/210 (67%), Gaps = 7/210 (3%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTE  583
            +C+  ++ A + E GDID YSI+T +C    ++ +  ++    K  LLRR    YDPCTE
Sbjct  174  KCDDTVNYAMNHEFGDIDQYSIYTPSC---IALPNSTVRPMRLKNTLLRRRVSGYDPCTE  230

Query  582  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  403
             ++  Y+N  EVQKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+IW
Sbjct  231  NYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIW  290

Query  402  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  223
            VFSGDTD+V+PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHE
Sbjct  291  VFSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHE  350

Query  222  VALHRPKLALTLVESFLAGTSMPGLQRISD  133
            V L +P+ AL L  SFLAG  +P  + IS 
Sbjct  351  VPLFQPRRALILFRSFLAGKQLPKSRHISQ  380



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            +C+ V   A + E G+ID YSI+T TCT S +   R ++ ++     L   YDPCTE ++
Sbjct  262  KCDDVYSYAVNYEFGNIDQYSIYTPTCTASQNNTVRHMRFKNLH---LISGYDPCTENYA  318

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
              Y+NLPEVQKA+H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGL+IWVFS
Sbjct  319  EKYYNLPEVQKAMHANVTNIPYKWTACSDVLLKNWKDSAISVLPIYKELIAAGLKIWVFS  378

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TR+S++ L L   + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L
Sbjct  379  GDTDSVVPVTATRFSLNHLNLSIRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPL  438

Query  213  HRPKLALTLVESFLAGTSMP  154
             +PK A  L +SFLA   +P
Sbjct  439  FQPKRAYILFKSFLAAKELP  458



>gb|KHN42831.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 137/200 (69%), Gaps = 4/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            +C+ V   A + E G+ID Y I+T TCT S +   R ++ ++     L   YDPCTE ++
Sbjct  262  KCDDVYSYAVNYEFGNIDQYIIYTPTCTTSQNNTVRHMRFKNLH---LISGYDPCTENYA  318

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
              Y+NLPEVQ A+H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGLRIWVFS
Sbjct  319  EKYYNLPEVQIAMHANVTNIPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFS  378

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TR+S++ L L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L
Sbjct  379  GDTDSVVPVTATRFSLNHLNLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPL  438

Query  213  HRPKLALTLVESFLAGTSMP  154
             +PK A  L +SFLAG  +P
Sbjct  439  FQPKRAYILFKSFLAGNELP  458



>ref|XP_006453596.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66836.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=471

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 139/209 (67%), Gaps = 5/209 (2%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTER  580
            +C+  ++ A + E GDID YSI+T +C    +  S V   R +   L RR+  YDPCTE 
Sbjct  264  KCDDTVNYAMNHEFGDIDQYSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCTEN  321

Query  579  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  400
            ++  Y+N  EVQKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+IWV
Sbjct  322  YAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWV  381

Query  399  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  220
            FSGDTD+V+PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV
Sbjct  382  FSGDTDSVVPVTATRFSVSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEV  441

Query  219  ALHRPKLALTLVESFLAGTSMPGLQRISD  133
             L +P+ AL L  SFLAG  +P  + IS 
Sbjct  442  PLFQPRRALILFRSFLAGKQLPKSRHISQ  470



>ref|XP_007011905.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY29524.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=465

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 137/202 (68%), Gaps = 5/202 (2%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTER  580
            +C+  +  A + E GDID YSI+T +C    +  +R +  R +   L RR+  YDPCTE 
Sbjct  264  KCDDAVSYAMNHEFGDIDQYSIYTPSCLALTNNSARHI--RLKNTLLHRRVSGYDPCTEN  321

Query  579  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  400
            ++  Y+N P+VQKA+H +TT   ++W  CSD +   WKD   +VL +Y+ELI AGLRIWV
Sbjct  322  YAEKYYNRPDVQKAMHANTTGIPYKWTACSDVLIKNWKDSENSVLPIYKELIAAGLRIWV  381

Query  399  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  220
            FSGDTD+V+PVT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV
Sbjct  382  FSGDTDSVVPVTATRFSLSHLNLHIKTPWYPWYSGNQVGGWTEVYQGLTFATVRGAGHEV  441

Query  219  ALHRPKLALTLVESFLAGTSMP  154
             L +PK A  L +SFLAG  +P
Sbjct  442  PLFQPKRAFILYKSFLAGKELP  463



>ref|XP_006474013.1| PREDICTED: serine carboxypeptidase 24-like [Citrus sinensis]
Length=471

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 139/209 (67%), Gaps = 5/209 (2%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTER  580
            +C+  ++ A + E GDID YSI+T +C    +  S V   R +   L RR+  YDPCTE 
Sbjct  264  KCDDTVNYAMNHEFGDIDQYSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCTEN  321

Query  579  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  400
            ++  Y+N  EVQKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+IWV
Sbjct  322  YAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWV  381

Query  399  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  220
            FSGDTD+V+PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV
Sbjct  382  FSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEV  441

Query  219  ALHRPKLALTLVESFLAGTSMPGLQRISD  133
             L +P+ AL L  SFLAG  +P  + IS 
Sbjct  442  PLFQPRRALILFRSFLAGKQLPKSRHISQ  470



>gb|KDP38690.1| hypothetical protein JCGZ_04043 [Jatropha curcas]
Length=254

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 137/203 (67%), Gaps = 4/203 (2%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLR-RI--YDPCTE  583
            +C++ ++ A + E GDID YSI+T +C +  +  S +   R  K  LLR RI  YDPCTE
Sbjct  50   KCDEAVNYAMNHEFGDIDQYSIYTPSCIQLQNNKSNLRPLRLFKNTLLRGRISGYDPCTE  109

Query  582  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  403
             ++  Y+N P+VQKA+H + T   ++W  CSD +   W+D  ++VL +Y+ELI AGLRIW
Sbjct  110  NYAEKYYNRPDVQKAMHANVTGIPYKWTACSDVLIKNWRDSESSVLPIYKELIAAGLRIW  169

Query  402  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  223
            VFSGDTD+V+PVT+TR+S+  L L   + W PWY   QVGGWT+ Y GLTF  VRGAGHE
Sbjct  170  VFSGDTDSVVPVTATRFSLSHLNLTVKTRWYPWYSGNQVGGWTEAYNGLTFATVRGAGHE  229

Query  222  VALHRPKLALTLVESFLAGTSMP  154
            V L +P+ A  L  SF+AG  +P
Sbjct  230  VPLFQPRRAFILFRSFVAGKELP  252



>ref|XP_008394313.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 24-like 
[Malus domestica]
Length=472

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 7/203 (3%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTE  583
            +C+  ++ A+D + GDID YSI+T  C    +   R L+ ++    LLRR    YDPCTE
Sbjct  270  QCDDAINYATDHDFGDIDPYSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPCTE  326

Query  582  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  403
             ++  Y+N P+VQKA+H + T   ++W  CSD +Y++W D   +VL  Y+ELI AGLRIW
Sbjct  327  NYAEKYYNRPDVQKAMHANVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIW  386

Query  402  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  223
            VFSGDTD+V+PVT+TR+S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHE
Sbjct  387  VFSGDTDSVVPVTATRFSLNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHE  446

Query  222  VALHRPKLALTLVESFLAGTSMP  154
            V L + +  LTL +SFLAG  +P
Sbjct  447  VPLIQAERGLTLFKSFLAGKKLP  469



>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-ii, 
With The Microbial Peptide Aldehyde Inhibitor, Antipain, 
And Arginine At Room Temperature
 pdb|1BCS|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, 
With The Microbial Peptide Aldehyde Inhibitor, Chymostatin, 
And Arginine At 100 Degrees Kelvin
 prf||1408164B CPase II B
Length=160

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  600  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  424
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  4    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  63

Query  423  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  244
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  64   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  123

Query  243  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  151
            VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  124  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  154



>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  600  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  424
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  423  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  244
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  243  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  151
            VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase 
Ii At 2.2- Angstroms Resolution
Length=152

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  600  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  424
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  423  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  244
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  243  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  151
            VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  600  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  424
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  423  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  244
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  243  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  151
            VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>ref|XP_009358427.1| PREDICTED: serine carboxypeptidase 24 [Pyrus x bretschneideri]
Length=472

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 138/206 (67%), Gaps = 7/206 (3%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTE  583
            +C   ++ A+D + GDID YSI+T  C    +   R L+ ++    LLRR    YDPCTE
Sbjct  270  QCEDAINYATDHDFGDIDPYSIYTPFCLTMLNNRKRHLRLKNT---LLRRRASGYDPCTE  326

Query  582  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  403
             ++  Y+N P+VQKA+H + T   ++W  CSD ++ +WKD   +VL  Y+ELI AGLRIW
Sbjct  327  NYAEKYYNRPDVQKAMHANVTRIPYKWTACSDVLFKYWKDSEYSVLPTYKELIAAGLRIW  386

Query  402  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  223
            VFSGDTD+V+PVT+TR S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHE
Sbjct  387  VFSGDTDSVVPVTATRLSLNHLNLTIKTPWYPWYSGSQVGGWTEVYDGLTFATVRGAGHE  446

Query  222  VALHRPKLALTLVESFLAGTSMPGLQ  145
            V L + +  LTL +SFLAG  +P L 
Sbjct  447  VPLIQAERGLTLFKSFLAGKKLPKLN  472



>ref|XP_010656616.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Vitis vinifera]
Length=381

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 135/202 (67%), Gaps = 4/202 (2%)
 Frame = -2

Query  750  ECNKVLDTA-SDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTER  580
            +C++ +  A + E GDID YSI+T +C  +    S +   R +   + RR+  YDPCTE 
Sbjct  176  KCDEAVSYAINHEFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNSLVRRRVSGYDPCTEN  234

Query  579  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  400
            ++  Y+N P+VQKA+H ++T   ++W  CS  +  +W D   ++L +Y+ELI AGLRIWV
Sbjct  235  YAEKYYNRPDVQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWV  294

Query  399  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  220
            FSGDTDAV+PVT+TR+S++ L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGHEV
Sbjct  295  FSGDTDAVVPVTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEV  354

Query  219  ALHRPKLALTLVESFLAGTSMP  154
             L +P  A  L  SFL G  +P
Sbjct  355  PLFQPMRAFLLFRSFLGGKQLP  376



>ref|XP_010265560.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 135/202 (67%), Gaps = 6/202 (3%)
 Frame = -2

Query  750  ECNKVLDTA-SDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIY--DPCTER  580
            +C+K ++ A + E GDID YSI+T  C  S +    +   R +   L RR+Y  DPCTE 
Sbjct  225  KCDKAINYALNHEFGDIDQYSIYTPICKASKNTTRSI---RLKNTLLHRRVYGYDPCTEN  281

Query  579  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  400
            ++  Y+N P+VQKA+H + T   + W  CSD +   WKD   ++L  Y+EL+  GLRIWV
Sbjct  282  YAEKYYNRPDVQKAMHANATGIPYRWTACSDFLLKNWKDSQFSMLPTYKELMEGGLRIWV  341

Query  399  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  220
            FSGDTD+V+PVT+TR+S++ L L   + W PWY  GQVGGWT+ YEGLTF  VRGAGHEV
Sbjct  342  FSGDTDSVVPVTATRFSLNHLNLTVKTRWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEV  401

Query  219  ALHRPKLALTLVESFLAGTSMP  154
             L +P+ ALTL  SFLAG  +P
Sbjct  402  PLFQPERALTLFRSFLAGAELP  423



>gb|KFK29637.1| hypothetical protein AALP_AA7G159500 [Arabis alpina]
Length=462

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 135/215 (63%), Gaps = 19/215 (9%)
 Frame = -2

Query  750  ECNKVLDTASD------------ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLR  607
             CN   DTASD            E GDID YSI+T TC  S +     ++ ++    LLR
Sbjct  248  HCNFTADTASDGCDTAVNYAMNHEFGDIDQYSIYTPTCMASKNKTGFYVRMKNT---LLR  304

Query  606  RI----YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDV  439
            R     YDPCTE ++  Y+N P+VQ+A+H + T   ++W  CSD +   WKD   T+L V
Sbjct  305  RRLVSGYDPCTESYAEKYYNRPDVQRAMHANVTGIRYKWTACSDVMIKNWKDSDKTMLPV  364

Query  438  YQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEG  259
            Y+EL   G+RIW+FSGDTD+V+PVT+TR+S+  L LP  + W PWY   QVGGWT+ Y+G
Sbjct  365  YKELAATGMRIWIFSGDTDSVVPVTATRFSLSHLNLPVKTRWYPWYSGNQVGGWTEVYKG  424

Query  258  LTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  154
            LTF  VRGAGHEV L  PK AL L +SFLAG  +P
Sbjct  425  LTFATVRGAGHEVPLFEPKRALILFQSFLAGKELP  459



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 135/202 (67%), Gaps = 6/202 (3%)
 Frame = -2

Query  750  ECNKVLDTA-SDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIY--DPCTER  580
            +C+K ++ A + E GDID YSI+T  C  S +    +   R +   L RR+Y  DPCTE 
Sbjct  256  KCDKAINYALNHEFGDIDQYSIYTPICKASKNTTRSI---RLKNTLLHRRVYGYDPCTEN  312

Query  579  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  400
            ++  Y+N P+VQKA+H + T   + W  CSD +   WKD   ++L  Y+EL+  GLRIWV
Sbjct  313  YAEKYYNRPDVQKAMHANATGIPYRWTACSDFLLKNWKDSQFSMLPTYKELMEGGLRIWV  372

Query  399  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  220
            FSGDTD+V+PVT+TR+S++ L L   + W PWY  GQVGGWT+ YEGLTF  VRGAGHEV
Sbjct  373  FSGDTDSVVPVTATRFSLNHLNLTVKTRWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEV  432

Query  219  ALHRPKLALTLVESFLAGTSMP  154
             L +P+ ALTL  SFLAG  +P
Sbjct  433  PLFQPERALTLFRSFLAGAELP  454



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 133/200 (67%), Gaps = 3/200 (2%)
 Frame = -2

Query  750  ECNKVLDTASD-ELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
            +C+  ++ A + E GDID YSI+T  C    +  +R L  R +   L RR YDPC+E ++
Sbjct  270  QCDDAVNYAMNYEFGDIDQYSIYTPFCLTQITNSARNL--RLKNTLLCRRGYDPCSENYA  327

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
              Y+N P+VQKA+H + T   ++W  CSD +   W D   ++L  Y+EL+ AGL+IWVFS
Sbjct  328  EKYYNRPDVQKAMHANITKIPYKWTACSDTLIKNWNDSEDSMLPTYKELMAAGLKIWVFS  387

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TR+S+  L L   +PW PWY  GQVGGWT+ Y GLTF  +RGAGHEV L
Sbjct  388  GDTDSVVPVTATRFSLSHLNLTIKTPWYPWYTGGQVGGWTEVYHGLTFATIRGAGHEVPL  447

Query  213  HRPKLALTLVESFLAGTSMP  154
             +PK A  L +SFLAG  +P
Sbjct  448  FQPKRAFVLFQSFLAGKQLP  467



>emb|CAN79972.1| hypothetical protein VITISV_010072 [Vitis vinifera]
Length=434

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 135/202 (67%), Gaps = 4/202 (2%)
 Frame = -2

Query  750  ECNKVLDTA-SDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTER  580
            +C++ +  A + E GDID YSI+T +C  +    S +   R +   + RR+  YDPCTE 
Sbjct  229  KCDEAVSYAVNHEFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNSLVRRRVSGYDPCTEN  287

Query  579  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  400
            ++  Y+N P+VQKA+H ++T   ++W  CS  +  +W D   ++L +Y+ELI AGLRIWV
Sbjct  288  YAEKYYNRPDVQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWV  347

Query  399  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  220
            FSGDTDAV+PVT+TR+S++ L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGHEV
Sbjct  348  FSGDTDAVVPVTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEV  407

Query  219  ALHRPKLALTLVESFLAGTSMP  154
             L +P  A  L  SFL G  +P
Sbjct  408  PLFQPMRAFHLFRSFLGGKQLP  429



>ref|XP_010942076.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Elaeis guineensis]
Length=363

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 133/200 (67%), Gaps = 1/200 (1%)
 Frame = -2

Query  750  ECNKVLDTA-SDELGDIDTYSIFTXTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHS  574
             C+ V++ A S E GDID YSI+T +CT       R L+ ++  +      YDPCTE ++
Sbjct  162  SCDHVINYAVSHEFGDIDQYSIYTPSCTAPNFTAPRSLRLKNTLIRRRSYGYDPCTENYA  221

Query  573  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  394
              Y+N P+VQ+A+H +TT+  ++W  CSD +   W D   ++L  Y+ELI AGLRIWVFS
Sbjct  222  EKYYNRPDVQEAMHANTTSIPYKWTACSDLLLKTWGDSELSMLPTYKELIRAGLRIWVFS  281

Query  393  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  214
            GDTD+V+PVT+TR+SI+ L L    PW PWY   QV GWT+ YEGLTF  VRGAGHEV L
Sbjct  282  GDTDSVVPVTATRFSINHLNLTVNIPWYPWYIGRQVAGWTEVYEGLTFAIVRGAGHEVPL  341

Query  213  HRPKLALTLVESFLAGTSMP  154
             +P+ A  L +SFLAG  +P
Sbjct  342  LQPRRAFRLFQSFLAGKPLP  361



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840