BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002D22

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009778293.1|  PREDICTED: CASP-like protein 2B1                   278   1e-90   Nicotiana sylvestris
gb|EYU27670.1|  hypothetical protein MIMGU_mgv1a013955mg                278   2e-90   Erythranthe guttata [common monkey flower]
emb|CDP04507.1|  unnamed protein product                                272   3e-88   Coffea canephora [robusta coffee]
ref|XP_004250287.1|  PREDICTED: CASP-like protein 2B1                   271   4e-88   Solanum lycopersicum
ref|XP_006365844.1|  PREDICTED: CASP-like protein GSVIVT000135020...    271   1e-87   Solanum tuberosum [potatoes]
ref|XP_006467305.1|  PREDICTED: CASP-like protein POPTRDRAFT_8189...    270   1e-87   Citrus sinensis [apfelsine]
ref|XP_006352330.1|  PREDICTED: CASP-like protein RCOM_0864260-like     270   1e-87   Solanum tuberosum [potatoes]
ref|XP_009627397.1|  PREDICTED: CASP-like protein 2B1                   270   2e-87   Nicotiana tomentosiformis
ref|XP_009592222.1|  PREDICTED: CASP-like protein 2B1                   270   3e-87   Nicotiana tomentosiformis
ref|XP_009789786.1|  PREDICTED: CASP-like protein 2B1                   269   4e-87   Nicotiana sylvestris
ref|XP_004239817.1|  PREDICTED: CASP-like protein 2B1                   269   6e-87   Solanum lycopersicum
ref|XP_002522908.1|  conserved hypothetical protein                     267   2e-86   Ricinus communis
ref|XP_006449900.1|  hypothetical protein CICLE_v10016754mg             265   1e-85   Citrus clementina [clementine]
sp|A7R385.1|CSPLC_VITVI  RecName: Full=CASP-like protein 2B1; Sho...    265   2e-85   Vitis vinifera
ref|XP_011095935.1|  PREDICTED: CASP-like protein 2B1                   265   2e-85   Sesamum indicum [beniseed]
ref|XP_011086255.1|  PREDICTED: CASP-like protein 2B1                   263   1e-84   Sesamum indicum [beniseed]
ref|XP_002307903.1|  integral membrane family protein                   260   1e-83   Populus trichocarpa [western balsam poplar]
gb|EYU33843.1|  hypothetical protein MIMGU_mgv1a024377mg                259   2e-83   Erythranthe guttata [common monkey flower]
ref|XP_011004511.1|  PREDICTED: CASP-like protein 2B2                   258   8e-83   Populus euphratica
ref|XP_008227444.1|  PREDICTED: CASP-like protein RCOM_0864260          258   2e-82   Prunus mume [ume]
ref|XP_011040245.1|  PREDICTED: CASP-like protein 2B1                   256   4e-82   Populus euphratica
gb|KDP29302.1|  hypothetical protein JCGZ_19405                         255   1e-81   Jatropha curcas
ref|XP_007212067.1|  hypothetical protein PRUPE_ppa011591mg             255   1e-81   Prunus persica
ref|XP_002323133.1|  hypothetical protein POPTR_0016s01010g             253   5e-81   Populus trichocarpa [western balsam poplar]
gb|AGE09573.1|  UPF-like protein                                        250   8e-80   Eucalyptus cladocalyx
ref|XP_010052948.1|  PREDICTED: CASP-like protein 2B1                   248   6e-79   Eucalyptus grandis [rose gum]
ref|XP_007026314.1|  CASP-like protein POPTRDRAFT_818956 isoform 1      247   2e-78   
gb|KJB67396.1|  hypothetical protein B456_010G188700                    247   2e-78   Gossypium raimondii
ref|XP_003534893.1|  PREDICTED: CASP-like protein GSVIVT000135020...    247   2e-78   Glycine max [soybeans]
gb|KHN40811.1|  CASP-like protein                                       245   8e-78   Glycine soja [wild soybean]
ref|XP_010540841.1|  PREDICTED: CASP-like protein 2B1                   245   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_003547283.1|  PREDICTED: CASP-like protein RCOM_0864260-like     245   1e-77   Glycine max [soybeans]
ref|XP_010087633.1|  hypothetical protein L484_010584                   244   2e-77   Morus notabilis
ref|XP_010270196.1|  PREDICTED: CASP-like protein 2B1                   244   3e-77   Nelumbo nucifera [Indian lotus]
gb|KHG12114.1|  CASP-like protein                                       245   8e-77   Gossypium arboreum [tree cotton]
ref|XP_009346047.1|  PREDICTED: CASP-like protein RCOM_0864260          241   3e-76   Pyrus x bretschneideri [bai li]
gb|KJB69167.1|  hypothetical protein B456_011G008900                    241   4e-76   Gossypium raimondii
ref|XP_003549509.1|  PREDICTED: CASP-like protein RCOM_0864260-like     239   1e-75   Glycine max [soybeans]
ref|XP_003529670.1|  PREDICTED: CASP-like protein RCOM_0864260-like     239   2e-75   Glycine max [soybeans]
ref|XP_008384165.1|  PREDICTED: CASP-like protein RCOM_0864260 is...    238   6e-75   
ref|XP_006410744.1|  hypothetical protein EUTSA_v10017259mg             237   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_004486332.1|  PREDICTED: CASP-like protein POPTRDRAFT_5759...    236   2e-74   Cicer arietinum [garbanzo]
gb|KHN32948.1|  CASP-like protein                                       236   4e-74   Glycine soja [wild soybean]
ref|XP_008370988.1|  PREDICTED: CASP-like protein RCOM_0864260          235   7e-74   Malus domestica [apple tree]
ref|XP_010909399.1|  PREDICTED: CASP-like protein 2B1                   235   8e-74   Elaeis guineensis
ref|XP_010252724.1|  PREDICTED: CASP-like protein 2B1                   234   1e-73   
ref|XP_003594276.1|  hypothetical protein MTR_2g026530                  234   2e-73   Medicago truncatula
ref|XP_007154032.1|  hypothetical protein PHAVU_003G085300g             234   3e-73   Phaseolus vulgaris [French bean]
ref|XP_009133041.1|  PREDICTED: CASP-like protein 1                     230   9e-72   Brassica rapa
gb|EPS67628.1|  hypothetical protein M569_07146                         229   3e-71   Genlisea aurea
gb|KEH36968.1|  CASP POPTRDRAFT-like protein                            226   1e-70   Medicago truncatula
gb|KFK36471.1|  hypothetical protein AALP_AA4G129000                    226   2e-70   Arabis alpina [alpine rockcress]
ref|NP_565822.1|  CASP-like protein                                     225   5e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69773.1|  BnaAnng31470D                                          225   6e-70   Brassica napus [oilseed rape]
gb|AAM66995.1|  unknown                                                 224   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141516.1|  PREDICTED: CASP-like protein 1                     223   3e-69   Brassica rapa
ref|XP_010686644.1|  PREDICTED: CASP-like protein 2B1                   223   5e-69   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY71930.1|  BnaCnng75140D                                          221   2e-68   Brassica napus [oilseed rape]
emb|CDX79621.1|  BnaC03g19570D                                          219   1e-67   
emb|CDY40441.1|  BnaA04g20760D                                          218   2e-67   Brassica napus [oilseed rape]
ref|XP_007147633.1|  hypothetical protein PHAVU_006G141200g             217   5e-67   Phaseolus vulgaris [French bean]
ref|XP_002879572.1|  integral membrane family protein                   216   2e-66   
gb|KFK26539.1|  hypothetical protein AALP_AA8G262200                    212   6e-65   Arabis alpina [alpine rockcress]
ref|XP_009407837.1|  PREDICTED: CASP-like protein 2B1                   212   9e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006295017.1|  hypothetical protein CARUB_v10024089mg             212   1e-64   
ref|XP_010907052.1|  PREDICTED: CASP-like protein 2B1                   208   3e-63   Elaeis guineensis
ref|XP_008800613.1|  PREDICTED: CASP-like protein GSVIVT00013502001     207   5e-63   Phoenix dactylifera
ref|XP_009414753.1|  PREDICTED: CASP-like protein 2B1                   207   7e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008463603.1|  PREDICTED: CASP-like protein RCOM_0864260          206   3e-62   Cucumis melo [Oriental melon]
ref|XP_010509564.1|  PREDICTED: CASP-like protein 2B2                   202   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_004139530.1|  PREDICTED: CASP-like protein GSVIVT000135020...    202   5e-61   Cucumis sativus [cucumbers]
ref|XP_004293384.1|  PREDICTED: CASP-like protein 2B1                   202   8e-61   Fragaria vesca subsp. vesca
ref|XP_006849031.1|  hypothetical protein AMTR_s00028p00153320          201   2e-60   Amborella trichopoda
ref|XP_002868133.1|  integral membrane family protein                   200   3e-60   Arabidopsis lyrata subsp. lyrata
ref|NP_567497.1|  uncharacterized protein                               199   5e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505095.1|  PREDICTED: CASP-like protein 2B2                   197   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010516779.1|  PREDICTED: CASP-like protein 2B2                   194   3e-58   Camelina sativa [gold-of-pleasure]
emb|CDX90524.1|  BnaA03g42570D                                          190   4e-56   
ref|XP_009124526.1|  PREDICTED: CASP-like protein ARALYDRAFT_915107     189   5e-56   Brassica rapa
ref|XP_009136766.1|  PREDICTED: CASP-like protein ARALYDRAFT_915107     188   2e-55   Brassica rapa
emb|CDY70521.1|  BnaCnng68730D                                          186   9e-55   Brassica napus [oilseed rape]
emb|CDY34471.1|  BnaC01g21620D                                          184   1e-53   Brassica napus [oilseed rape]
emb|CDY32244.1|  BnaA01g17400D                                          183   1e-53   Brassica napus [oilseed rape]
ref|XP_009145991.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...    183   2e-53   
emb|CDY71889.1|  BnaAnng39180D                                          181   4e-53   Brassica napus [oilseed rape]
emb|CDY09694.1|  BnaC07g33670D                                          181   2e-52   Brassica napus [oilseed rape]
ref|XP_008791870.1|  PREDICTED: CASP-like protein RCOM_0864260          178   7e-52   Phoenix dactylifera
ref|XP_006414349.1|  hypothetical protein EUTSA_v10026264mg             179   1e-51   Eutrema salsugineum [saltwater cress]
ref|XP_010917254.1|  PREDICTED: CASP-like protein 2B1                   177   2e-51   Elaeis guineensis
ref|XP_010440155.1|  PREDICTED: CASP-like protein 2B1                   177   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010434824.1|  PREDICTED: CASP-like protein 2B1                   176   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010647129.1|  PREDICTED: CASP-like protein 2B1                   176   8e-51   
ref|XP_010449792.1|  PREDICTED: CASP-like protein 2B1                   175   1e-50   Camelina sativa [gold-of-pleasure]
sp|B8LQF9.1|CSPL9_PICSI  RecName: Full=CASP-like protein 2BC2; Sh...    175   8e-50   Picea sitchensis
ref|XP_006284611.1|  hypothetical protein CARUB_v10005842mg             172   1e-49   Capsella rubella
gb|KJB67397.1|  hypothetical protein B456_010G188700                    167   2e-48   Gossypium raimondii
gb|EMT22476.1|  hypothetical protein F775_11012                         172   4e-48   
ref|XP_009374906.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...    166   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_008384166.1|  PREDICTED: CASP-like protein GSVIVT000135020...    164   8e-47   
emb|CAB10420.1|  LET1 like protein                                      170   2e-45   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK05387.1|  predicted protein                                      159   2e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU18779.1|  unknown                                                 155   2e-43   Glycine max [soybeans]
ref|XP_003558594.1|  PREDICTED: CASP-like protein 2U2                   154   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_004985347.1|  PREDICTED: CASP-like protein Sb01g044070-like      149   2e-40   Setaria italica
ref|XP_002468338.1|  hypothetical protein SORBIDRAFT_01g044070          148   6e-40   Sorghum bicolor [broomcorn]
dbj|BAJ91438.1|  predicted protein                                      147   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05801.1|  predicted protein                                      147   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA43987.1|  TPA: hypothetical protein ZEAMMB73_493857              142   7e-38   
ref|XP_003575478.2|  PREDICTED: CASP-like protein 2B1                   127   7e-32   Brachypodium distachyon [annual false brome]
ref|XP_002443261.1|  hypothetical protein SORBIDRAFT_08g016550          125   2e-31   Sorghum bicolor [broomcorn]
sp|D5A8E6.1|CSPL4_PICSI  RecName: Full=CASP-like protein 2BC1; Sh...    120   4e-29   Picea sitchensis
ref|XP_004162507.1|  PREDICTED: CASP-like protein GSVIVT000135020...    115   2e-28   
ref|XP_004162506.1|  PREDICTED: CASP-like protein GSVIVT000135020...    115   2e-28   
gb|EPS70050.1|  hypothetical protein M569_04716                         114   5e-28   Genlisea aurea
sp|Q0IN16.2|CSPLE_ORYSJ  RecName: Full=CASP-like protein 2B1; Sho...    116   6e-28   Oryza sativa Japonica Group [Japonica rice]
sp|Q10QH3.2|CSPLL_ORYSJ  RecName: Full=CASP-like protein Os03g019...    113   8e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008777752.1|  PREDICTED: CASP-like protein GSVIVT00013502001     103   2e-24   
dbj|BAJ98184.1|  predicted protein                                      101   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001159013.1|  membrane protein                                   102   1e-22   
ref|XP_006651131.1|  PREDICTED: CASP-like protein Os03g0196400-like     100   5e-22   
ref|XP_007026315.1|  CASP-like protein POPTRDRAFT_818956 isoform 2    94.7    6e-22   
ref|XP_004962893.1|  PREDICTED: CASP-like protein Sb08g016550-like      100   8e-22   Setaria italica
gb|KDP36414.1|  hypothetical protein JCGZ_08683                       99.4    9e-22   Jatropha curcas
gb|KJB53802.1|  hypothetical protein B456_009G006000                  99.0    1e-21   Gossypium raimondii
sp|B9IM09.2|CSPLG_POPTR  RecName: Full=CASP-like protein 2C1; Sho...  99.0    1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_007014187.1|  CASP-like protein XL3                            98.2    2e-21   
ref|XP_008800283.1|  PREDICTED: CASP-like protein Os06g0656300        97.8    3e-21   Phoenix dactylifera
emb|CDY68034.1|  BnaCnng57380D                                        95.9    7e-21   Brassica napus [oilseed rape]
ref|XP_010913647.1|  PREDICTED: CASP-like protein 2C1 isoform X1      95.9    1e-20   Elaeis guineensis
gb|KHF98180.1|  CASP-like protein XL3                                 95.1    4e-20   Gossypium arboreum [tree cotton]
ref|XP_010260176.1|  PREDICTED: CASP-like protein XL3                 94.7    5e-20   
sp|Q5K4H9.1|CSPL2_GOSHI  RecName: Full=CASP-like protein XL3; Alt...  92.8    3e-19   Gossypium hirsutum [American cotton]
ref|NP_001142330.1|  CASP-like protein 2U1                            92.4    3e-19   Zea mays [maize]
ref|XP_011043990.1|  PREDICTED: CASP-like protein 2C1                 91.7    5e-19   Populus euphratica
gb|ABF94455.1|  plant integral membrane protein TIGR01569 contain...  92.0    1e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EYU42435.1|  hypothetical protein MIMGU_mgv1a014854mg              90.9    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_011069901.1|  PREDICTED: CASP-like protein 2C1 isoform X2      90.1    2e-18   Sesamum indicum [beniseed]
ref|XP_010265455.1|  PREDICTED: CASP-like protein 2C1                 90.1    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_007223970.1|  hypothetical protein PRUPE_ppa014614mg           88.6    8e-18   
ref|XP_004163465.1|  PREDICTED: CASP-like protein RCOM_0864260-li...  85.5    1e-17   
emb|CDX94411.1|  BnaC01g17730D                                        88.2    1e-17   
ref|XP_009139582.1|  PREDICTED: CASP-like protein ARALYDRAFT_657503   86.3    4e-17   Brassica rapa
ref|XP_011069900.1|  PREDICTED: CASP-like protein 2C1 isoform X1      86.3    5e-17   Sesamum indicum [beniseed]
ref|XP_009396107.1|  PREDICTED: CASP-like protein 2C1                 86.3    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008223711.1|  PREDICTED: CASP-like protein POPTRDRAFT_578614   85.1    1e-16   Prunus mume [ume]
ref|XP_009396704.1|  PREDICTED: CASP-like protein 2C1                 85.1    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010046989.1|  PREDICTED: CASP-like protein 2C1                 84.7    2e-16   Eucalyptus grandis [rose gum]
ref|XP_002869651.1|  predicted protein                                84.0    3e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010433586.1|  PREDICTED: CASP-like protein 2C1                 83.6    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010448363.1|  PREDICTED: CASP-like protein 2C1                 83.2    6e-16   Camelina sativa [gold-of-pleasure]
emb|CDP02964.1|  unnamed protein product                              82.4    8e-16   Coffea canephora [robusta coffee]
ref|XP_004149074.1|  PREDICTED: CASP-like protein POPTRDRAFT_5786...  81.6    2e-15   Cucumis sativus [cucumbers]
ref|XP_009341031.1|  PREDICTED: CASP-like protein POPTRDRAFT_578614   81.6    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_010438829.1|  PREDICTED: CASP-like protein 2C1                 80.9    3e-15   Camelina sativa [gold-of-pleasure]
dbj|BAF00509.1|  hypothetical protein                                 78.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006453396.1|  hypothetical protein CICLE_v10009662mg           80.9    3e-15   Citrus clementina [clementine]
gb|KDO46523.1|  hypothetical protein CISIN_1g030313mg                 80.9    4e-15   Citrus sinensis [apfelsine]
ref|XP_006282730.1|  hypothetical protein CARUB_v10005865mg           80.9    4e-15   Capsella rubella
ref|NP_567729.1|  uncharacterized protein                             79.3    1e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49469.1|  BnaCnng17350D                                        79.3    1e-14   Brassica napus [oilseed rape]
ref|XP_004242688.1|  PREDICTED: CASP-like protein 2C1                 77.0    9e-14   Solanum lycopersicum
ref|XP_006413266.1|  hypothetical protein EUTSA_v10026381mg           76.6    1e-13   Eutrema salsugineum [saltwater cress]
gb|EEC69375.1|  hypothetical protein OsI_38510                        75.5    1e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001066880.1|  Os12g0514300                                     75.9    2e-13   
ref|XP_006366193.1|  PREDICTED: CASP-like protein VIT_11s0052g011...  76.3    2e-13   Solanum tuberosum [potatoes]
ref|XP_010545424.1|  PREDICTED: CASP-like protein 2C1                 75.9    2e-13   Tarenaya hassleriana [spider flower]
emb|CBI17818.3|  unnamed protein product                              76.3    2e-13   Vitis vinifera
gb|EEC69376.1|  hypothetical protein OsI_38511                        73.9    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_003553094.1|  PREDICTED: CASP-like protein 10-like             74.3    9e-13   Glycine max [soybeans]
ref|XP_006845610.1|  hypothetical protein AMTR_s00019p00209400        73.9    9e-13   Amborella trichopoda
ref|XP_003610149.1|  hypothetical protein MTR_4g128520                73.9    1e-12   
gb|EAY84708.1|  hypothetical protein OsI_06078                        73.9    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_007154779.1|  hypothetical protein PHAVU_003G147200g           73.6    1e-12   Phaseolus vulgaris [French bean]
ref|NP_001046070.1|  Os02g0177700                                     73.6    1e-12   
ref|XP_002989705.1|  hypothetical protein SELMODRAFT_272089           73.6    2e-12   Selaginella moellendorffii
emb|CAB39604.1|  putative mitochondrial protein                       76.6    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002991776.1|  hypothetical protein SELMODRAFT_272229           72.8    3e-12   Selaginella moellendorffii
sp|P0DH82.1|CSPL1_MARPO  RecName: Full=CASP-like protein 2U1; Sho...  72.8    4e-12   Marchantia polymorpha
ref|XP_002273403.2|  PREDICTED: CASP-like protein 2C1                 72.4    4e-12   Vitis vinifera
ref|NP_001237350.1|  CASP-like protein 2C1                            72.0    4e-12   Glycine max [soybeans]
gb|KHN22710.1|  CASP-like protein 3                                   72.0    5e-12   Glycine soja [wild soybean]
ref|XP_009798279.1|  PREDICTED: CASP-like protein 2C1                 71.6    7e-12   Nicotiana sylvestris
ref|XP_006855416.1|  hypothetical protein AMTR_s00057p00159510        71.2    9e-12   Amborella trichopoda
ref|XP_004507839.1|  PREDICTED: CASP-like protein 3-like isoform X1   71.2    9e-12   Cicer arietinum [garbanzo]
gb|AFK47158.1|  unknown                                               71.2    1e-11   Lotus japonicus
ref|XP_010691480.1|  PREDICTED: CASP-like protein 2C1                 70.9    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006657208.1|  PREDICTED: CASP-like protein Os06g0656300-like   70.9    1e-11   Oryza brachyantha
gb|KHN08760.1|  CASP-like protein 10                                  70.9    1e-11   Glycine soja [wild soybean]
ref|XP_010531897.1|  PREDICTED: CASP-like protein 2A1                 70.5    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_009783950.1|  PREDICTED: CASP-like protein 2A1                 70.1    2e-11   Nicotiana sylvestris
ref|XP_002276206.1|  PREDICTED: CASP-like protein 1E2                 69.7    3e-11   Vitis vinifera
dbj|BAJ84836.1|  predicted protein                                    69.7    4e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009611405.1|  PREDICTED: CASP-like protein 2C1                 69.7    6e-11   Nicotiana tomentosiformis
dbj|BAJ85571.1|  predicted protein                                    68.9    8e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT22680.1|  hypothetical protein F775_30108                       68.6    8e-11   
ref|XP_003549486.1|  PREDICTED: CASP-like protein 3-like              68.2    8e-11   Glycine max [soybeans]
ref|XP_002979076.1|  hypothetical protein SELMODRAFT_444075           71.2    1e-10   
ref|XP_003579514.1|  PREDICTED: CASP-like protein 2A1                 68.2    1e-10   Brachypodium distachyon [annual false brome]
ref|NP_001049263.2|  Os03g0196400                                     65.5    2e-10   
ref|XP_007141978.1|  hypothetical protein PHAVU_008G242000g           67.4    3e-10   Phaseolus vulgaris [French bean]
sp|P0DI24.1|CSPL3_PTEAA  RecName: Full=CASP-like protein 2U1; Sho...  67.0    3e-10   Pteridium aquilinum subsp. aquilinum
ref|XP_010062716.1|  PREDICTED: CASP-like protein 2A1                 67.0    3e-10   
ref|XP_002447595.1|  hypothetical protein SORBIDRAFT_06g005640        67.0    4e-10   Sorghum bicolor [broomcorn]
ref|NP_564017.1|  uncharacterized protein                             66.6    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503085.1|  PREDICTED: CASP-like protein 10-like             66.6    5e-10   Cicer arietinum [garbanzo]
ref|XP_010327104.1|  PREDICTED: CASP-like protein 2A1                 66.2    5e-10   Solanum lycopersicum
sp|D2KQI6.1|CSPL1_BETVM  RecName: Full=CASP-like protein Ni6; Alt...  66.2    5e-10   Beta vulgaris subsp. maritima [sea beet]
gb|KCW69848.1|  hypothetical protein EUGRSUZ_F03189                   66.6    5e-10   Eucalyptus grandis [rose gum]
gb|AAL36294.1|  unknown protein                                       66.2    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890211.1|  integral membrane family protein                 66.2    6e-10   
ref|XP_003600618.1|  hypothetical protein MTR_3g064310                66.2    7e-10   
gb|AES70869.2|  CASP POPTRDRAFT-like protein                          66.2    7e-10   Medicago truncatula
sp|P0DI21.1|CSPL2_OSMLA  RecName: Full=CASP-like protein 2U1; Sho...  65.5    8e-10   Osmunda lancea
ref|XP_011098144.1|  PREDICTED: CASP-like protein 2A1                 65.9    8e-10   Sesamum indicum [beniseed]
gb|KHN14990.1|  CASP-like protein 10                                  65.9    9e-10   Glycine soja [wild soybean]
ref|NP_001239767.1|  CASP-like protein 2A2                            65.5    1e-09   Glycine max [soybeans]
gb|EEC81102.1|  hypothetical protein OsI_23961                        65.5    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006304211.1|  hypothetical protein CARUB_v10010315mg           65.5    1e-09   Capsella rubella
ref|NP_001058251.1|  Os06g0656300                                     65.1    1e-09   
sp|P0DH61.1|CSPL6_SELML  RecName: Full=CASP-like protein 2U10; Sh...  65.5    1e-09   Selaginella moellendorffii
emb|CDX96785.1|  BnaA08g23280D                                        65.1    2e-09   
emb|CDX81811.1|  BnaC08g37900D                                        65.1    2e-09   
gb|KFK43914.1|  hypothetical protein AALP_AA1G190800                  65.1    2e-09   Arabis alpina [alpine rockcress]
emb|CDY48478.1|  BnaC05g13380D                                        65.1    2e-09   Brassica napus [oilseed rape]
ref|XP_011030770.1|  PREDICTED: CASP-like protein 2A1                 64.7    2e-09   Populus euphratica
sp|D8ST12.2|CSPL3_SELML  RecName: Full=CASP-like protein 2U11; Sh...  65.1    2e-09   Selaginella moellendorffii
ref|XP_006360011.1|  PREDICTED: CASP-like protein VIT_01s0010g018...  64.3    2e-09   Solanum tuberosum [potatoes]
gb|EPS73896.1|  hypothetical protein M569_00863                       63.9    3e-09   Genlisea aurea
ref|XP_002317605.1|  integral membrane family protein                 64.3    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_007022201.1|  CASP-like protein isoform 1                      64.3    3e-09   
ref|XP_002517919.1|  conserved hypothetical protein                   63.5    3e-09   Ricinus communis
ref|XP_004975109.1|  PREDICTED: CASP-like protein 6-like              64.3    3e-09   Setaria italica
ref|XP_006442224.1|  hypothetical protein CICLE_v10022266mg           63.9    4e-09   Citrus clementina [clementine]
ref|XP_009117714.1|  PREDICTED: CASP-like protein At1g17200           63.9    4e-09   Brassica rapa
sp|P0DH67.1|CSPL9_SELML  RecName: Full=CASP-like protein 2U1; Sho...  63.9    4e-09   Selaginella moellendorffii
sp|P0DH65.1|CSPL8_SELML  RecName: Full=CASP-like protein 2U2; Sho...  63.9    4e-09   Selaginella moellendorffii
dbj|BAJ89574.1|  predicted protein                                    63.9    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008451819.1|  PREDICTED: CASP-like protein F16                 63.9    4e-09   Cucumis melo [Oriental melon]
ref|XP_006465093.1|  PREDICTED: CASP-like protein POPTRDRAFT_5786...  62.4    4e-09   
ref|NP_001131228.1|  CASP-like protein 2A1                            63.9    4e-09   Zea mays [maize]
ref|XP_010476864.1|  PREDICTED: CASP-like protein 2A1                 63.9    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010498065.1|  PREDICTED: CASP-like protein 2A1                 63.5    5e-09   
ref|XP_010459293.1|  PREDICTED: CASP-like protein 2A1                 64.3    5e-09   Camelina sativa [gold-of-pleasure]
emb|CDO98909.1|  unnamed protein product                              63.2    7e-09   Coffea canephora [robusta coffee]
ref|XP_009149166.1|  PREDICTED: CASP-like protein At1g17200 isofo...  63.2    8e-09   Brassica rapa
emb|CDY26265.1|  BnaA06g11520D                                        63.2    8e-09   Brassica napus [oilseed rape]
emb|CDY21755.1|  BnaA09g45060D                                        63.2    8e-09   Brassica napus [oilseed rape]
gb|KJB12801.1|  hypothetical protein B456_002G037500                  63.2    9e-09   Gossypium raimondii
ref|XP_006366767.1|  PREDICTED: CASP-like protein VIT_01s0010g018...  62.8    1e-08   Solanum tuberosum [potatoes]
gb|AFK39780.1|  unknown                                               62.8    1e-08   Lotus japonicus
ref|XP_006416730.1|  hypothetical protein EUTSA_v10008792mg           62.8    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_011082822.1|  PREDICTED: CASP-like protein 2A1                 62.8    1e-08   Sesamum indicum [beniseed]
ref|XP_004147759.1|  PREDICTED: CASP-like protein F16-like            62.8    1e-08   Cucumis sativus [cucumbers]
ref|XP_002986549.1|  hypothetical protein SELMODRAFT_446616           63.9    1e-08   
ref|XP_004490772.1|  PREDICTED: CASP-like protein 10-like             62.8    1e-08   Cicer arietinum [garbanzo]
ref|XP_003616135.1|  hypothetical protein MTR_5g076480                62.4    1e-08   Medicago truncatula
gb|KHG06274.1|  CASP-like protein F16                                 62.4    2e-08   Gossypium arboreum [tree cotton]
emb|CDX83921.1|  BnaC08g17240D                                        62.0    2e-08   
gb|KDP40019.1|  hypothetical protein JCGZ_02017                       61.6    2e-08   Jatropha curcas
gb|KJB12800.1|  hypothetical protein B456_002G037500                  62.0    2e-08   Gossypium raimondii
sp|A2X2I0.1|CSPL9_ORYSI  RecName: Full=CASP-like protein 2D1; Sho...  61.6    2e-08   Oryza sativa Indica Group [Indian rice]
sp|Q6YW53.1|CSPL9_ORYSJ  RecName: Full=CASP-like protein 2D1; Sho...  61.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009790738.1|  PREDICTED: CASP-like protein 2A1                 61.6    2e-08   Nicotiana sylvestris
ref|NP_001174676.1|  Os06g0231050                                     61.6    2e-08   
emb|CAE05079.2|  OSJNBa0094P09.18                                     61.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KCW69847.1|  hypothetical protein EUGRSUZ_F03189                   62.0    3e-08   Eucalyptus grandis [rose gum]
ref|NP_001052366.1|  Os04g0281900                                     62.0    3e-08   
gb|EYU26260.1|  hypothetical protein MIMGU_mgv1a014927mg              61.2    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_002532825.1|  conserved hypothetical protein                   61.2    4e-08   Ricinus communis
ref|XP_010501875.1|  PREDICTED: CASP-like protein 2A2                 60.8    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002325065.1|  hypothetical protein POPTR_0018s10260g           59.7    4e-08   
sp|Q8W4Z5.1|CSPL1_GOSHI  RecName: Full=CASP-like protein F16; Alt...  60.8    5e-08   Gossypium hirsutum [American cotton]
ref|XP_010913648.1|  PREDICTED: CASP-like protein 2C1 isoform X2      59.7    7e-08   
ref|XP_002437393.1|  hypothetical protein SORBIDRAFT_10g026120        60.1    8e-08   Sorghum bicolor [broomcorn]
ref|XP_006655941.1|  PREDICTED: casparian strip membrane protein ...  60.1    8e-08   Oryza brachyantha
ref|XP_010666392.1|  PREDICTED: CASP-like protein Ni6                 60.1    8e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007022205.1|  CASP-like protein isoform 5                      60.1    9e-08   
ref|XP_011036232.1|  PREDICTED: CASP-like protein 2A2                 60.1    9e-08   Populus euphratica
emb|CAN63416.1|  hypothetical protein VITISV_007688                   60.1    9e-08   Vitis vinifera
ref|XP_009602689.1|  PREDICTED: CASP-like protein 2A1                 60.1    1e-07   
ref|XP_006342777.1|  PREDICTED: CASP-like protein 5-like              59.7    1e-07   
ref|XP_004951716.1|  PREDICTED: CASP-like protein 9-like              59.7    1e-07   
sp|A9NMM6.1|CSPL8_PICSI  RecName: Full=CASP-like protein 2A1; Sho...  59.7    1e-07   
ref|XP_010245909.1|  PREDICTED: casparian strip membrane protein ...  60.1    1e-07   
ref|XP_002300480.2|  hypothetical protein POPTR_0001s42730g           60.1    1e-07   
ref|XP_002993217.1|  hypothetical protein SELMODRAFT_431321           61.6    1e-07   
ref|XP_002279766.1|  PREDICTED: CASP-like protein 2D1                 59.3    1e-07   
ref|XP_004508310.1|  PREDICTED: CASP-like protein 7-like              59.3    2e-07   
ref|NP_001151672.1|  CASP-like protein 1D1                            59.7    2e-07   
ref|XP_008645310.1|  PREDICTED: CASP-like protein 9                   58.9    2e-07   
ref|XP_004956013.1|  PREDICTED: CASP-like protein Sb02g009660-like    58.9    2e-07   
ref|XP_004243226.1|  PREDICTED: CASP-like protein 2A1                 58.9    2e-07   
sp|P0DH63.1|CSPL7_SELML  RecName: Full=CASP-like protein 2U9; Sho...  58.9    3e-07   
ref|XP_004494327.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  58.2    3e-07   
ref|XP_010694843.1|  PREDICTED: CASP-like protein 2A1                 58.5    3e-07   
ref|XP_010111509.1|  hypothetical protein L484_021334                 58.9    4e-07   
gb|KDP24708.1|  hypothetical protein JCGZ_25699                       58.2    4e-07   
ref|XP_006289591.1|  hypothetical protein CARUB_v10003142mg           58.2    4e-07   
ref|XP_004965685.1|  PREDICTED: CASP-like protein 11-like             58.2    4e-07   
ref|XP_008652280.1|  PREDICTED: CASP-like protein 3                   58.2    4e-07   
ref|XP_010904772.1|  PREDICTED: CASP-like protein 1D1                 58.2    5e-07   
ref|XP_002516873.1|  conserved hypothetical protein                   58.2    5e-07   
ref|XP_008804521.1|  PREDICTED: CASP-like protein VIT_01s0010g01870   57.8    6e-07   
sp|A9P0A6.1|CSPL5_PICSI  RecName: Full=CASP-like protein 1U1; Sho...  58.2    6e-07   
ref|XP_010932312.1|  PREDICTED: CASP-like protein 2A1                 58.2    6e-07   
ref|XP_002275339.1|  PREDICTED: CASP-like protein 2A1                 58.2    6e-07   
tpg|DAA39419.1|  TPA: membrane protein 4                              57.8    6e-07   
sp|B6U8R7.1|CSPL9_MAIZE  RecName: Full=CASP-like protein 2C4; Sho...  57.4    6e-07   
ref|XP_010915912.1|  PREDICTED: CASP-like protein 1F2                 57.4    7e-07   
ref|XP_010249455.1|  PREDICTED: CASP-like protein 1F1                 56.6    7e-07   
ref|XP_007015764.1|  Casparian strip membrane protein 3, putative     57.8    8e-07   
ref|XP_010540119.1|  PREDICTED: CASP-like protein 2A1                 57.4    9e-07   
ref|XP_010271592.1|  PREDICTED: casparian strip membrane protein ...  57.8    9e-07   
ref|NP_001067249.1|  Os12g0610800                                     57.4    9e-07   
ref|XP_002453543.1|  hypothetical protein SORBIDRAFT_04g007720        57.0    9e-07   
ref|XP_011013658.1|  PREDICTED: CASP-like protein 2A2                 57.4    9e-07   
ref|XP_006407087.1|  hypothetical protein EUTSA_v10021621mg           57.0    1e-06   
ref|XP_002965801.1|  hypothetical protein SELMODRAFT_439258           58.9    1e-06   
ref|XP_006361147.1|  PREDICTED: casparian strip membrane protein ...  57.4    1e-06   
ref|NP_001239666.1|  CASP-like protein 1E1                            57.0    1e-06   
ref|XP_008799291.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   57.4    1e-06   
sp|A2ZMM4.1|CSPL5_ORYSI  RecName: Full=CASP-like protein 1B1; Sho...  57.0    1e-06   
ref|NP_567473.1|  uncharacterized protein                             57.0    1e-06   
ref|XP_003544956.1|  PREDICTED: CASP-like protein 11                  57.4    1e-06   
gb|EYU34055.1|  hypothetical protein MIMGU_mgv1a020210mg              56.6    1e-06   
gb|EEE53590.1|  hypothetical protein OsJ_36834                        57.8    1e-06   
ref|XP_009380719.1|  PREDICTED: CASP-like protein Os04g0281900        58.2    1e-06   
ref|XP_009630030.1|  PREDICTED: CASP-like protein 2A1                 56.2    2e-06   
gb|EAZ03696.1|  hypothetical protein OsI_25828                        57.0    2e-06   
ref|XP_010254228.1|  PREDICTED: CASP-like protein 2A1                 56.6    2e-06   
sp|C6SYW3.1|CSPLB_SOYBN  RecName: Full=CASP-like protein 2A1; Sho...  56.6    2e-06   
sp|A7R333.1|CSPLB_VITVI  RecName: Full=CASP-like protein 1C1; Sho...  55.8    2e-06   
gb|ABA99368.1|  plant integral membrane protein TIGR01569 contain...  57.4    2e-06   
ref|XP_009401544.1|  PREDICTED: CASP-like protein Os04g0281900        56.6    2e-06   
sp|D5A972.1|CSPL3_PICSI  RecName: Full=CASP-like protein 2A3; Sho...  55.8    2e-06   
ref|XP_004242111.1|  PREDICTED: casparian strip membrane protein ...  56.2    3e-06   
sp|P0DI20.1|CSPL1_OSMLA  RecName: Full=CASP-like protein 2U2; Sho...  56.2    3e-06   
ref|XP_007154229.1|  hypothetical protein PHAVU_003G101100g           55.8    3e-06   
ref|XP_004235355.1|  PREDICTED: CASP-like protein 1F1 isoform X1      55.5    3e-06   
gb|KFK29091.1|  hypothetical protein AALP_AA7G087700                  55.5    3e-06   
ref|NP_001059526.1|  Os07g0442900                                     55.8    3e-06   
ref|XP_007154230.1|  hypothetical protein PHAVU_003G101200g           55.8    4e-06   
gb|KFK38804.1|  hypothetical protein AALP_AA3G162100                  55.5    4e-06   
emb|CDY22743.1|  BnaA08g05730D                                        55.5    4e-06   
gb|AAM67044.1|  unknown                                               55.5    4e-06   
ref|XP_002523839.1|  conserved hypothetical protein                   55.8    4e-06   
ref|XP_009107849.1|  PREDICTED: CASP-like protein At4g15630           55.5    4e-06   
gb|EMT20234.1|  hypothetical protein F775_10059                       55.5    4e-06   
sp|P0DI25.1|CSPL4_PTEAA  RecName: Full=CASP-like protein 2U3; Sho...  55.1    4e-06   
sp|P0DI32.1|CASP1_TARKO  RecName: Full=Casparian strip membrane p...  55.5    5e-06   
ref|XP_006414479.1|  hypothetical protein EUTSA_v10026349mg           55.1    5e-06   
ref|XP_008663281.1|  PREDICTED: casparian strip membrane protein 2    55.1    5e-06   
ref|XP_007022202.1|  CASP-like protein, putative isoform 2            54.7    5e-06   
sp|D8SJ65.2|CSPL4_SELML  RecName: Full=CASP-like protein 2U4; Sho...  55.1    6e-06   
ref|XP_003571714.1|  PREDICTED: CASP-like protein 2D1                 54.7    6e-06   
gb|KCW78730.1|  hypothetical protein EUGRSUZ_C00172                   54.3    6e-06   
emb|CBI26107.3|  unnamed protein product                              53.9    6e-06   
ref|XP_006299393.1|  hypothetical protein CARUB_v10015553mg           54.7    6e-06   
ref|XP_002312755.2|  hypothetical protein POPTR_0008s20950g           55.1    6e-06   
ref|XP_006371562.1|  integral membrane family protein                 54.3    6e-06   
gb|EYU43016.1|  hypothetical protein MIMGU_mgv1a014654mg              54.7    7e-06   
ref|XP_009411946.1|  PREDICTED: casparian strip membrane protein ...  55.1    7e-06   
ref|XP_011081169.1|  PREDICTED: CASP-like protein 1                   55.1    7e-06   
gb|EPS69398.1|  hypothetical protein M569_05367                       54.3    8e-06   
ref|XP_010492362.1|  PREDICTED: casparian strip membrane protein ...  54.7    8e-06   
sp|D8QNV6.2|CSPL5_SELML  RecName: Full=CASP-like protein 2U3; Sho...  54.7    9e-06   
ref|XP_009146374.1|  PREDICTED: CASP-like protein ARALYDRAFT_478855   54.7    9e-06   
ref|XP_008808432.1|  PREDICTED: CASP-like protein VIT_19s0090g00570   54.3    9e-06   
ref|XP_009393394.1|  PREDICTED: casparian strip membrane protein ...  55.1    9e-06   
ref|XP_004229217.1|  PREDICTED: CASP-like protein 1E2                 54.3    1e-05   
ref|XP_008647966.1|  PREDICTED: CASP-like protein 13 isoform X1       54.3    1e-05   
ref|XP_011037328.1|  PREDICTED: CASP-like protein 1C3                 53.9    1e-05   
ref|XP_006360012.1|  PREDICTED: CASP-like protein VIT_01s0010g018...  53.5    1e-05   
sp|A7PJ32.1|CSPL2_VITVI  RecName: Full=CASP-like protein 1C2; Sho...  53.9    1e-05   
ref|XP_002272783.1|  PREDICTED: CASP-like protein 1C2                 53.9    1e-05   
ref|XP_003556790.1|  PREDICTED: CASP-like protein 2-like              54.3    1e-05   
ref|XP_004300689.1|  PREDICTED: CASP-like protein 2A1                 54.3    1e-05   
ref|XP_006653237.1|  PREDICTED: CASP-like protein Os04g0281900-like   53.5    1e-05   
ref|XP_010923854.1|  PREDICTED: CASP-like protein 2D1                 53.9    1e-05   
ref|XP_010453663.1|  PREDICTED: casparian strip membrane protein 5    53.9    1e-05   
sp|P0DI42.1|CASP2_WHEAT  RecName: Full=Casparian strip membrane p...  53.9    1e-05   
ref|XP_008237993.1|  PREDICTED: CASP-like protein VIT_01s0010g01870   54.3    1e-05   
ref|XP_004955209.1|  PREDICTED: casparian strip membrane protein ...  53.9    1e-05   
emb|CDY09075.1|  BnaC08g10290D                                        53.9    1e-05   
ref|XP_010420188.1|  PREDICTED: casparian strip membrane protein ...  53.9    2e-05   
ref|XP_002992808.1|  hypothetical protein SELMODRAFT_448915           55.5    2e-05   
ref|NP_001236009.1|  CASP-like protein 1E2                            53.9    2e-05   
gb|KJB38474.1|  hypothetical protein B456_006G257500                  53.9    2e-05   
gb|KDP34883.1|  hypothetical protein JCGZ_09171                       53.9    2e-05   
gb|KJB21715.1|  hypothetical protein B456_004G010900                  53.9    2e-05   
ref|XP_006844549.1|  hypothetical protein AMTR_s00016p00177260        53.5    2e-05   
ref|XP_002870226.1|  integral membrane family protein                 53.5    2e-05   
gb|KDP24131.1|  hypothetical protein JCGZ_25788                       53.1    2e-05   
ref|XP_002446616.1|  hypothetical protein SORBIDRAFT_06g018970        53.5    2e-05   
ref|XP_009419511.1|  PREDICTED: CASP-like protein MA4_106O17.52       53.9    2e-05   
ref|XP_010487237.1|  PREDICTED: CASP-like protein 2A2                 53.1    2e-05   
ref|XP_010241335.1|  PREDICTED: CASP-like protein 1D1                 53.5    2e-05   
sp|P0DI33.1|CASP1_PANVG  RecName: Full=Casparian strip membrane p...  53.1    2e-05   
ref|XP_006363994.1|  PREDICTED: CASP-like protein VIT_17s0000g005...  53.1    2e-05   
gb|KHN25032.1|  CASP-like protein 2                                   53.1    3e-05   
ref|XP_004965049.1|  PREDICTED: casparian strip membrane protein ...  52.8    3e-05   
sp|P0DH84.1|CSPL2_ADICA  RecName: Full=CASP-like protein 2U1; Sho...  53.1    3e-05   
ref|XP_009393233.1|  PREDICTED: CASP-like protein 5                   53.1    3e-05   
ref|XP_003542918.1|  PREDICTED: CASP-like protein 7-like isoform X1   52.8    3e-05   
ref|XP_003564046.1|  PREDICTED: casparian strip membrane protein 3    52.8    3e-05   
ref|XP_008799290.1|  PREDICTED: CASP-like protein MA4_106O17.52       53.1    3e-05   
gb|EAZ21949.1|  hypothetical protein OsJ_05601                        51.6    4e-05   
emb|CDX70605.1|  BnaC03g06890D                                        52.8    4e-05   
ref|XP_006376496.1|  integral membrane family protein                 52.4    4e-05   
ref|XP_002534086.1|  conserved hypothetical protein                   51.2    4e-05   
ref|XP_006648369.1|  PREDICTED: CASP-like protein Os02g0177700-like   52.4    4e-05   
ref|XP_002870224.1|  integral membrane family protein                 52.8    4e-05   
ref|XP_011098938.1|  PREDICTED: CASP-like protein 1F1                 52.8    4e-05   
ref|XP_010904767.1|  PREDICTED: CASP-like protein 1E1                 52.8    4e-05   
gb|ACN26856.1|  unknown                                               50.8    4e-05   
ref|XP_004486055.1|  PREDICTED: CASP-like protein 5-like              52.8    5e-05   
sp|Q1EPG7.1|CSPL1_MUSAC  RecName: Full=CASP-like protein 1E1; Sho...  52.8    5e-05   
ref|NP_001148957.1|  casparian strip membrane protein 1               52.4    5e-05   
sp|P0DI44.1|CASP1_SOLTU  RecName: Full=Casparian strip membrane p...  52.4    5e-05   
gb|EMT22194.1|  hypothetical protein F775_09434                       52.4    5e-05   
gb|KJB75708.1|  hypothetical protein B456_012G052700                  52.4    5e-05   
ref|XP_002268702.1|  PREDICTED: CASP-like protein 1E1                 52.8    5e-05   
ref|XP_008799972.1|  PREDICTED: CASP-like protein VIT_01s0010g01870   52.4    5e-05   
ref|XP_006363407.1|  PREDICTED: casparian strip membrane protein ...  52.4    6e-05   
ref|NP_197033.1|  casparian strip membrane protein 5                  52.4    6e-05   
emb|CDX90578.1|  BnaA03g42030D                                        52.4    6e-05   
sp|D7M7B3.2|CASP5_ARALL  RecName: Full=Casparian strip membrane p...  52.0    6e-05   
ref|XP_002461872.1|  hypothetical protein SORBIDRAFT_02g009660        52.4    6e-05   
ref|XP_010105027.1|  hypothetical protein L484_008468                 53.5    6e-05   
ref|XP_009136705.1|  PREDICTED: CASP-like protein At4g15630           52.4    6e-05   
ref|XP_006414480.1|  hypothetical protein EUTSA_v10026308mg           52.4    6e-05   
gb|AFK37802.1|  unknown                                               52.0    7e-05   
ref|XP_006400049.1|  hypothetical protein EUTSA_v10015485mg           52.0    7e-05   
ref|XP_006844548.1|  hypothetical protein AMTR_s00016p00176090        52.0    7e-05   
ref|XP_006431199.1|  hypothetical protein CICLE_v10013539mg           52.0    7e-05   
ref|XP_006284585.1|  hypothetical protein CARUB_v10005811mg           52.0    7e-05   
ref|XP_010465330.1|  PREDICTED: CASP-like protein 2A2                 51.6    7e-05   
ref|NP_001235823.1|  CASP-like protein 6                              52.0    7e-05   
ref|XP_002436759.1|  hypothetical protein SORBIDRAFT_10g008220        52.0    7e-05   
sp|P0DI62.1|CASP1_CYNCS  RecName: Full=Casparian strip membrane p...  52.4    8e-05   
ref|XP_006452385.1|  hypothetical protein CICLE_v10009601mg           52.0    8e-05   
gb|KHN12189.1|  CASP-like protein 1                                   51.6    8e-05   
ref|XP_006347352.1|  PREDICTED: CASP-like protein VIT_17s0000g005...  51.6    8e-05   
ref|XP_008458485.1|  PREDICTED: CASP-like protein 6 isoform X1        52.0    8e-05   
ref|XP_006467803.1|  PREDICTED: CASP-like protein POPTRDRAFT_8109...  51.2    8e-05   
gb|KDO75960.1|  hypothetical protein CISIN_1g047574mg                 51.2    9e-05   
emb|CDY09749.1|  BnaC07g33120D                                        51.6    9e-05   
gb|AFW85233.1|  membrane protein 2                                    51.6    9e-05   
ref|NP_001236648.1|  CASP-like protein 7                              51.6    9e-05   
ref|XP_002533365.1|  conserved hypothetical protein                   50.1    9e-05   
gb|KJB21732.1|  hypothetical protein B456_004G011000                  52.0    9e-05   
sp|A9P1V1.1|CSPL6_PICSI  RecName: Full=CASP-like protein 2A2; Sho...  51.6    9e-05   
ref|XP_010548920.1|  PREDICTED: CASP-like protein 1D1                 51.6    1e-04   
ref|XP_007153553.1|  hypothetical protein PHAVU_003G045200g           51.6    1e-04   
ref|XP_010440273.1|  PREDICTED: CASP-like protein 1E1                 51.6    1e-04   
emb|CBI27492.3|  unnamed protein product                              50.8    1e-04   
ref|XP_010904769.1|  PREDICTED: CASP-like protein 1E1                 51.6    1e-04   
ref|XP_004233369.1|  PREDICTED: casparian strip membrane protein 1    51.2    1e-04   
gb|AIC33063.1|  integral membrane family protein                      51.6    1e-04   
ref|XP_007147871.1|  hypothetical protein PHAVU_006G161900g           52.4    1e-04   
gb|EPS74593.1|  hypothetical protein M569_00163                       51.6    1e-04   
ref|XP_002325064.1|  integral membrane family protein                 49.7    1e-04   
ref|NP_001150865.1|  membrane protein                                 51.2    1e-04   
ref|XP_009789373.1|  PREDICTED: casparian strip membrane protein ...  51.6    1e-04   
ref|XP_004150813.1|  PREDICTED: CASP-like protein 6-like              51.2    1e-04   
ref|XP_009121585.1|  PREDICTED: casparian strip membrane protein ...  51.2    1e-04   
ref|XP_010941794.1|  PREDICTED: CASP-like protein 1E2                 51.6    1e-04   
gb|KDO72617.1|  hypothetical protein CISIN_1g045471mg                 51.2    1e-04   
ref|XP_006482625.1|  PREDICTED: casparian strip membrane protein ...  51.2    1e-04   
ref|XP_003626998.1|  hypothetical protein MTR_8g013900                51.2    1e-04   
ref|XP_010449916.1|  PREDICTED: CASP-like protein 1E1                 51.2    1e-04   
ref|XP_003625864.1|  hypothetical protein MTR_7g108130                51.2    1e-04   
ref|XP_009365707.1|  PREDICTED: CASP-like protein VIT_01s0010g01870   51.2    1e-04   
ref|XP_010258295.1|  PREDICTED: casparian strip membrane protein 3    51.2    1e-04   
gb|KHN33122.1|  CASP-like protein 6                                   51.2    1e-04   
ref|XP_009609007.1|  PREDICTED: casparian strip membrane protein ...  51.6    1e-04   
ref|XP_006665081.1|  PREDICTED: casparian strip membrane protein ...  51.2    1e-04   
dbj|BAJ88632.1|  predicted protein                                    50.8    2e-04   
gb|AFK37260.1|  unknown                                               50.8    2e-04   
ref|NP_567472.1|  uncharacterized protein                             50.8    2e-04   
ref|XP_007146967.1|  hypothetical protein PHAVU_006G085600g           50.4    2e-04   
ref|XP_010035749.1|  PREDICTED: CASP-like protein 1C1                 50.4    2e-04   
ref|XP_003546096.2|  PREDICTED: CASP-like protein 6-like              50.8    2e-04   
gb|AFK36571.1|  unknown                                               50.8    2e-04   
ref|NP_001140819.1|  CASP-like protein 2A2                            51.2    2e-04   
ref|XP_003571287.1|  PREDICTED: casparian strip membrane protein 2    51.2    2e-04   
ref|XP_010434939.1|  PREDICTED: CASP-like protein 1E1                 50.8    2e-04   
ref|XP_003566190.1|  PREDICTED: CASP-like protein 1C1-1               50.1    2e-04   
gb|KJB62069.1|  hypothetical protein B456_009G399600                  50.8    2e-04   
ref|XP_004170007.1|  PREDICTED: CASP-like protein F16-like            49.7    2e-04   
ref|XP_004975856.1|  PREDICTED: casparian strip membrane protein ...  50.4    2e-04   
gb|KHG13245.1|  CASP-like protein                                     49.3    2e-04   
ref|XP_007035489.1|  CASP-like protein RCOM_0679870, putative         50.4    2e-04   
sp|P0DI34.1|CASP2_PANVG  RecName: Full=Casparian strip membrane p...  50.4    2e-04   
emb|CDP06128.1|  unnamed protein product                              49.7    3e-04   
ref|XP_010672773.1|  PREDICTED: casparian strip membrane protein ...  50.4    3e-04   
ref|XP_002533115.1|  conserved hypothetical protein                   50.4    3e-04   
ref|XP_008438805.1|  PREDICTED: CASP-like protein 5                   50.4    3e-04   
ref|XP_009399244.1|  PREDICTED: CASP-like protein MA4_106O17.50       50.4    3e-04   
ref|XP_004968732.1|  PREDICTED: CASP-like protein Sb03g014480-like    51.2    3e-04   



>ref|XP_009778293.1| PREDICTED: CASP-like protein 2B1 [Nicotiana sylvestris]
Length=202

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 173/187 (93%), Gaps = 1/187 (1%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+ EL+ RCVICGLAI+GAVLIGTDSQV+ IFSI K AKFTDMKALV
Sbjct  16   YHGNNLKVIDRRVRVTELVLRCVICGLAILGAVLIGTDSQVKVIFSIEKIAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQLMAYL+L AVAAAAQS
Sbjct  76   FLVIANGLAAAYSLVQVLRCILSMIRGSVLFNKPLAWAIFSGDQLMAYLTLVAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN-  212
            AV+AK+GQ+ELQWM+IC+MYGKFCNQVGEGIASSLIV +SMI+L GISAFSLFRLYG+N 
Sbjct  136  AVFAKLGQTELQWMKICDMYGKFCNQVGEGIASSLIVSLSMIVLSGISAFSLFRLYGNNS  195

Query  211  KSKCNGR  191
            K K N R
Sbjct  196  KGKGNAR  202



>gb|EYU27670.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27671.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27672.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27673.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
Length=205

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS LKV+D RVRLAELI RCVICGLAI+ AVLIGTD+QVREIF+IRKKAKFTDMKALV
Sbjct  19   YHGSNLKVLDMRVRLAELILRCVICGLAILSAVLIGTDTQVREIFTIRKKAKFTDMKALV  78

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAW IFSGDQL+AYL+L AVAAAAQS
Sbjct  79   FLVIANGLAAAYSLVQILRCVLSMIRGTVLFNKPLAWVIFSGDQLIAYLTLAAVAAAAQS  138

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ ELQWM+ C++YGKFCNQ+GEG+AS++IVC+S ++L  ISAFSLFRLYGDNK
Sbjct  139  AVFAKLGQMELQWMKTCDLYGKFCNQIGEGVASAVIVCLSTVVLSAISAFSLFRLYGDNK  198

Query  208  SKCNG  194
             K +G
Sbjct  199  EKSSG  203



>emb|CDP04507.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   272 bits (696),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS LKVVD+RVR+AEL+ RC+ICGLA++ AVLIGTD+QV+EIF+I+K+AKFT+MKALV
Sbjct  16   YHGSNLKVVDRRVRIAELVLRCLICGLAVLAAVLIGTDTQVKEIFTIKKEAKFTEMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVI  G+AAAYS VQ++RC  SMIRG+VLFNKPLAWAIFSGDQLMAYLSL AVAAAAQS
Sbjct  76   FLVITTGIAAAYSFVQVLRCITSMIRGNVLFNKPLAWAIFSGDQLMAYLSLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ+ELQWM+ICNMYGK+CNQVGEGIAS+L+V +SM++L GISAFSLFRLYG+NK
Sbjct  136  AVFAKLGQTELQWMKICNMYGKYCNQVGEGIASALMVSLSMVVLSGISAFSLFRLYGENK  195

Query  208  SKCNGR  191
             K + R
Sbjct  196  GKNSSR  201



>ref|XP_004250287.1| PREDICTED: CASP-like protein 2B1 [Solanum lycopersicum]
Length=201

 Score =   271 bits (694),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+ EL+ RCVI GLAIVG +LIGTD QV+ IFSI K AKFTDMKALV
Sbjct  16   YHGNNLKVIDRRVRVTELVLRCVIFGLAIVGVILIGTDKQVKVIFSIEKIAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAWAIFSGDQLMAYL+L AVAAAAQS
Sbjct  76   FLVIANGLAAAYSLVQVLRCILSMIRGTVLFNKPLAWAIFSGDQLMAYLTLTAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ+ELQWM+ICNMYGKFCNQVGEGIASSLIV +S+I+L GISAFSLFRLYG++K
Sbjct  136  AVFAKLGQAELQWMKICNMYGKFCNQVGEGIASSLIVSLSVIVLSGISAFSLFRLYGNSK  195

Query  208  SKCN  197
             K N
Sbjct  196  GKGN  199



>ref|XP_006365844.1| PREDICTED: CASP-like protein GSVIVT00013502001-like [Solanum 
tuberosum]
Length=201

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            +HGS LKV+DKRVR+ ELI RC+I GLAI+GAVLIGTDSQV+ IFSI+K+AKFTDMK LV
Sbjct  16   HHGSNLKVIDKRVRIIELILRCLILGLAIIGAVLIGTDSQVKVIFSIKKEAKFTDMKVLV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSL+Q++RC  SMIRGSVLFNKPLAW IFSGDQLMAYLSL AVAAAAQS
Sbjct  76   FLVIANGLAAAYSLIQVLRCIFSMIRGSVLFNKPLAWVIFSGDQLMAYLSLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V +K GQ ELQWM++CN+YGKFCNQ+GEGIASS+IV +SMI L GISAFSLFRLYG+N 
Sbjct  136  GVISKFGQPELQWMKVCNLYGKFCNQIGEGIASSVIVSLSMIALSGISAFSLFRLYGNNG  195

Query  208  SKCNGR  191
             K N R
Sbjct  196  GKSNAR  201



>ref|XP_006467305.1| PREDICTED: CASP-like protein POPTRDRAFT_818956-like [Citrus sinensis]
 gb|KDO78497.1| hypothetical protein CISIN_1g028855mg [Citrus sinensis]
 gb|KDO78498.1| hypothetical protein CISIN_1g028855mg [Citrus sinensis]
Length=202

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ +KVVD+R+RL EL+ RCVICGL ++ AVL+GTD+QVREIFSI+KKAKFTDMKALV
Sbjct  16   YHGTVMKVVDRRIRLVELVLRCVICGLGVLAAVLVGTDTQVREIFSIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AAAYSLVQ VRC+V+M++GSVLFNKPLAWAIFSGDQ+MAYL++ AVAAAAQS
Sbjct  76   FLVVANGIAAAYSLVQGVRCTVAMLKGSVLFNKPLAWAIFSGDQMMAYLTVAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ ELQW++ICNMYGKFCNQVGEGIAS+L+V ISM++L  ISAFSLFRLYG +K
Sbjct  136  AVFAKLGQPELQWLKICNMYGKFCNQVGEGIASALLVSISMVVLSCISAFSLFRLYGGSK  195

Query  208  SKCNGR  191
            +K   R
Sbjct  196  AKNGAR  201



>ref|XP_006352330.1| PREDICTED: CASP-like protein RCOM_0864260-like [Solanum tuberosum]
Length=201

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+ EL+ RC+I GLAI+GA+LIGTD Q + IFSI K AKFTDMKALV
Sbjct  16   YHGNNLKVIDRRVRVTELVLRCIIFGLAILGAILIGTDKQAKVIFSIEKIAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAWAIFSGDQLMAYL+L AVAAAAQS
Sbjct  76   FLVIANGLAAAYSLVQVLRCILSMIRGTVLFNKPLAWAIFSGDQLMAYLTLTAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ+ELQWM+ICNMYGKFCNQVGEGIASSLIV +SMI+L  ISAFSLFRLYG++K
Sbjct  136  AVFAKLGQTELQWMKICNMYGKFCNQVGEGIASSLIVSLSMIVLSAISAFSLFRLYGNSK  195

Query  208  SKCN  197
             K N
Sbjct  196  GKGN  199



>ref|XP_009627397.1| PREDICTED: CASP-like protein 2B1 [Nicotiana tomentosiformis]
Length=202

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 171/185 (92%), Gaps = 1/185 (1%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+  KV+D+RVR+ EL+ RCVICGLAI+GAVLIGTDSQV+ IFSI K AKFTDMKALV
Sbjct  16   YHGNNSKVIDRRVRVTELVLRCVICGLAILGAVLIGTDSQVKVIFSIEKIAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQLMAYL+L A+AAAAQS
Sbjct  76   FLVIANGLAAAYSLVQVLRCILSMIRGSVLFNKPLAWAIFSGDQLMAYLTLAALAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN-  212
            AV+AK+GQ+ELQWM+ICNMYGKFCNQVGEGIASSLIV +SMI+L GISAFSLFRLYG+N 
Sbjct  136  AVFAKLGQTELQWMKICNMYGKFCNQVGEGIASSLIVSLSMIVLSGISAFSLFRLYGNNS  195

Query  211  KSKCN  197
            K K N
Sbjct  196  KGKGN  200



>ref|XP_009592222.1| PREDICTED: CASP-like protein 2B1 [Nicotiana tomentosiformis]
Length=201

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            +H S LKV+DKRVRLAELI RC+ICGLA++ AVLIGTDSQVR IFSI+KKAKFTDMK+LV
Sbjct  16   HHRSNLKVIDKRVRLAELILRCLICGLAVLAAVLIGTDSQVRVIFSIQKKAKFTDMKSLV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQLMAYL+L AVAAAAQS
Sbjct  76   FLVIANGLAAAYSLVQVIRCILSMIRGSVLFNKPLAWAIFSGDQLMAYLNLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV++K+GQ+ELQWM++C+MYGK+CNQ GEG+ASS+I  +SMI+L GISAFSLFRLYG++ 
Sbjct  136  AVFSKLGQTELQWMKLCDMYGKYCNQAGEGVASSVIASLSMIVLSGISAFSLFRLYGNSG  195

Query  208  SKCNGR  191
             K N +
Sbjct  196  GKGNAK  201



>ref|XP_009789786.1| PREDICTED: CASP-like protein 2B1 [Nicotiana sylvestris]
Length=201

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            +H S LKV+DKRVRLAELI RC+ICGLA++ AVLIGTDSQVR IFSI+KKAKFTDMK+LV
Sbjct  16   HHRSNLKVIDKRVRLAELILRCLICGLAVLAAVLIGTDSQVRVIFSIQKKAKFTDMKSLV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQLMAYL+L AVAAAAQS
Sbjct  76   FLVIANGLAAAYSLVQVIRCILSMIRGSVLFNKPLAWAIFSGDQLMAYLTLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV++K+GQ+ELQWM++C+MYGK+CNQ G+G+ASS+I  +SMI+L GISAFSLFRLYG++ 
Sbjct  136  AVFSKLGQTELQWMKLCDMYGKYCNQAGKGVASSVIASLSMIVLSGISAFSLFRLYGNSA  195

Query  208  SKCNGR  191
             K N +
Sbjct  196  GKGNAK  201



>ref|XP_004239817.1| PREDICTED: CASP-like protein 2B1 [Solanum lycopersicum]
Length=201

 Score =   269 bits (687),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            +HGS LKV+DKRVR+ E+I RC+I GLAI+GAVLIGTDSQV+ IFSI+K+AKFTDMK LV
Sbjct  16   HHGSNLKVIDKRVRIIEVILRCLILGLAIIGAVLIGTDSQVKVIFSIKKEAKFTDMKVLV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSL+Q++RC  SMIRGSVLFNKPLAW IFSGDQLMAYLSL AVAAAAQS
Sbjct  76   FLVIANGLAAAYSLIQVLRCIFSMIRGSVLFNKPLAWVIFSGDQLMAYLSLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V +K GQ ELQWM++CN+YGKFCNQ+GEGI SSLIV +SMI L GISAFSLFRLYG+N 
Sbjct  136  GVISKFGQPELQWMKVCNLYGKFCNQIGEGIVSSLIVSLSMIALSGISAFSLFRLYGNNG  195

Query  208  SKCNGR  191
             K N R
Sbjct  196  GKSNAR  201



>ref|XP_002522908.1| conserved hypothetical protein [Ricinus communis]
 sp|B9SA89.1|CSPLB_RICCO RecName: Full=CASP-like protein 2B1; Short=RcCASPL2B1 [Ricinus 
communis]
 gb|EEF39508.1| conserved hypothetical protein [Ricinus communis]
Length=202

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS LKV+DKRVRLAEL+ RC+ICGL ++ AVL+GTD+QV+EIFSI+KKA+FTDMKALV
Sbjct  16   YHGSNLKVIDKRVRLAELVLRCLICGLGVLAAVLVGTDTQVKEIFSIQKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANG+AAAYSL+Q VRC V M+RGS LF+KPLAWAIFSGDQ+MAYL++ AVAAAAQS
Sbjct  76   FLVIANGIAAAYSLLQGVRCVVGMVRGSALFSKPLAWAIFSGDQMMAYLTVAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ ELQWM+ICNMYGKFCNQVGEGIAS+L+V +SM++L  ISAFSLFRLYG NK
Sbjct  136  AVFAKLGQPELQWMKICNMYGKFCNQVGEGIASALLVSVSMVVLSCISAFSLFRLYGANK  195

Query  208  SK  203
             K
Sbjct  196  GK  197



>ref|XP_006449900.1| hypothetical protein CICLE_v10016754mg [Citrus clementina]
 gb|ESR63140.1| hypothetical protein CICLE_v10016754mg [Citrus clementina]
Length=202

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            Y G+ +KVVD+R+RL EL+ RCVICGL  + AVL+GTD+QVREIFSI+KKAKFTDMKALV
Sbjct  16   YRGTVMKVVDRRIRLVELVLRCVICGLGALAAVLVGTDTQVREIFSIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AAAYSLVQ VRC+V+M++GSVLFNKPLAWAIFSGDQ+MAYL++ AVAAAAQS
Sbjct  76   FLVVANGIAAAYSLVQGVRCTVAMLKGSVLFNKPLAWAIFSGDQMMAYLTVAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ ELQW++ICNMYGKFCNQVGEGIAS+L+V ISM++L  ISAFSLFRLYG +K
Sbjct  136  AVFAKLGQPELQWLKICNMYGKFCNQVGEGIASALLVSISMVVLSCISAFSLFRLYGGSK  195

Query  208  SKCNGR  191
            +K   R
Sbjct  196  AKNGAR  201



>sp|A7R385.1|CSPLC_VITVI RecName: Full=CASP-like protein 2B1; Short=VvCASPL2B1 [Vitis 
vinifera]
Length=202

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKVVD+RVRLAEL+ RCVICGL I+ AVL+GTD+QV+ IF+I+KKAKFTDMKALV
Sbjct  16   YHGTNLKVVDRRVRLAELVLRCVICGLGILAAVLVGTDTQVKVIFTIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANG+AAAYSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQ++AYL+L AVAAAAQS
Sbjct  76   FLVIANGIAAAYSLIQGLRCVVSMVRGSVLFSKPLAWAIFSGDQVIAYLTLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +V+ + GQ ELQWM+ICNMYGKFCNQVGEGI S++ V +SM+IL GISAFSLFRLYG NK
Sbjct  136  SVFGEFGQPELQWMKICNMYGKFCNQVGEGIVSAVGVSLSMVILSGISAFSLFRLYGGNK  195

Query  208  SKCNGR  191
                GR
Sbjct  196  GTSGGR  201



>ref|XP_011095935.1| PREDICTED: CASP-like protein 2B1 [Sesamum indicum]
Length=202

 Score =   265 bits (676),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS +KV+D+RV++AEL+ RCVIC LAI+ AVLIGTD+QVREIF+IRKKAKFTDMKALV
Sbjct  16   YHGSNVKVIDRRVKVAELVLRCVICVLAILAAVLIGTDTQVREIFTIRKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQ++RC +SMIRG+VLF+KPLAWAIFSGDQ+MAYLSL AVAA+AQS
Sbjct  76   FLVIANGLAAAYSLVQVLRCVLSMIRGTVLFSKPLAWAIFSGDQVMAYLSLSAVAASAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ ELQWM+ C +Y KFCNQVGEG+AS+++  +SM++L  ISAFSLFRLYGD+K
Sbjct  136  AVFAKLGQPELQWMKTCTLYEKFCNQVGEGVASAVLASLSMVVLSAISAFSLFRLYGDSK  195

Query  208  SKCNG  194
             K +G
Sbjct  196  GKSSG  200



>ref|XP_011086255.1| PREDICTED: CASP-like protein 2B1 [Sesamum indicum]
Length=202

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS LK VD+RVR+AEL+ R  I GLAI+ A+LIGTD+QV+EIFSI+KKAKFTDMKALV
Sbjct  16   YHGSNLKAVDRRVRVAELVLRGFISGLAILSALLIGTDTQVKEIFSIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGLAAAYSLVQL+RC +SMIRGSVLFNKPLAWAIFSGDQ+MAYL L AVAAAAQS
Sbjct  76   FLVIANGLAAAYSLVQLLRCILSMIRGSVLFNKPLAWAIFSGDQVMAYLMLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A  AK+GQ ELQWM+IC+MY KFCNQVGEGIAS+L V +S +++  ISAFSLFRLYG+NK
Sbjct  136  AALAKLGQPELQWMKICDMYAKFCNQVGEGIASALFVSLSFVVVSAISAFSLFRLYGENK  195

Query  208  SKCNGR  191
             K +GR
Sbjct  196  RKNSGR  201



>ref|XP_002307903.1| integral membrane family protein [Populus trichocarpa]
 sp|B9HD38.1|CSPLE_POPTR RecName: Full=CASP-like protein 2B2; Short=PtCASPL2B2 [Populus 
trichocarpa]
 gb|EEE91426.1| integral membrane family protein [Populus trichocarpa]
Length=202

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG  LKV+D+RVRLAEL+ RCVIC L ++ AVL+GTD+QV+EIFSI+KKA+FTDMKALV
Sbjct  16   YHGMNLKVIDRRVRLAELVLRCVICALGVLAAVLVGTDTQVKEIFSIQKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AAAYSLVQ VRC V M++GSVLF+KPLAW IFSGDQ+MAYL+L AVAAA QS
Sbjct  76   FLVVANGIAAAYSLVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQMMAYLTLSAVAAAVQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A +AK+GQ +LQWM+ICNMYGKFCNQVGEGIAS+L+V +SM++L  IS+FSLFRLYG NK
Sbjct  136  ASFAKLGQPDLQWMKICNMYGKFCNQVGEGIASALLVSVSMVVLSCISSFSLFRLYGGNK  195

Query  208  SKCNGR  191
             K   R
Sbjct  196  GKDGAR  201



>gb|EYU33843.1| hypothetical protein MIMGU_mgv1a024377mg [Erythranthe guttata]
Length=203

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            +HGS LKV+DKRVRL E++ RC+ICGLA++ A+LIGTD QV+EIF+I+KKA+FT+MKALV
Sbjct  17   HHGSNLKVIDKRVRLTEVVLRCLICGLALLSALLIGTDVQVKEIFTIQKKAQFTNMKALV  76

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+ AAYSL Q++RC +SMIRG VLFNKP AWAIF+GDQ+MAYL+L AVAAAAQS
Sbjct  77   FLVVANGITAAYSLAQVLRCVLSMIRGRVLFNKPFAWAIFAGDQVMAYLTLAAVAAAAQS  136

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV AK+GQ+ LQWM ICN+YGKFCNQ+GEGIAS L+V +SMI+L  ISAFSLFRLYGDN 
Sbjct  137  AVLAKLGQTALQWMSICNIYGKFCNQIGEGIASGLLVSLSMIVLSAISAFSLFRLYGDNN  196

Query  208  SKCNGR  191
             K NGR
Sbjct  197  RKSNGR  202



>ref|XP_011004511.1| PREDICTED: CASP-like protein 2B2 [Populus euphratica]
Length=202

 Score =   258 bits (659),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVRLAEL+ RCVIC L ++ AVL+GTD+QV+EIFSI KKA+FTDMKALV
Sbjct  16   YHGTNLKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIFSIEKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AAAYSLVQ VRC V M++GSVLF+KP+AW IFSGDQ+MAYL+L AVAAA QS
Sbjct  76   FLVVANGIAAAYSLVQGVRCVVGMVKGSVLFSKPVAWVIFSGDQMMAYLTLSAVAAAVQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A +AK+GQ +LQWM+ICNMYGKFCNQVGEGIAS+L+V +SM++L  IS+FSLFRLYG NK
Sbjct  136  ASFAKLGQPDLQWMKICNMYGKFCNQVGEGIASALLVSVSMVVLSCISSFSLFRLYGGNK  195

Query  208  SKCNGR  191
             K   R
Sbjct  196  GKDGAR  201



>ref|XP_008227444.1| PREDICTED: CASP-like protein RCOM_0864260 [Prunus mume]
Length=204

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKV+D+RVR+AEL+ RCVICGL ++ A L+GTD+QV+EIF+I+KKAKFTDMKALV
Sbjct  16   YHSTNLKVIDRRVRVAELVLRCVICGLGVIAAALVGTDTQVKEIFTIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+MAY+S+ AV AAAQS
Sbjct  76   FLVIANGIIAAYSLVQVLRCVVSMVRGNVLFSKPIAWIIFSGDQVMAYVSVAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQSELQWM+ICNMY KFCNQVGEGIAS+L+V +S ++L  ISAF+LFRLYG NK
Sbjct  136  AVFAKLGQSELQWMKICNMYDKFCNQVGEGIASALLVSLSTVVLSCISAFNLFRLYGGNK  195

Query  208  SK  203
            SK
Sbjct  196  SK  197



>ref|XP_011040245.1| PREDICTED: CASP-like protein 2B1, partial [Populus euphratica]
Length=187

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVRLAEL+ RCVIC L ++ AVL+GTD+QV+EIFSI KKA+FTDMKALV
Sbjct  1    YHGTNLKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIFSIEKKARFTDMKALV  60

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV ANG+AAAYSLVQ VRC V M++GSVLF+KPLAW IFSGDQ+MAYL++ AVAAAAQS
Sbjct  61   FLVAANGIAAAYSLVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQMMAYLTMSAVAAAAQS  120

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A +AK+GQ +LQWM+ C MYGKFCNQVGEGIAS+L+V +SM++L  ISAFSLFRLYG NK
Sbjct  121  AAFAKLGQPDLQWMKTCTMYGKFCNQVGEGIASALLVSVSMVVLSCISAFSLFRLYGGNK  180

Query  208  SKCNGR  191
             K   R
Sbjct  181  GKDGAR  186



>gb|KDP29302.1| hypothetical protein JCGZ_19405 [Jatropha curcas]
Length=202

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ +KV+D+RVRLAEL+ RCV CGL ++ AVL+ TD+QV+EIFSI+KKA++TDMKALV
Sbjct  16   YHGTNVKVIDRRVRLAELVLRCVTCGLGVLAAVLVATDTQVKEIFSIQKKARYTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANG+ AAYSLVQ VRC V MIRGSVLFNKPLAWAIFSGDQ+MAYL++ AVAAAAQS
Sbjct  76   FLVIANGIVAAYSLVQGVRCVVGMIRGSVLFNKPLAWAIFSGDQVMAYLTVAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A +AK+GQ ELQWM+IC+MYGKFCNQVGEGIAS+  V +S ++L  +SAFSLFRLYG NK
Sbjct  136  AAFAKLGQPELQWMKICDMYGKFCNQVGEGIASAFFVGLSTVVLSCLSAFSLFRLYGANK  195

Query  208  SK  203
             K
Sbjct  196  GK  197



>ref|XP_007212067.1| hypothetical protein PRUPE_ppa011591mg [Prunus persica]
 gb|EMJ13266.1| hypothetical protein PRUPE_ppa011591mg [Prunus persica]
Length=204

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKV+D+RVR+AEL+ RCVICGL ++ A L+GTD+QV+EIF+I+KKAKFTDMKALV
Sbjct  16   YHSTNLKVIDRRVRVAELVLRCVICGLGVIAAALVGTDTQVKEIFTIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIA+G+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+MAY+S+ AV AAAQS
Sbjct  76   FLVIAHGIIAAYSLVQVLRCVVSMVRGNVLFSKPIAWIIFSGDQVMAYVSVAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQSELQWM+ICNMY KFCNQVGEGIAS+L+V +S ++L  ISAF+LFRLYG NK
Sbjct  136  AVFAKLGQSELQWMKICNMYDKFCNQVGEGIASALLVSLSTVVLSCISAFNLFRLYGGNK  195

Query  208  SK  203
            SK
Sbjct  196  SK  197



>ref|XP_002323133.1| hypothetical protein POPTR_0016s01010g [Populus trichocarpa]
 sp|B9IH36.1|CSPLJ_POPTR RecName: Full=CASP-like protein 2B1; Short=PtCASPL2B1 [Populus 
trichocarpa]
 gb|EEF04894.1| hypothetical protein POPTR_0016s01010g [Populus trichocarpa]
Length=202

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+  KV+D+RVRLAEL+ RCVIC L ++ AVL+GTD+QV+EIFSI+KKA+FTDMKALV
Sbjct  16   YHGTNSKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIFSIQKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV ANG+AAAYS VQ VRC V M++GSVLF+KPLAW IFSGDQ+MAYL++ AVAAAAQS
Sbjct  76   FLVAANGIAAAYSFVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQMMAYLTMSAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +V+AK+GQ +LQWM+IC MYGKFCNQVGEGIAS+L+V +SM++L  ISAFSLFRLYG NK
Sbjct  136  SVFAKLGQPDLQWMKICTMYGKFCNQVGEGIASALLVSVSMVVLSCISAFSLFRLYGGNK  195

Query  208  SKCNGR  191
             K   R
Sbjct  196  GKDGAR  201



>gb|AGE09573.1| UPF-like protein [Eucalyptus cladocalyx]
Length=203

 Score =   250 bits (639),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 160/185 (86%), Gaps = 1/185 (1%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKVVD+RVRLAEL+ R VICGL ++ AVL+GTD+QVREIF+I+KKAKFTDMKALV
Sbjct  16   YHETSLKVVDRRVRLAELVLRFVICGLGVLTAVLVGTDTQVREIFTIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVI NG+AA+YSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQ+MAY++L AVAA+AQS
Sbjct  76   FLVIVNGIAASYSLIQALRCVVSMVRGSVLFSKPLAWAIFSGDQVMAYVTLAAVAASAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY-GDN  212
            AV AK+GQ ELQWM+IC MY KFCNQVGEGI S+L+V I M+ L  ISAF LFRLY G N
Sbjct  136  AVIAKLGQPELQWMKICGMYEKFCNQVGEGIVSALLVSIGMVALSVISAFGLFRLYNGSN  195

Query  211  KSKCN  197
            K K N
Sbjct  196  KGKSN  200



>ref|XP_010052948.1| PREDICTED: CASP-like protein 2B1 [Eucalyptus grandis]
 gb|KCW77100.1| hypothetical protein EUGRSUZ_D01440 [Eucalyptus grandis]
Length=203

 Score =   248 bits (634),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 160/185 (86%), Gaps = 1/185 (1%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKVVD+RVRLAEL+ R VICGL ++ AVL+GTD+QVREIF+I+KKAKFTDMKALV
Sbjct  16   YHETSLKVVDRRVRLAELVLRFVICGLGVLAAVLVGTDTQVREIFTIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANG+AA+YS++Q +RC VSM+RGSVLF+KPLAW IFSGDQ+MAY++L AVAAAAQS
Sbjct  76   FLVIANGIAASYSMIQALRCVVSMVRGSVLFSKPLAWVIFSGDQVMAYVTLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY-GDN  212
            AV AK+GQ ELQWM++C MY KFCNQVGEGI S+L+V I M+ L  ISAF LFRLY G N
Sbjct  136  AVIAKLGQPELQWMKVCGMYEKFCNQVGEGIVSALLVSIGMVALSVISAFGLFRLYNGSN  195

Query  211  KSKCN  197
            K K N
Sbjct  196  KGKSN  200



>ref|XP_007026314.1| CASP-like protein POPTRDRAFT_818956 isoform 1 [Theobroma cacao]
 gb|EOY28936.1| CASP-like protein POPTRDRAFT_818956 isoform 1 [Theobroma cacao]
Length=202

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKV+D+RVR+AEL+ RCVIC L+++ AVL+ TD+QV+EIFSI+KKA+FTDMKALV
Sbjct  16   YHATNLKVIDRRVRVAELVLRCVICVLSVLAAVLVATDTQVKEIFSIQKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AAAYSL+Q VRC V+M+RGSVLF+KP AWAIFSGDQ +AYL++ AV AAAQS
Sbjct  76   FLVVANGVAAAYSLIQGVRCVVAMVRGSVLFSKPFAWAIFSGDQALAYLTVAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+ K+GQ+ELQW++IC+MYGKFCNQVG+G+A +L+V + M+ L  ISAFSLFRLYG  K
Sbjct  136  AVFGKLGQTELQWLKICSMYGKFCNQVGDGVAMALLVSLGMVALSCISAFSLFRLYGSTK  195

Query  208  SKCNGR  191
            ++ N R
Sbjct  196  ARNNSR  201



>gb|KJB67396.1| hypothetical protein B456_010G188700 [Gossypium raimondii]
Length=202

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+AEL+ RC+ICGL+++ AVL+GTD+Q++EIF+I+KKA+FTDMKALV
Sbjct  16   YHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIFTIQKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV ANG+ AAYSLVQ VRC V M+RGSVLF+KPLA+AIFSGDQ +AYL++ AV AAAQS
Sbjct  76   FLVAANGITAAYSLVQGVRCVVGMVRGSVLFSKPLAFAIFSGDQALAYLNVAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A +AK+GQ++LQWM ICNMYGKFCNQ+GEGIA SL+V I M+ L  ISAF LFRLYG NK
Sbjct  136  AAFAKLGQTKLQWMVICNMYGKFCNQIGEGIAVSLLVSICMVGLSCISAFGLFRLYGSNK  195

Query  208  SKCN  197
            +K N
Sbjct  196  AKNN  199



>ref|XP_003534893.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 1 
[Glycine max]
Length=203

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + + V+D+R+++ EL+ RCVI GL ++ AVL+GTDSQV+E FS +K+AKFTDMK+LV
Sbjct  17   YHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSQVKEFFSFQKEAKFTDMKSLV  76

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+MAY+++  V AA QS
Sbjct  77   FLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQVMAYVTVATVVAAGQS  136

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V A++GQ ELQWM+ICNMYGKFCNQVGEGIAS+ +  +SM++L  ISAFSLFRLYG NK
Sbjct  137  GVIARVGQPELQWMKICNMYGKFCNQVGEGIASAFVASLSMVVLSCISAFSLFRLYGGNK  196

Query  208  SK  203
            +K
Sbjct  197  TK  198



>gb|KHN40811.1| CASP-like protein [Glycine soja]
Length=203

 Score =   245 bits (626),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + + V+D+R+++ EL+ RCVI GL ++ AVL+GTDS+V+E FS +K+AKFTDMK+LV
Sbjct  17   YHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFSFQKEAKFTDMKSLV  76

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+MAY+++  V AA QS
Sbjct  77   FLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQVMAYVTVATVVAAGQS  136

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V A++GQ ELQWM+ICNMYGKFCNQVGEGIAS+ +  +SM++L  ISAFSLFRLYG NK
Sbjct  137  GVIARVGQPELQWMKICNMYGKFCNQVGEGIASAFVASLSMVVLSCISAFSLFRLYGGNK  196

Query  208  SK  203
            +K
Sbjct  197  TK  198



>ref|XP_010540841.1| PREDICTED: CASP-like protein 2B1 [Tarenaya hassleriana]
Length=196

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ +K +D+RV+L ELI RC +CGL +V A+L+GTD+QV+EIF+I+KKA+FTDMKALV
Sbjct  12   YHGANMKSIDRRVKLTELILRCSVCGLGLVAALLVGTDTQVKEIFTIQKKARFTDMKALV  71

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV ANG+AAAYSLVQ++RC+V M++GSVLF+KPLAWAIFSGDQ +AYL + A+AAAAQS
Sbjct  72   FLVSANGVAAAYSLVQVIRCAVGMVKGSVLFSKPLAWAIFSGDQAIAYLCVAAIAAAAQS  131

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A +AK+G+SELQWM+ICNMYGKFCNQVGEGI S+L   I M+++  ISAFSLFRLYG +K
Sbjct  132  AAFAKLGESELQWMKICNMYGKFCNQVGEGIGSALFAAIGMVMVSCISAFSLFRLYGGSK  191

Query  208  SK  203
             +
Sbjct  192  GR  193



>ref|XP_003547283.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
Length=202

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + +KV+D+++++ EL+ RCVI GL ++ AVL+GTDS+V+E FS +K+AKFTDMK+LV
Sbjct  17   YHSTNVKVLDRKIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFSFQKEAKFTDMKSLV  76

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANGLAA YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+MAY+++ A+AAA QS
Sbjct  77   FLVVANGLAAGYSLIQGLRCILSMIRGRVLFSKPLAWAIFSGDQVMAYVTVVALAAAGQS  136

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             + A++GQ ELQWM+ICNMYGKFCNQVGEGIAS+ +  +SM+++  ISAFSLFRLYG NK
Sbjct  137  GMIARVGQPELQWMKICNMYGKFCNQVGEGIASAFVASLSMVVMSCISAFSLFRLYGGNK  196

Query  208  SK  203
            +K
Sbjct  197  TK  198



>ref|XP_010087633.1| hypothetical protein L484_010584 [Morus notabilis]
 gb|EXB29526.1| hypothetical protein L484_010584 [Morus notabilis]
Length=202

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH +  +VVD+RVR+AEL+ RC+I  L IV  VL+ TD+QV+EIFSI+KKAKFTDMKALV
Sbjct  16   YHMTDSRVVDRRVRMAELVLRCLISVLGIVACVLVATDTQVKEIFSIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FL  ANG+ AAYSLVQ +RC VSM+RG+V+F+KPLAW IFSGDQ+MAY+++ AV AAAQ+
Sbjct  76   FLATANGIVAAYSLVQALRCVVSMVRGNVIFSKPLAWVIFSGDQVMAYVTVAAVGAAAQA  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ+ELQWM+ICNMY KFCNQVGEGIAS+L+V +S +++ GISAF+LFRLYG NK
Sbjct  136  AVFAKLGQAELQWMKICNMYDKFCNQVGEGIASALLVSLSTVVISGISAFNLFRLYGGNK  195

Query  208  SKCNGR  191
            +K + R
Sbjct  196  AKSSAR  201



>ref|XP_010270196.1| PREDICTED: CASP-like protein 2B1 [Nelumbo nucifera]
Length=204

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = -1

Query  748  YHGSXLK-VVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKAL  572
            YHG  LK ++D+RVRLAE++ RC+ICGL ++ AVLIG+D+QVRE F+IRKKAKFTDMKAL
Sbjct  17   YHGDNLKAMIDRRVRLAEMVLRCLICGLGVLAAVLIGSDTQVREFFTIRKKAKFTDMKAL  76

Query  571  VFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaq  392
            V LV+ANG+AA YSL+Q +RC +SMI+GSVLFNKPLAWAIFSGDQ+MAYL + ++AAAAQ
Sbjct  77   VLLVVANGIAAGYSLIQGLRCGLSMIKGSVLFNKPLAWAIFSGDQVMAYLLMASLAAAAQ  136

Query  391  savyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
            S+V A++GQ E QWM++C++Y KFC Q GEG+AS+L+V + MI L  ISAF+LFRLYG N
Sbjct  137  SSVIARLGQPEFQWMKVCSLYEKFCTQTGEGMASALVVSLGMITLSCISAFNLFRLYGGN  196

Query  211  KSKCNGR  191
            K+K +GR
Sbjct  197  KAKSSGR  203



>gb|KHG12114.1| CASP-like protein [Gossypium arboreum]
Length=269

 Score =   245 bits (626),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+AEL+ RC+ICGL+++ AVL+GTD+Q++EIF+I+K+A+FTDMKALV
Sbjct  16   YHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIFTIQKRARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV ANG+ AAYSLVQ VRC V M RGSVLF+KPLA AIFSGDQ +AYL+L AV AAAQS
Sbjct  76   FLVAANGITAAYSLVQGVRCVVGMGRGSVLFSKPLALAIFSGDQALAYLNLAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A +AK+GQ++LQWM ICNMYGKFCNQVGEGIA SL+V I M+ L  ISAF LFRLYG NK
Sbjct  136  AAFAKLGQTKLQWMVICNMYGKFCNQVGEGIAVSLLVSICMVGLSCISAFGLFRLYGSNK  195

Query  208  SKCN  197
            +K N
Sbjct  196  AKNN  199



>ref|XP_009346047.1| PREDICTED: CASP-like protein RCOM_0864260 [Pyrus x bretschneideri]
Length=202

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKV+D+RVR+AEL+ RCVICGL +V A L+GTD+Q++EIF+++KKAKFTDMKALV
Sbjct  16   YHSTNLKVIDRRVRVAELVLRCVICGLGVVAAALVGTDTQIKEIFTVQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+MAY+S+ AV AAAQS
Sbjct  76   FLVVANGIVAAYSLVQVMRCVVSMVRGNVLFSKPIAWIIFSGDQVMAYVSVAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ ELQWM+ICNMY KFCNQVGEGIAS+L+V +S ++L  +SAF+LFRLYG NK
Sbjct  136  AVFAKLGQPELQWMKICNMYDKFCNQVGEGIASALLVSLSTVLLSCVSAFNLFRLYGGNK  195

Query  208  SKCNGR  191
            +K   R
Sbjct  196  NKTASR  201



>gb|KJB69167.1| hypothetical protein B456_011G008900 [Gossypium raimondii]
Length=202

 Score =   241 bits (615),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+   V+++RVR+AEL+ RC+IC L+++ A L+GTDSQV+EIFSI+KKA+FTDMKALV
Sbjct  16   YHGTNPMVIERRVRIAELLLRCLICVLSVLTAFLVGTDSQVKEIFSIQKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AAAYSLVQ+VRC VSM++GSVL NKPLAW IFSGDQ MAYL++ AV AAAQS
Sbjct  76   FLVVANGVAAAYSLVQVVRCVVSMVKGSVLVNKPLAWTIFSGDQAMAYLNVAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ+ELQWM+ICN+YGKFCNQVGEGI+ +++  + M++  GISAF+LFRL G NK
Sbjct  136  AVFAKLGQTELQWMKICNLYGKFCNQVGEGISMAVLASVCMVLQSGISAFTLFRLCGVNK  195

Query  208  SKCN  197
            +K N
Sbjct  196  AKGN  199



>ref|XP_003549509.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
 gb|KHN03533.1| CASP-like protein [Glycine soja]
Length=201

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+ EL+ RCV  GL +V  VL+ TDSQV+E FS +KKAKFTDMKALV
Sbjct  16   YHGTKLKVLDRRVRITELVLRCVSLGLGVVAIVLVVTDSQVKEFFSFQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANGL   YSL+Q +RC VSM+RG+VLF+KPLAW IFSGDQ+MAY+++ AVAAA QS
Sbjct  76   FLVVANGLTVGYSLIQGLRCVVSMVRGNVLFSKPLAWLIFSGDQVMAYVTVAAVAAALQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V  + GQ+ELQWM++CNMYGKFCNQ+GEGIAS+ +V +SM++L  ISAFSLFRLYG NK
Sbjct  136  GVLGRTGQAELQWMKVCNMYGKFCNQMGEGIASAFVVSLSMVVLSCISAFSLFRLYGTNK  195

Query  208  SKCNG  194
            +K  G
Sbjct  196  NKYAG  200



>ref|XP_003529670.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
 gb|KHN42278.1| CASP-like protein [Glycine soja]
Length=201

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+ EL+ RCV  GL  V  VL+ TDSQV+E FS +KKAKFTDMKALV
Sbjct  16   YHGTKLKVLDRRVRITELVLRCVSLGLGAVAIVLVVTDSQVKEFFSFQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANGL   YSL+Q +RC VSMIRG+VLFNKP AW IFSGDQ+MAY+++ AV AA QS
Sbjct  76   FLVVANGLTVGYSLIQGLRCVVSMIRGNVLFNKPFAWLIFSGDQVMAYVTVAAVVAALQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V  + GQ+ELQWM++CNMYGKFCNQ+GEGIAS+ +V +SM++L  ISAFSLFRLYG NK
Sbjct  136  GVLGRTGQAELQWMKVCNMYGKFCNQMGEGIASAFVVSLSMVVLSCISAFSLFRLYGTNK  195

Query  208  SKCNG  194
            +K  G
Sbjct  196  NKYAG  200



>ref|XP_008384165.1| PREDICTED: CASP-like protein RCOM_0864260 isoform X1 [Malus domestica]
Length=204

 Score =   238 bits (607),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKV D+R+R+AEL+ RC+ICGL +V A L+GTD+QV+EIF+++KKAKFTDMKALV
Sbjct  16   YHSTNLKVNDRRLRVAELVLRCLICGLGVVAAALVGTDTQVKEIFTVQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+ +AYSLVQ+VRC VSM+RG+VLF+KP+AW IFSGDQ+MAY+ + AV AA QS
Sbjct  76   FLVVANGIVSAYSLVQVVRCVVSMVRGNVLFSKPIAWIIFSGDQVMAYVCVAAVGAATQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV AK+GQ ELQWM+ICNMY KFCNQVGEGIAS+L+V +S ++L  +SAF+LFRLYG NK
Sbjct  136  AVLAKLGQPELQWMKICNMYDKFCNQVGEGIASALLVSLSTVLLSCVSAFNLFRLYGGNK  195

Query  208  S  206
            +
Sbjct  196  N  196



>ref|XP_006410744.1| hypothetical protein EUTSA_v10017259mg [Eutrema salsugineum]
 sp|E4MWF4.1|CSPL1_THEHA RecName: Full=CASP-like protein 2B1; Short=ThCASPL2B1 [Eutrema 
halophilum]
 dbj|BAJ33937.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52197.1| hypothetical protein EUTSA_v10017259mg [Eutrema salsugineum]
Length=199

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  742  GSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  563
            G+ +K++D++VRL ELI RC +C LA+V A+LI TD+QV+EIF+I+KKAK+TDMKALVFL
Sbjct  15   GTKMKLMDRKVRLTELILRCSVCALALVAAILIATDTQVKEIFTIQKKAKYTDMKALVFL  74

Query  562  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  383
            V+ NG+AAAYSL+ +VRC V M++GSVLF+KPLAWAIFSGDQ +AYL++  VAAAAQSA 
Sbjct  75   VVVNGIAAAYSLLHMVRCVVGMMKGSVLFSKPLAWAIFSGDQAIAYLTVAGVAAAAQSAA  134

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
            +AK+G+ ELQWM+IC +YGKFCNQVGEGIA++L+  I M+++  ISAF+LFRLYG NK++
Sbjct  135  FAKLGEPELQWMKICTIYGKFCNQVGEGIATALLASIGMVLISSISAFALFRLYGGNKAQ  194

Query  202  CNGR  191
               R
Sbjct  195  QGSR  198



>ref|XP_004486332.1| PREDICTED: CASP-like protein POPTRDRAFT_575900-like [Cicer arietinum]
Length=201

 Score =   236 bits (603),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH S +KV+D+R+R+ EL+ RCVI  LA++   L+ TDSQVR  F+I KKAKFTDMKALV
Sbjct  16   YHSSNMKVLDRRIRITELVLRCVILCLALLAVFLVVTDSQVRVFFTIEKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANGLAA YSL+Q VRC VSMI GSVLF+KPLAWAIFSGDQ+MAY+++ AVAAAAQS
Sbjct  76   FLVVANGLAAGYSLIQGVRCVVSMINGSVLFSKPLAWAIFSGDQVMAYITVSAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ ELQW++IC+MYGKFCNQVGEG+AS+++V +SM++L  ISAFSLFRLYG +K
Sbjct  136  AVFAKLGQPELQWIKICDMYGKFCNQVGEGLASAIVVSLSMVLLSCISAFSLFRLYGGSK  195

Query  208  SK  203
             K
Sbjct  196  IK  197



>gb|KHN32948.1| CASP-like protein [Glycine soja]
Length=204

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 150/184 (82%), Gaps = 2/184 (1%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + +KV+D+++++ EL+ RCVI GL ++ AVL+GTDS+V+E FS +K+AKFTDMK+LV
Sbjct  17   YHSTNVKVLDRKIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFSFQKEAKFTDMKSLV  76

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL--Maylslgavaaaa  395
            FLV+ANGLAA YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+  +   +   +    
Sbjct  77   FLVVANGLAAGYSLIQGLRCILSMIRGRVLFSKPLAWAIFSGDQVYFIYIKNTAYLLFFW  136

Query  394  qsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGD  215
            QS + A++GQ ELQWM+ICNMYGKFCNQVGEGIAS+ +  +SM+++  ISAFSLFRLYG 
Sbjct  137  QSGMIARVGQPELQWMKICNMYGKFCNQVGEGIASAFVASLSMVVMSCISAFSLFRLYGG  196

Query  214  NKSK  203
            NK+K
Sbjct  197  NKTK  200



>ref|XP_008370988.1| PREDICTED: CASP-like protein RCOM_0864260 [Malus domestica]
Length=202

 Score =   235 bits (600),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+AEL+ RCVICGL +V A L+GTD+Q++EIF+++KKAKFTDMKALV
Sbjct  16   YHGTNLKVIDRRVRVAELVLRCVICGLGVVAAALVGTDTQIKEIFTVQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+MAY+S+ AV AAAQS
Sbjct  76   FLVVANGIVAAYSLVQVMRCVVSMVRGNVLFSKPIAWIIFSGDQVMAYVSVAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ ELQWM+ICNMY KFCN+VGEGIAS+L+V +S ++L  +SAF+LFRLYG N 
Sbjct  136  AVFAKLGQPELQWMKICNMYDKFCNRVGEGIASALLVSLSAVLLSCVSAFNLFRLYGGNT  195

Query  208  SKCNGR  191
            +K   R
Sbjct  196  NKTAAR  201



>ref|XP_010909399.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=202

 Score =   235 bits (600),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            Y G  LK V++RV++AE++ R VI GL ++GA L+ +D+QVREIFS+ KKAKFTDMKALV
Sbjct  16   YGGGHLKAVERRVKVAEVVLRWVIFGLGVLGAALVSSDTQVREIFSLEKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANG+AA YSL+Q VRC VSMI+G+VLFNK  AW IFS DQ+MAY++L AV AAAQS
Sbjct  76   FLVIANGIAAGYSLIQGVRCVVSMIKGTVLFNKAWAWVIFSCDQVMAYVTLAAVGAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV  + GQSELQWM+ICN+YGKFC QVGEG+ SS +V +SM+ L G+SAF+LFRLYG+NK
Sbjct  136  AVLGEFGQSELQWMKICNLYGKFCTQVGEGLVSSFVVSLSMVSLSGLSAFNLFRLYGNNK  195

Query  208  SKCNG  194
             KC+G
Sbjct  196  GKCSG  200



>ref|XP_010252724.1| PREDICTED: CASP-like protein 2B1 [Nelumbo nucifera]
Length=203

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + L+V+D+RV++AE++ RC+ICGL I+ AVL+G+D+QVREIF+IRKKAKFTDMKALV
Sbjct  17   YHKNNLEVIDRRVKVAEVVLRCMICGLGILAAVLVGSDTQVREIFTIRKKAKFTDMKALV  76

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FL+IANG+AA YS +Q +RC VS+IRGS+L NKPLAWAIFSGDQ+MAY+ + A AAAAQS
Sbjct  77   FLLIANGIAAGYSFIQSLRCVVSVIRGSLLVNKPLAWAIFSGDQVMAYVLMAAFAAAAQS  136

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +V A++GQ E QWM++CN+Y KFC Q GEG+  +L+V +SMI L  ISAF+LFRLYG+ +
Sbjct  137  SVIAEMGQPEWQWMKVCNLYEKFCTQAGEGMVIALVVSLSMITLSFISAFNLFRLYGETE  196

Query  208  SKCNG  194
            ++  G
Sbjct  197  AQNRG  201



>ref|XP_003594276.1| hypothetical protein MTR_2g026530 [Medicago truncatula]
 gb|AES64527.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
 gb|AFK47998.1| unknown [Medicago truncatula]
Length=201

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + +KV+D+RVR+ EL+ R V  GL ++  VLI TDSQVRE F+I+KKAKFTDMKALV
Sbjct  16   YHSTNMKVLDRRVRITELVLRFVNLGLGVLAVVLIVTDSQVREFFTIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+AN +AA YSL+Q +RC VSMI+GSVLFNKPLAWAIFS DQ+MAY+++ AV+AAAQS
Sbjct  76   FLVVANAIAAGYSLIQGLRCVVSMIKGSVLFNKPLAWAIFSCDQVMAYITVAAVSAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+AK+GQ +LQWM+ICNMYGKFCNQVGEG+AS+ +V +SM+++  ISAFSLFRLYG +K
Sbjct  136  AVFAKMGQEQLQWMKICNMYGKFCNQVGEGLASAFLVSLSMVVVSCISAFSLFRLYGGSK  195

Query  208  SK  203
             K
Sbjct  196  IK  197



>ref|XP_007154032.1| hypothetical protein PHAVU_003G085300g [Phaseolus vulgaris]
 gb|ESW26026.1| hypothetical protein PHAVU_003G085300g [Phaseolus vulgaris]
Length=201

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+AE++ R V  G+ ++  VL+ TDSQV+E FS +KKAKFTDMKALV
Sbjct  16   YHGTKLKVLDRRVRIAEMVLRGVSLGIGVLAIVLVVTDSQVKEFFSFQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIANGL   YSL+Q +RC VSM+RG+VL +KPLAW IFSGDQ+MAYLS+ AVAAA QS
Sbjct  76   FLVIANGLTVGYSLIQGLRCVVSMVRGNVLLSKPLAWLIFSGDQVMAYLSVAAVAAALQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             +  + GQ+ELQWM++CNMYGKFCN++GEGI S+L+V +SM++L  ISAFSLFRLYG NK
Sbjct  136  GMIGRAGQAELQWMKVCNMYGKFCNRMGEGIGSALVVSLSMVVLSCISAFSLFRLYGSNK  195

Query  208  SKCNG  194
            +K  G
Sbjct  196  NKHAG  200



>ref|XP_009133041.1| PREDICTED: CASP-like protein 1 [Brassica rapa]
Length=199

 Score =   230 bits (586),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -1

Query  742  GSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  563
            G+ +K+ D++VRL ELI RC++C LA++ A+L+ TD+QV+E+F+I+KKAK+TDMKALV L
Sbjct  15   GAPMKLNDRKVRLTELILRCLVCALALISAILVATDTQVKEVFTIQKKAKYTDMKALVLL  74

Query  562  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  383
            V+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGDQ +AYL++ +V AAAQSA 
Sbjct  75   VVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQAVAYLTVASVGAAAQSAA  134

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
            +AK+G+ ELQWM+IC MYGKFCNQVGEGIA++L+  I M+++  ISAF LFRLYG NK++
Sbjct  135  FAKLGEPELQWMKICTMYGKFCNQVGEGIATALLASIGMVMISCISAFGLFRLYGGNKAR  194



>gb|EPS67628.1| hypothetical protein M569_07146 [Genlisea aurea]
Length=205

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 157/187 (84%), Gaps = 5/187 (3%)
 Frame = -1

Query  745  HGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  566
            HG+ L+ VD+++RL EL+ RCVI G+AIV  VLI TD+QV+EIFSIRK+A+FTDMK L+F
Sbjct  17   HGNNLREVDRKIRLVELVLRCVIFGVAIVSTVLIATDTQVKEIFSIRKRARFTDMKVLIF  76

Query  565  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ---LMaylslgavaaaa  395
            +V+ N LAA YSLVQLVRC VSMI+GSVLF+KPLAWAIFSGDQ   ++AYL L AVAA+ 
Sbjct  77   MVVVNVLAAGYSLVQLVRCGVSMIKGSVLFSKPLAWAIFSGDQNVEILAYLMLSAVAASL  136

Query  394  qsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGD  215
            QSA+YA+ G+++LQWM+ CN+Y KFCN++GEGI  +++VC+SM+ L GISAFSLFRLY D
Sbjct  137  QSAIYAQYGEADLQWMKTCNLYKKFCNRMGEGIVGAVLVCLSMVCLSGISAFSLFRLYDD  196

Query  214  NKS--KC  200
            + S  KC
Sbjct  197  DSSTGKC  203



>gb|KEH36968.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=181

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +KV+D+RVR+ EL+ R V  GL ++  VLI TDSQVRE F+I+KKAKFTDMKALVFLV+A
Sbjct  1    MKVLDRRVRITELVLRFVNLGLGVLAVVLIVTDSQVREFFTIQKKAKFTDMKALVFLVVA  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            N +AA YSL+Q +RC VSMI+GSVLFNKPLAWAIFS DQ+MAY+++ AV+AAAQSAV+AK
Sbjct  61   NAIAAGYSLIQGLRCVVSMIKGSVLFNKPLAWAIFSCDQVMAYITVAAVSAAAQSAVFAK  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
            +GQ +LQWM+ICNMYGKFCNQVGEG+AS+ +V +SM+++  ISAFSLFRLYG +K K
Sbjct  121  MGQEQLQWMKICNMYGKFCNQVGEGLASAFLVSLSMVVVSCISAFSLFRLYGGSKIK  177



>gb|KFK36471.1| hypothetical protein AALP_AA4G129000 [Arabis alpina]
Length=199

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            + G+ +K+ D++VRL EL+ RC +C LA++ A+LI TD QVREIF+I+KKAK+TDMKALV
Sbjct  13   FTGTKVKLFDRKVRLTELVLRCSVCVLALISAILIATDVQVREIFTIQKKAKYTDMKALV  72

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
             LV+ NG+AAAYSLVQ+VRC V +++G+VLF+KPLAWAIF GDQ +AYL +  +AAAAQS
Sbjct  73   LLVVVNGIAAAYSLVQVVRCVVGLMKGNVLFSKPLAWAIFFGDQAVAYLCVAGIAAAAQS  132

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A +AK+G+ ELQWM+ICNMYGKFCNQVGEGIAS+L   I M+++  ISAF LFRLYG NK
Sbjct  133  AAFAKLGEPELQWMKICNMYGKFCNQVGEGIASALFASIGMVMISCISAFGLFRLYGGNK  192

Query  208  SKCNGR  191
             + + R
Sbjct  193  IRPSSR  198



>ref|NP_565822.1| CASP-like protein [Arabidopsis thaliana]
 sp|Q8L924.2|CSPL7_ARATH RecName: Full=CASP-like protein 2B2; Short=AtCASPL2B2 [Arabidopsis 
thaliana]
 gb|AAL58928.1|AF462840_1 unknown protein [Arabidopsis thaliana]
 gb|AAD15439.2| expressed protein [Arabidopsis thaliana]
 gb|AAM70533.1| At2g35760/T20F21.5 [Arabidopsis thaliana]
 gb|AEC09157.1| CASP-like protein [Arabidopsis thaliana]
Length=201

 Score =   225 bits (574),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -1

Query  739  SXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLV  560
            + +K++D++VR+ ELI RC++C LA+V A+LI TD QVREIF I+KKAKFTDMKALV LV
Sbjct  18   TKMKLIDRKVRVTELILRCLVCVLALVAAILIATDVQVREIFMIQKKAKFTDMKALVLLV  77

Query  559  IANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  380
            + NG+AA YSLVQ VRC V +++G VLF+KPLAWAIF GDQ +AYL +  VAAAAQSA +
Sbjct  78   VVNGIAAGYSLVQAVRCVVGLMKGRVLFSKPLAWAIFFGDQAVAYLCVAGVAAAAQSAAF  137

Query  379  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKC  200
            AK+G+ ELQWM+ICNMYGKFCNQVGEGIAS+L  CI M+++  ISAF +FRLYG +KS+ 
Sbjct  138  AKLGEPELQWMKICNMYGKFCNQVGEGIASALFACIGMVLISCISAFGVFRLYGGSKSRP  197

Query  199  NGR  191
            + R
Sbjct  198  SSR  200



>emb|CDY69773.1| BnaAnng31470D [Brassica napus]
Length=200

 Score =   225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  742  GSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  563
            G+ +K+ D++VRL ELI RC++C LA++ A+L+ TD+QV+E+F+I+KKAK+TDMKALV L
Sbjct  15   GAPMKLNDRKVRLTELILRCLVCALALISAILVATDTQVKEVFTIQKKAKYTDMKALVLL  74

Query  562  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-QLMaylslgavaaaaqsa  386
            V+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q +AYL++ +V AAAQSA
Sbjct  75   VVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQQAVAYLTVASVGAAAQSA  134

Query  385  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
             +AK+G+ ELQWM+IC MYGKFCNQVGEGIA++L+  I M+++  ISAF LFRLYG NK+
Sbjct  135  AFAKLGEPELQWMKICTMYGKFCNQVGEGIATALLASIGMVMISCISAFGLFRLYGGNKA  194

Query  205  K  203
            +
Sbjct  195  R  195



>gb|AAM66995.1| unknown [Arabidopsis thaliana]
Length=201

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -1

Query  739  SXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLV  560
            + +K++D++VR+ ELI RC++C L++V A+LI TD QVREIF I+KKAKFTDMKALV LV
Sbjct  18   TKMKLIDRKVRVTELILRCLVCVLSLVSAILIATDVQVREIFMIQKKAKFTDMKALVLLV  77

Query  559  IANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  380
            + NG+AA YSLVQ VRC V +++G VLF+KPLAWAIF GDQ +AYL +  VAAAAQSA +
Sbjct  78   VVNGIAAGYSLVQAVRCVVGLMKGRVLFSKPLAWAIFFGDQAVAYLCVAGVAAAAQSAAF  137

Query  379  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKC  200
            AK+G+ ELQWM+ICNMYGKFCNQVGEGIAS+L  CI M+++  ISAF +FRLYG +KS+ 
Sbjct  138  AKLGEPELQWMKICNMYGKFCNQVGEGIASALFACIGMVLISCISAFGVFRLYGGSKSRP  197

Query  199  NGR  191
            + R
Sbjct  198  SSR  200



>ref|XP_009141516.1| PREDICTED: CASP-like protein 1 [Brassica rapa]
Length=184

 Score =   223 bits (568),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K+ +++VRL ELI RC++C LA+V A+LI TD+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKINERKVRLTELILRCLVCALALVAAILIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AAAYSLV + RC V M++GSVLF+KPLAWAIFSGDQ +AYL++  +AAAAQSA +AK
Sbjct  61   NGIAAAYSLVHVARCVVGMMKGSVLFSKPLAWAIFSGDQAIAYLTVAGLAAAAQSAAFAK  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
            +GQ ELQWM+IC MYG+FCNQVGEGI  +L+  + M+++  ISA  LFRLYG NK+
Sbjct  121  LGQPELQWMKICTMYGRFCNQVGEGIGVALLASVGMVLISCISALGLFRLYGGNKA  176



>ref|XP_010686644.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686645.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686646.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
Length=203

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  748  YHGSX-LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKAL  572
            +HGS   K V+++V++AEL+ R +I GL ++ A LIG DS+V+ IFSI KKAKFTDMKAL
Sbjct  16   HHGSYNAKAVERKVKIAELVLRVLILGLGVLAAALIGFDSEVKVIFSITKKAKFTDMKAL  75

Query  571  VFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaq  392
            VFLVI +G+ AAYSLVQ+VRC + MIRGSVLF+KPLAW IFSGDQ MAYL+L AVAAAA+
Sbjct  76   VFLVIVDGIVAAYSLVQVVRCIMGMIRGSVLFSKPLAWIIFSGDQAMAYLTLAAVAAAAE  135

Query  391  savyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
            S+V  K GQ ELQWM+ C+ YGKFCNQ+GEGIASS++V +  ++L  ISA+SLFRLYG N
Sbjct  136  SSVIGKFGQPELQWMKTCDFYGKFCNQIGEGIASSVVVSLCTLVLSCISAYSLFRLYGGN  195

Query  211  KSKCNGR  191
            K K N R
Sbjct  196  KGKSNTR  202



>emb|CDY71930.1| BnaCnng75140D [Brassica napus]
Length=185

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K+ +++VRLAELI RC++C LA+V AVLI TD+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKLNERKVRLAELILRCLVCALALVAAVLIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-QLMaylslgavaaaaqsavyA  377
            NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q +AYL++  +AAAAQSA +A
Sbjct  61   NGMAAAYSLVHAVRCVVGMMKGSVLFSKPLAWAIFSGDQQAIAYLTVAGLAAAAQSAAFA  120

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
            K+GQ ELQWM+IC MYGKFCNQVGEGI  +L+  + M+++  ISA  +FRLYG NK+
Sbjct  121  KLGQPELQWMKICTMYGKFCNQVGEGIGVALLASVGMVLISCISALGVFRLYGGNKA  177



>emb|CDX79621.1| BnaC03g19570D [Brassica napus]
Length=200

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  742  GSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  563
            G+  K+ + +VRL ELI RC +C LA++ A+L+ TD+QV+E+F+I+KKAK+TDMKALV L
Sbjct  15   GAPTKLNEGKVRLTELILRCFVCALALISAILVATDTQVKEVFTIQKKAKYTDMKALVLL  74

Query  562  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-QLMaylslgavaaaaqsa  386
            V+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q +AYL++ +V AAAQSA
Sbjct  75   VVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQQAVAYLTVASVGAAAQSA  134

Query  385  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
             +AK+G  ELQWM+IC MYGKFCNQVGEGIA++L+  I M+++  ISAF LFRLYG NK+
Sbjct  135  AFAKLGNPELQWMKICTMYGKFCNQVGEGIATALLASIGMVMISCISAFGLFRLYGGNKA  194

Query  205  K  203
            +
Sbjct  195  R  195



>emb|CDY40441.1| BnaA04g20760D [Brassica napus]
Length=185

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K+ +++VRL ELI RC++C LA+V A+LI TD+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKINERKVRLTELILRCLVCALALVSAILIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-QLMaylslgavaaaaqsavyA  377
            NG+AAAYSLV + RC V M++GSVLF+KPLAWAIFSGD Q +AYL++  +AAAAQSA +A
Sbjct  61   NGIAAAYSLVHVARCVVGMMKGSVLFSKPLAWAIFSGDQQAIAYLTVAGLAAAAQSAAFA  120

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
            K+GQ ELQWM+IC MYG+FCNQVGEGI  +L+  + M+++  ISA  LFRLYG NK+
Sbjct  121  KLGQPELQWMKICTMYGRFCNQVGEGIGVALLASVGMVLISCISALGLFRLYGGNKA  177



>ref|XP_007147633.1| hypothetical protein PHAVU_006G141200g [Phaseolus vulgaris]
 gb|ESW19627.1| hypothetical protein PHAVU_006G141200g [Phaseolus vulgaris]
Length=179

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = -1

Query  721  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  542
            D+R+R+ EL+ RCVI GL ++ AVL+GTDSQV+E FSI+K AKFTDMKALVFLV+ANGLA
Sbjct  3    DRRIRITELVLRCVILGLGVLAAVLVGTDSQVKEFFSIQKTAKFTDMKALVFLVVANGLA  62

Query  541  AAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQS  362
            A +SL+Q + C + ++RG  L +KPLAW IFSGDQ+MAY+++ AVAAA QS + AK+GQ 
Sbjct  63   AGFSLLQGLHCIICVVRGRTLLSKPLAWVIFSGDQVMAYVTVAAVAAAGQSGMLAKVGQP  122

Query  361  ELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
            ELQWM +CNMYGKFCNQVGEGIAS+  V +SM++L  ISAFSLFRLYG N+ K
Sbjct  123  ELQWMELCNMYGKFCNQVGEGIASAFGVSLSMVVLSCISAFSLFRLYGGNRMK  175



>ref|XP_002879572.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7LIK3.1|CSPL3_ARALL RecName: Full=CASP-like protein 2B2; Short=AlCASPL2B2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH55831.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=201

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = -1

Query  739  SXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLV  560
            + +K++D++VR+ ELI R ++C  A+V A+L+ TD QVREIF+I+KKAKFTDMKALVFLV
Sbjct  18   TKMKLIDRKVRVTELILRSLVCAFALVAAILVATDVQVREIFTIQKKAKFTDMKALVFLV  77

Query  559  IANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  380
            + NG+AA YSLVQ V C V +++GSVL ++PLAWAIF GDQ +AYL +  VAAAAQSA +
Sbjct  78   VINGIAAGYSLVQAVCCLVGLMKGSVLLSEPLAWAIFFGDQAVAYLCVAGVAAAAQSAAF  137

Query  379  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKC  200
            AK+GQ ELQWM+IC+MYGKFCNQVGEGIAS+L  CI M+++  ISAF +FRLYG +K + 
Sbjct  138  AKLGQPELQWMKICDMYGKFCNQVGEGIASALFACIGMVLISCISAFGVFRLYGGSKPRQ  197

Query  199  NGR  191
            + R
Sbjct  198  SSR  200



>gb|KFK26539.1| hypothetical protein AALP_AA8G262200 [Arabis alpina]
Length=195

 Score =   212 bits (540),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS +KV+D+RVRL EL+ RC I  L+++  +L+ TDSQV++IF+I KKAK+T+MKALV
Sbjct  9    YHGSKMKVIDRRVRLTELLLRCSISCLSLLALILVVTDSQVKQIFTIEKKAKYTEMKALV  68

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV ANG+AA YSL+Q VRC V  ++GSVL +KPLAWAIFS DQ +AY+S+ A+AAAA+S
Sbjct  69   FLVAANGIAAVYSLLQSVRCYVGSVKGSVLCSKPLAWAIFSADQAIAYISVAAIAAAAES  128

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V A  G+ ELQWM++CNM+GKFCN+V EG+AS+L+  I+M+++  ISAF LFRLYG NK
Sbjct  129  GVIAMKGEDELQWMKLCNMFGKFCNRVAEGVASALLAAIAMVLVSCISAFGLFRLYGANK  188

Query  208  SK  203
             +
Sbjct  189  DR  190



>ref|XP_009407837.1| PREDICTED: CASP-like protein 2B1 [Musa acuminata subsp. malaccensis]
Length=202

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            Y G  L+ V +R+ +AE++ RC ICGL ++ A LIG+ +QVRE FS+ KKA+FTDMKALV
Sbjct  16   YGGGKLRAVGRRMEVAEVVLRCAICGLGVLAAALIGSATQVREFFSVEKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AA YSLVQ VRC VS+I+G VL  K LAWAIFS DQ +AY++  A+AAAA++
Sbjct  76   FLVVANGIAAGYSLVQGVRCVVSIIKGGVLLKKALAWAIFSCDQALAYVASAAIAAAAEA  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A   + GQ+ELQWM++CN+YGKFC QVGEGIAS+ + C+ ++I+  +SAF+LFRLYG  K
Sbjct  136  AELGQSGQAELQWMKLCNLYGKFCTQVGEGIASAFLACLCLVIVSSMSAFNLFRLYGRTK  195

Query  208  SKCNG  194
             + +G
Sbjct  196  EQNSG  200



>ref|XP_006295017.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 ref|XP_006295018.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 gb|EOA27915.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 gb|EOA27916.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
Length=200

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -1

Query  739  SXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLV  560
            + +K++D++VR+AELI RC +C LA+V A+LI TD QVREIF I+KKAK+T+MKALVF+V
Sbjct  19   TKMKLIDRKVRVAELILRCSVCALALVAAILIVTDVQVREIFMIKKKAKYTNMKALVFMV  78

Query  559  IANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  380
            + NG+AA YSLVQ VRC V +++G VL +KPLAWAIFSGDQ ++YL +  VAAAAQSA +
Sbjct  79   VVNGIAAGYSLVQAVRCVVGLMKGDVLLSKPLAWAIFSGDQAVSYLCVAGVAAAAQSAAF  138

Query  379  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
            AK+G+ +LQWM+IC MY KFC QVGEGIAS+L  C+ M+++  ISAF +FRLYG +K++
Sbjct  139  AKLGEPDLQWMKICGMYWKFCIQVGEGIASALFACVGMVLISCISAFGVFRLYGGSKTR  197



>ref|XP_010907052.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=200

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            Y G  LK V++RV++AE++ R VI GL ++ A L+ +D+QV  IFS+ KKAKFTDMKALV
Sbjct  16   YGGGHLKAVERRVKVAEVVLRWVIFGLGVLAAALVASDTQVTNIFSLEKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIAN +AA YSL+Q +RC+VSMI+GSVLF+K LA  IFS DQ+MAY++L AVAAAAQS
Sbjct  76   FLVIANAIAAGYSLIQGLRCAVSMIKGSVLFDKALALVIFSCDQVMAYVTLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV  + GQSELQWM++CN+Y +FC++VGEGI SS +V + M+ L G+SAF+LFRL+G+NK
Sbjct  136  AVLGEFGQSELQWMKLCNLYRRFCSRVGEGILSSFVVSLGMVSLSGLSAFNLFRLFGNNK  195

Query  208  SKCNG  194
             K  G
Sbjct  196  GKTRG  200



>ref|XP_008800613.1| PREDICTED: CASP-like protein GSVIVT00013502001 [Phoenix dactylifera]
Length=201

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            Y G  LK V++R+++AE++ R VI GL ++ A L+ +D+QV+ IFS++KKAKFTD+KALV
Sbjct  16   YGGGHLKAVERRMKVAEVVLRWVIFGLGVLAAALVASDTQVKNIFSVQKKAKFTDIKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVIA+ +AA YSL+Q +RC V+MI+G+VLFNK LA  IFS DQ+MAY++L AVAAAAQS
Sbjct  76   FLVIADAIAAGYSLIQGLRCVVNMIKGNVLFNKALALVIFSCDQVMAYVTLAAVAAAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV  + GQSELQWM++CN+Y KFC+QVGEGI SS +V + M+ L G+SAF+LFRL+G+NK
Sbjct  136  AVLGEFGQSELQWMKLCNLYNKFCSQVGEGILSSFVVSLGMVSLSGLSAFNLFRLFGNNK  195

Query  208  SKCNG  194
             K +G
Sbjct  196  GKSSG  200



>ref|XP_009414753.1| PREDICTED: CASP-like protein 2B1 [Musa acuminata subsp. malaccensis]
Length=202

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            Y G  L  V++R+++AE++ RC+ C   ++ AVL+G+D+QVRE FS+ KKAKFTDMKALV
Sbjct  16   YGGGKLMAVERRMKVAEVVLRCLSCAFGVIAAVLVGSDTQVREFFSVEKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AA YSL+ +VR  VSM++GSVLFNK LAWAIFS DQ++AYL+L AV+AAAQ+
Sbjct  76   FLVVANGIAAGYSLLMVVRSVVSMMKGSVLFNKALAWAIFSCDQVVAYLTLAAVSAAAQA  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A  ++ GQ+ELQWM++CN+Y KFCNQ G G+ S+ +  + M+ +  +SAF+LFRLYG NK
Sbjct  136  AELSQFGQTELQWMKVCNLYHKFCNQSGGGMVSAFLGSLCMVAVSSMSAFNLFRLYGKNK  195

Query  208  SKCNG  194
             K +G
Sbjct  196  GKRSG  200



>ref|XP_008463603.1| PREDICTED: CASP-like protein RCOM_0864260 [Cucumis melo]
 ref|XP_008463604.1| PREDICTED: CASP-like protein RCOM_0864260 [Cucumis melo]
Length=202

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS LKV DKRVR+ EL+ R VICGL ++ AVL+GTD++VR IF+IRK+AKFTDMKALV
Sbjct  16   YHGSNLKVFDKRVRVVELVLRFVICGLGVLAAVLVGTDTEVRTIFAIRKRAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+MAY+++ AVA+AAQS
Sbjct  76   FLVVANAVAAAYSLVQGLRCVVCMLRGKVLFSKPLAWIIFSGDQIMAYVTVAAVASAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+ K+GQ ELQWM+IC++Y KFCNQVGEG+AS+++V +SM++L  ISA SLFRLY   K
Sbjct  136  AVFGKLGQPELQWMKICDLYKKFCNQVGEGLASAVVVSLSMVVLSCISASSLFRLYNGGK  195

Query  208  SKCNGR  191
            +K N R
Sbjct  196  NKSNSR  201



>ref|XP_010509564.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D++VR+AELI RC +  LA++ A+LI TD QV+EIF I+KKAKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRVAELILRCSVFALALLAAILIVTDVQVKEIFMIKKKAKFTNMKALVFMVVV  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AA YSL+Q VRC V +++G+VL +KPLAWAIFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVGLMKGNVLLSKPLAWAIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  194
            +G+ ELQWM++C+MYGKFCNQVGEGIAS+L  CI M+++  ISAF +FRLYG +K++ + 
Sbjct  121  LGEPELQWMKVCDMYGKFCNQVGEGIASALFACIGMVLVSCISAFGVFRLYGGSKTRLSS  180

Query  193  R  191
            R
Sbjct  181  R  181



>ref|XP_004139530.1| PREDICTED: CASP-like protein GSVIVT00013502001-like [Cucumis 
sativus]
 gb|KGN65030.1| hypothetical protein Csa_1G181430 [Cucumis sativus]
Length=202

 Score =   202 bits (514),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS LKV DKRVR+ EL+ R +ICGL ++ AVL+GTD++V+ IF+IRK+A FTDMKALV
Sbjct  16   YHGSNLKVFDKRVRVVELVLRFLICGLGVLAAVLVGTDTEVKTIFTIRKRATFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+MAY+++ AVA+AAQS
Sbjct  76   FLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQIMAYVTVAAVASAAQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+ K+GQ ELQWM+IC++Y KFCNQVGEG+AS+++V +SM++L  ISA SLFRLY   K
Sbjct  136  AVFGKLGQPELQWMKICDLYKKFCNQVGEGLASAVVVSLSMVVLSCISASSLFRLYNGGK  195

Query  208  SKCNGR  191
            +K N R
Sbjct  196  NKSNSR  201



>ref|XP_004293384.1| PREDICTED: CASP-like protein 2B1 [Fragaria vesca subsp. vesca]
Length=205

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = -1

Query  739  SXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLV  560
            + LKV+D+RV++AEL+ R +ICGL +  A+L+ TD+QV+EIF ++KKAKFTDMKALVFLV
Sbjct  22   TNLKVIDRRVKVAELVLRFLICGLGLAAALLVATDTQVKEIFMVKKKAKFTDMKALVFLV  81

Query  559  IANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  380
            I NG+AAAYSL+Q +RC VSMI+G VLF+KPLAW IFS DQ++AY+++  V AAAQSA  
Sbjct  82   IVNGIAAAYSLLQALRCVVSMIKGIVLFSKPLAWMIFSADQVVAYVAVAEVGAAAQSAAL  141

Query  379  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKC  200
            AK+GQSELQWM+ICNMY KFC QVGEGIA S++V +S I++  ISAF+LFRLYG  K++ 
Sbjct  142  AKLGQSELQWMKICNMYDKFCTQVGEGIAISVLVGLSTILISCISAFNLFRLYGGGKNQS  201

Query  199  NGR  191
            + R
Sbjct  202  SSR  204



>ref|XP_006849031.1| hypothetical protein AMTR_s00028p00153320 [Amborella trichopoda]
 gb|ERN10612.1| hypothetical protein AMTR_s00028p00153320 [Amborella trichopoda]
Length=198

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH S L+VVD+RVR+AE++ RCVI GL ++ AVL+GTD+Q R+IFSI+KKAKFTDMKAL+
Sbjct  16   YHSSKLRVVDRRVRVAEVVLRCVISGLGLLAAVLVGTDTQTRQIFSIQKKAKFTDMKALM  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVI NG+ A+YSLVQ +RC+VSM++GSVLFNK LAWAIFS DQ+MAY SL A AAA QS
Sbjct  76   FLVIINGIVASYSLVQGLRCAVSMLKGSVLFNKSLAWAIFSCDQVMAYASLAAAAAATQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            A  A+ GQ ++QWM+ICN YGKFC QVG+GI S+ +V +SM+ L G+SAF+LFRLY   K
Sbjct  136  AAIAEKGQQDVQWMKICNFYGKFCTQVGDGIVSAFVVSLSMVTLSGLSAFNLFRLYNKGK  195



>ref|XP_002868133.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7M9V1.1|CSPL7_ARALL RecName: Full=CASP-like protein 2B1; Short=AlCASPL2B1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44392.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D+R+RL EL+ RC I   A++  +L+ TD++V+ IF+I+K AK+TDMKA+VFLV+A
Sbjct  1    MKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIKKTAKYTDMKAVVFLVVA  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAYL++ A+AA A+S V A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGRVLFSKPLAWAFFSGDQAMAYLNVAAIAATAESGVIAR  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             G+ +LQWMR+CNMYGKFCNQ+  G++S+L+  I+M+ +  ISAFSLFRLYG  + +
Sbjct  121  EGEEDLQWMRVCNMYGKFCNQMAIGVSSALLASIAMVFVSCISAFSLFRLYGATRDR  177



>ref|NP_567497.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8L9B5.1|CSPLP_ARATH RecName: Full=CASP-like protein 2B1; Short=AtCASPL2B1 [Arabidopsis 
thaliana]
 gb|AAM66067.1| unknown [Arabidopsis thaliana]
 gb|AAO41974.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04067.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83749.1| uncharacterized protein AT4G16442 [Arabidopsis thaliana]
Length=182

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D+R+RL EL+ RC I   A++  +L+ TD++V+ IF+I+K AK+TDMKA+VFLV+A
Sbjct  1    MKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIKKTAKYTDMKAVVFLVVA  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAYL++ A+AA A+S V A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGKVLFSKPLAWAFFSGDQAMAYLNVAAIAATAESGVIAR  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             G+ +LQWMR+C MYGKFCNQ+  G++S+L+  I+M+ +  ISAFSLFRLYG  K +
Sbjct  121  EGEEDLQWMRVCTMYGKFCNQMAIGVSSALLASIAMVFVSCISAFSLFRLYGATKDR  177



>ref|XP_010505095.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D++VR+AELI RC +  LA++ A+LI TD QV+EIF I+K+AKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRVAELILRCSVFALALLAAILIVTDVQVKEIFMIKKEAKFTNMKALVFMVVV  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AA YSL+Q VRC V +++G+VL +KPLAW IFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVGLMKGNVLLSKPLAWTIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  194
            +G  ELQWM++C+MYGKFCNQVGEGIASSL  C+ M+++  ISAF +FRLYG +K++ + 
Sbjct  121  LGVPELQWMKVCDMYGKFCNQVGEGIASSLFACVGMVLVSCISAFGVFRLYGGSKTRQSS  180

Query  193  R  191
            R
Sbjct  181  R  181



>ref|XP_010516779.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D++VR AELI RC +  LA++ A+LI TD QV+EIF I+KKAKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRAAELILRCSVFALALLAAILIVTDVQVKEIFMIKKKAKFTNMKALVFMVVV  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AA YSL+Q VRC V +++G+VL +KPLA AIFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVCLMKGNVLLSKPLAGAIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  194
            +G+ ELQWM++C+MYGKFCNQVGEGIAS+L  C+ M+++  ISAF +FRLYG +K++ + 
Sbjct  121  LGEPELQWMKVCDMYGKFCNQVGEGIASALFACVGMVLVSCISAFGVFRLYGGSKTRQSS  180

Query  193  R  191
            R
Sbjct  181  R  181



>emb|CDX90524.1| BnaA03g42570D [Brassica napus]
Length=208

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  745  HGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  566
            HG  +K++D++++L EL+ RC    LA++  +LI T++QV++IF+I K+AK+TDMKALVF
Sbjct  17   HGGKMKLIDRKLKLTELLLRCSATALALLALILIVTNTQVKQIFTIEKRAKYTDMKALVF  76

Query  565  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  386
            LV+ANG+AAAYSL+Q VRC V  ++GSVLFNKPLAWAIF  DQ        A  AA+  +
Sbjct  77   LVVANGIAAAYSLLQSVRCVVGSMKGSVLFNKPLAWAIFLSDQQAVAYMSVAAIAASAES  136

Query  385  vyAKI-GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
                I G+ ELQWM++CNM+GKFCN+   G AS+L+  ++M+ +  ISAFSLFRLYG
Sbjct  137  GLIGIRGEDELQWMKVCNMFGKFCNRAAGGTASALLASVAMVFVSSISAFSLFRLYG  193



>ref|XP_009124526.1| PREDICTED: CASP-like protein ARALYDRAFT_915107 [Brassica rapa]
Length=204

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG  +K++D+R+RL E++ RC +   A++  +L+ TD+QV+ IF + K+AK+TDMK+LV
Sbjct  16   YHGGKMKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIFVVEKRAKYTDMKSLV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFS DQ MAY+S+ A+AAA++S
Sbjct  76   FLVVANGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSVDQAMAYMSVAAIAAASES  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V    G+ +LQWM++CNMY KFC Q    +AS+ I  I+M+ +  ISAFSLFRLYG  +
Sbjct  136  GVIGIRGEEKLQWMKVCNMYSKFCYQGAGVVASASIASIAMVFVSCISAFSLFRLYGATQ  195

Query  208  SKCN  197
             + N
Sbjct  196  RRLN  199



>ref|XP_009136766.1| PREDICTED: CASP-like protein ARALYDRAFT_915107 [Brassica rapa]
Length=207

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -1

Query  745  HGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  566
            HG  +K++D+R++L EL+ RC    LA++  +LI T++QV++IF+I K+AK+TDMKALVF
Sbjct  17   HGGKMKLIDRRLKLTELLLRCSATALALLALILIVTNTQVKQIFTIEKRAKYTDMKALVF  76

Query  565  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  386
            LV+ANG+AAAYSL+Q VRC V  ++GSVLFNK LAWAIF  DQ +AY+S+ A+AA+A+S 
Sbjct  77   LVVANGIAAAYSLLQSVRCVVGSVKGSVLFNKSLAWAIFLSDQAVAYMSVAAIAASAESG  136

Query  385  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
            +    G+ ELQWM++CNM+GKFCN+   G AS+++  ++M+ +  ISAFSLFRLYG
Sbjct  137  LIGIRGEDELQWMKVCNMFGKFCNRAAGGTASAVLASVAMVFVSSISAFSLFRLYG  192



>emb|CDY70521.1| BnaCnng68730D, partial [Brassica napus]
Length=189

 Score =   186 bits (472),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG  +K++D+R+RL E++ RC +   A++  +L+ TD+QV+ IF + K+AK+TDMK+LV
Sbjct  1    YHGGKIKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIFVVEKRAKYTDMKSLV  60

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFSGDQ MAY+S+ A+AAAA+S
Sbjct  61   FLVVANGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSGDQAMAYMSVAAIAAAAES  120

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V    G+ +LQWM++CNMY KFCNQ    +AS+ I  I+M+I+  ISAFSLFRLYG  +
Sbjct  121  GVIGIRGEEKLQWMKVCNMYSKFCNQGAAVVASASIASIAMVIVSCISAFSLFRLYGATQ  180

Query  208  SKCN  197
             + N
Sbjct  181  RRLN  184



>emb|CDY34471.1| BnaC01g21620D [Brassica napus]
Length=206

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 137/183 (75%), Gaps = 1/183 (1%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG  +KVVD+R+RL EL+ RC +  LA +G +LI TD+QV++IF+I K+AK+T+MK+LV
Sbjct  16   YHGGKMKVVDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKKIFTIEKRAKYTNMKSLV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AA YSL+Q VRC +  ++GSVLF+K LAWAIFSGDQ        A  AAA  
Sbjct  76   FLVVANGIAAVYSLLQSVRCVMGSMKGSVLFSKSLAWAIFSGDQQAMAYMSVAAIAAASE  135

Query  388  avyAKI-GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
            +    I G+ ELQWM++CNM+GKFCN+   G+AS+++  ++M+++  ISAFSLFRLYG  
Sbjct  136  SGVIGIRGEEELQWMKVCNMFGKFCNRGAGGVASAMLASLAMVLVSCISAFSLFRLYGAT  195

Query  211  KSK  203
              +
Sbjct  196  TQR  198



>emb|CDY32244.1| BnaA01g17400D [Brassica napus]
Length=205

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG  +K++D+R+RL EL+ RC +  LA +G +LI TD+QV++IF+I K+AK+T+MK+LV
Sbjct  16   YHGGKMKLIDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKQIFTIEKRAKYTNMKSLV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AA YSL+Q VRC +  ++G VL NK LAWAIFSGDQ MAY+S+ A+AAA++S
Sbjct  76   FLVVANGIAAVYSLLQSVRCVMGSMKGDVLLNKSLAWAIFSGDQAMAYMSVAAIAAASES  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             V    G  ELQWM++CNM+GKFCN+   G+AS+++  ++M+++  ISAFSLFRLYG   
Sbjct  136  GVIGIRGDEELQWMKVCNMFGKFCNRGAGGVASAMLASVAMVLVSCISAFSLFRLYGATT  195

Query  208  SK  203
             +
Sbjct  196  QR  197



>ref|XP_009145991.1| PREDICTED: LOW QUALITY PROTEIN: CASP-like protein ARALYDRAFT_915107 
[Brassica rapa]
Length=203

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG  +K++D+R+RL EL+ RC +  LA +G +LI TD+QV++IF++ K+AK+T+MK+LV
Sbjct  16   YHGGKMKLIDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKQIFTVEKRAKYTNMKSLV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AA YSL+Q VRC +  ++G VL NK LAWAIFSGDQ MAY+S+ A+AAA++S
Sbjct  76   FLVVANGIAAVYSLLQSVRCVMGSMKGDVLLNKSLAWAIFSGDQAMAYMSVAAIAAASES  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             V    G+ ELQWM++CNM+GKFCN+   G+AS+++  ++M+++  ISAFSLFRLYG
Sbjct  136  GVIGIRGEEELQWMKVCNMFGKFCNRGAGGVASAMLASVAMVLVSCISAFSLFRLYG  192



>emb|CDY71889.1| BnaAnng39180D [Brassica napus]
Length=184

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 136/179 (76%), Gaps = 0/179 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D+R+RL E++ RC +   A++  +L+ TD+QV+ IF + K+AK+TDMK+LVFLV+A
Sbjct  1    MKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIFVVEKRAKYTDMKSLVFLVVA  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFS DQ MAY+S+ A+AAA++S V   
Sbjct  61   NGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSVDQAMAYMSVAAIAAASESGVIGI  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCN  197
             G+ +LQWM++CNMY KFC Q    +AS+ I  I+M+ +  ISAFSLFRLYG  + + N
Sbjct  121  RGEEKLQWMKVCNMYSKFCYQGAGVVASASIASIAMVFVSCISAFSLFRLYGATQRRLN  179



>emb|CDY09694.1| BnaC07g33670D [Brassica napus]
Length=206

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -1

Query  745  HGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  566
            HG  +K++D++++L E++ RC    LA++  +LI TD+QV++IF+I K+AK+TDMKALVF
Sbjct  17   HGGKMKLIDRKLKLTEVLLRCSATALALLALILIVTDTQVKKIFTIEKRAKYTDMKALVF  76

Query  565  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  386
            LV+ANG+ AAYSL+Q VRC V  ++GSVL NK LAWAIF  DQ        A  AA+  +
Sbjct  77   LVVANGITAAYSLLQSVRCVVGSMKGSVLLNKSLAWAIFLSDQQAMAYMSVAAIAASAES  136

Query  385  vyAKI-GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
                I G+ +LQWM++CNM+GKFCN+   G AS+L+  I+M+ +  ISAFSLFRLYG
Sbjct  137  GLIGIRGEEKLQWMKVCNMFGKFCNRAAGGTASALLASIAMVFVSSISAFSLFRLYG  193



>ref|XP_008791870.1| PREDICTED: CASP-like protein RCOM_0864260 [Phoenix dactylifera]
Length=188

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -1

Query  742  GSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  563
            G   K V++++R+ E+  RCVICGLA++ A L+GTD+Q R I  + +KAKFTDMKA VFL
Sbjct  10   GGRWKAVERKLRVGEVALRCVICGLAVLVAALVGTDTQTRRIVYLERKAKFTDMKASVFL  69

Query  562  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  383
            VI NG+AA YSL+Q +RC V++ +GSVL NKP AW IF  DQ+MAY+S+ AVAA+AQS +
Sbjct  70   VIFNGIAACYSLIQGLRCIVNVTKGSVLLNKPFAWLIFLCDQVMAYVSVAAVAASAQSGL  129

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             A+ GQ ELQWM++C++Y  FC + G G+A + +V   ++IL  ISAF+LFRLYG+NK
Sbjct  130  LAQFGQPELQWMKLCDLYRGFCIKAGCGLAIAFVVTSCILILSCISAFNLFRLYGNNK  187



>ref|XP_006414349.1| hypothetical protein EUTSA_v10026264mg [Eutrema salsugineum]
 gb|ESQ55802.1| hypothetical protein EUTSA_v10026264mg [Eutrema salsugineum]
Length=205

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG  +K++D+R+RL EL+ RC +    ++  +L+ TD+QV+ IF+I ++AK+TDMKALV
Sbjct  16   YHGGKMKLIDRRLRLTELLLRCSVTVFTLLALILVVTDTQVKHIFTIERRAKYTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+AA YSL+  VRC V  ++GSVLF+KPLAWAIFSGDQ MAY+ + A+AAAA+S
Sbjct  76   FLVVANGIAAVYSLLHSVRCLVGSMKGSVLFSKPLAWAIFSGDQAMAYMCVAAIAAAAES  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             +  + G+ +LQWM++CNMYGKFC+ +  G+A +L+  I+M+ +  ISAFSLFRLYG   
Sbjct  136  GLIGREGEEKLQWMKLCNMYGKFCDWMSVGVAIALLASIAMVFVSCISAFSLFRLYGGAT  195

Query  208  SK  203
             +
Sbjct  196  QR  197



>ref|XP_010917254.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=196

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            +       ++ R+R+ E+  RCV+CGLA++ A L+GTD+QV++I  + +KAKFTDMKA V
Sbjct  16   HRNGRWNALEGRLRVGEVALRCVVCGLAVLVAALVGTDTQVKKIVFVERKAKFTDMKASV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLVI NG+AA YSL+Q +RC V++IRG+VL NKP+AW IFS DQ+MAY+S+ AVAA  QS
Sbjct  76   FLVIFNGIAACYSLIQGLRCVVTLIRGNVLLNKPVAWLIFSCDQVMAYVSVAAVAATTQS  135

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             + A+ GQ ELQWM++C+MY  FC + G G+  + +V   ++IL  ISAF+LFRLYG+NK
Sbjct  136  GLLAEFGQPELQWMKLCDMYRGFCIKAGCGLMIAFVVTCCILILSCISAFNLFRLYGNNK  195



>ref|XP_010440155.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D+R+RL EL+ R  I  LA++G +LI TDS+V+ IF+I+K AK++DMK++VFLV+A
Sbjct  1    MKLIDRRLRLTELLLRISISVLALLGLILIVTDSEVKLIFTIKKTAKYSDMKSVVFLVVA  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AA YSL+Q VRC V  ++G+VLF+KPLAW IFSGDQ+MAYLS+ A+AA A+S + A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGTVLFSKPLAWTIFSGDQVMAYLSVAAIAATAESGMIAR  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             G+ +LQW+++CNMYGKFCN++  G++S+L   I+M+ +  +SAFSLFRLYG  K +
Sbjct  121  EGEEDLQWIKVCNMYGKFCNRMAIGVSSALFASIAMVFVSCMSAFSLFRLYGATKDR  177



>ref|XP_010434824.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D+R+RL EL+ R  I  LA++G +LI TDS+V+ IF+I+K AK++DMK++VFLV+A
Sbjct  1    MKLIDRRLRLTELLLRISISVLALLGLILIVTDSEVKLIFTIKKTAKYSDMKSVVFLVVA  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+AA YSL+Q VRC V  ++G+VLF+KPLAW IFS DQ+MAYLS+ A+AA A+S + A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGTVLFSKPLAWTIFSADQVMAYLSVAAIAATAESGMIAR  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             G+ +LQW+++CNMYGKFCN++  G++S+L   I+M+ +  ISAFSLFRLYG  K +
Sbjct  121  EGEEDLQWIKVCNMYGKFCNRMAIGVSSALFASIAMVFVSCISAFSLFRLYGATKDR  177



>ref|XP_010647129.1| PREDICTED: CASP-like protein 2B1 [Vitis vinifera]
Length=189

 Score =   176 bits (445),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKVVD+RVRLAEL+ RCVICGL I+ AVL+GTD+QV+ IF+I+KKAKFTDMKALV
Sbjct  16   YHGTNLKVVDRRVRLAELVLRCVICGLGILAAVLVGTDTQVKVIFTIQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  434
            FLVIANG+AAAYSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQL
Sbjct  76   FLVIANGIAAAYSLIQGLRCVVSMVRGSVLFSKPLAWAIFSGDQL  120



>ref|XP_010449792.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -1

Query  670  LAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  491
            L+++  +LI TDS+V+ IF+I+KKAK++DMK++VFLV+ANG+AA YSL+Q VRC V  ++
Sbjct  22   LSLLALILIVTDSEVKLIFTIKKKAKYSDMKSVVFLVVANGIAAVYSLLQSVRCVVGTMK  81

Query  490  GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQ  311
            G+VLF+KPLAW IFSGDQ MAYLS+ A+AA A+S + A+ G+ +LQW+++CNMYGKFCN+
Sbjct  82   GTVLFSKPLAWTIFSGDQAMAYLSVAAIAATAESGMIAREGEEDLQWIKVCNMYGKFCNR  141

Query  310  VGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
            +  G++S+L   I+M+ +  ISAFSLFRLYG  K +
Sbjct  142  MAIGVSSALFASIAMVFVSCISAFSLFRLYGATKDR  177



>sp|B8LQF9.1|CSPL9_PICSI RecName: Full=CASP-like protein 2BC2; Short=PsCASPL2BC2 [Picea 
sitchensis]
 gb|ABR17889.1| unknown [Picea sitchensis]
Length=238

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V+KR+++ E+I R  +  LA+V AV +GTD+Q R IF+I KKAK++DMKALVFLV+ NG+
Sbjct  63   VEKRLKIGEVILRFAMIALALVAAVRVGTDTQTRTIFTIEKKAKYSDMKALVFLVVMNGI  122

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A+YSL+Q +RC +S+   S L +KPLAW IF+ DQ MAY SL A AAAA+SA  A+ GQ
Sbjct  123  VASYSLLQGLRCVLSIYTQSPLTSKPLAWLIFALDQTMAYFSLAAAAAAAESAYLAERGQ  182

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
            +E QWM++C  Y KFC+Q+GEG+ S+ +V +SM  + G+SA+ LFRLYG  
Sbjct  183  TEFQWMKVCIFYEKFCHQIGEGLVSTFLVSLSMATVSGMSAYHLFRLYGSK  233



>ref|XP_006284611.1| hypothetical protein CARUB_v10005842mg [Capsella rubella]
 gb|EOA17509.1| hypothetical protein CARUB_v10005842mg [Capsella rubella]
Length=182

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K++D R+RL EL+ R  I  L+++  +LI TDS+V+ IF+I+K AK+TDMK++VFLV+A
Sbjct  1    MKLIDGRLRLTELLLRISISVLSLLALILIVTDSEVKLIFTIKKAAKYTDMKSVVFLVVA  60

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NG+A  YSL+Q VRC V  ++G+VLF+KPLAW IFSGDQ +AYLS+ A+A  A+S + A+
Sbjct  61   NGIATVYSLLQSVRCVVGKMKGTVLFSKPLAWTIFSGDQALAYLSVAAIATTAESGMIAR  120

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             G+ +LQW+++CNMYGKFCN++  G+AS+L   I+M+ +  ISAFSLFRLYG  K +
Sbjct  121  EGEEDLQWIKVCNMYGKFCNRMTVGVASALFASIAMVFISCISAFSLFRLYGATKDR  177



>gb|KJB67397.1| hypothetical protein B456_010G188700 [Gossypium raimondii]
Length=132

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHG+ LKV+D+RVR+AEL+ RC+ICGL+++ AVL+GTD+Q++EIF+I+KKA+FTDMKALV
Sbjct  16   YHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIFTIQKKARFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  437
            FLV ANG+ AAYSLVQ VRC V M+RGSVLF+KPLA+AIFSGDQ
Sbjct  76   FLVAANGITAAYSLVQGVRCVVGMVRGSVLFSKPLAFAIFSGDQ  119



>gb|EMT22476.1| hypothetical protein F775_11012 [Aegilops tauschii]
Length=306

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
             ++++++ EL+ RC++ G   V A L+ TDSQ R  FS+ ++AK+TDMKALV LV ANG 
Sbjct  67   AERKMKVWELVLRCLVGGFGAVAAALVVTDSQTRTFFSLERRAKYTDMKALVLLVAANGA  126

Query  544  AAAYSLVQLVRCSVSMIRGS---VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            A  YSL+Q  RC+V+M RG    V+ ++ LAW++FSGDQL+AY  L A AAA QS++  K
Sbjct  127  AVGYSLLQAARCAVAMARGGGALVMSSRALAWSVFSGDQLLAYAMLAATAAALQSSLLGK  186

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  194
            +GQ ELQWM IC +YG FC QVG GIA +++  ++ ++L   SAF+LFRLYG NK   + 
Sbjct  187  LGQPELQWMGICGLYGAFCRQVGAGIACAVVAGLAAVLLASFSAFNLFRLYGGNKGSSST  246

Query  193  R  191
            R
Sbjct  247  R  247



>ref|XP_009374906.1| PREDICTED: LOW QUALITY PROTEIN: CASP-like protein RCOM_0864260 
[Pyrus x bretschneideri]
Length=168

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 121/153 (79%), Gaps = 2/153 (1%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKV D++VR+AEL+ RC+ICGL +V A L+GTD++V+EIF+++KK KF DMKALV
Sbjct  16   YHSTNLKVNDRKVRVAELVLRCLICGLGVVAAALVGTDTEVKEIFTVQKKXKFIDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+ANG+ AA SLVQ++RC VSM+RG+VL +   +  I   + +M  + + AV AAAQS
Sbjct  76   FLVVANGMVAACSLVQVIRCVVSMVRGNVLGS--FSLGIRQSESVMVCVCVAAVGAAAQS  133

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIAS  290
            AV AK+GQ ELQWM+ICNMY +FCNQVGE + +
Sbjct  134  AVLAKLGQPELQWMKICNMYDEFCNQVGEELPA  166



>ref|XP_008384166.1| PREDICTED: CASP-like protein GSVIVT00013502001 isoform X2 [Malus 
domestica]
Length=161

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKV D+R+R+AEL+ RC+ICGL +V A L+GTD+QV+EIF+++KKAKFTDMKALV
Sbjct  16   YHSTNLKVNDRRLRVAELVLRCLICGLGVVAAALVGTDTQVKEIFTVQKKAKFTDMKALV  75

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  434
            FLV+ANG+ +AYSLVQ+VRC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  76   FLVVANGIVSAYSLVQVVRCVVSMVRGNVLFSKPIAWIIFSGDQI  120



>emb|CAB10420.1| LET1 like protein [Arabidopsis thaliana]
 emb|CAB78686.1| LET1 like protein [Arabidopsis thaliana]
Length=578

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -1

Query  739  SXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLV  560
            S +K++D+R+RL EL+ RC I   A++  +L+ TD++V+ IF+I+K AK+TDMKA+VFLV
Sbjct  122  SKMKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIKKTAKYTDMKAVVFLV  181

Query  559  IANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  380
            +ANG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAYL++ A+AA A+S V 
Sbjct  182  VANGIAAVYSLLQSVRCVVGTMKGKVLFSKPLAWAFFSGDQAMAYLNVAAIAATAESGVI  241

Query  379  AKIGQSELQWMRICNMYGKFCNQVGEGIASSL  284
            A+ G+ +LQWMR+C MYGKFCNQ+  G++S+ 
Sbjct  242  AREGEEDLQWMRVCTMYGKFCNQMAIGVSSAF  273



>dbj|BAK05387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 131/187 (70%), Gaps = 3/187 (2%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            +++++++ EL+ RC++ G   V A L+ TDSQ R  FS+ ++AK+TDMKALV LV ANG 
Sbjct  5    LERKMKVWELVLRCLVGGFGAVAAALVVTDSQTRTFFSLERRAKYTDMKALVLLVAANGA  64

Query  544  AAAYSLVQLVRCSVSMIRGS---VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            A  YSL+Q  RC+++M RG    V+ ++ LAW++FSGDQL+AY  L A AAA QS++  K
Sbjct  65   AVVYSLLQAARCAMAMARGGGALVMSSRALAWSVFSGDQLLAYAMLAATAAALQSSLLGK  124

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  194
            +GQ ELQWM IC++YG FC QVG GIA +++  ++ ++L   SAF+LFRLYG NK     
Sbjct  125  LGQPELQWMGICSLYGAFCKQVGAGIACAVVAGLAAVLLASFSAFNLFRLYGGNKGSSTT  184

Query  193  R*RKTIY  173
            R   T Y
Sbjct  185  RNGATWY  191



>gb|ACU18779.1| unknown [Glycine max]
Length=131

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + + V+D+R+++ EL+ RCVI GL ++ AVL+GTDSQV+E FS +K+AKFTDMK+LV
Sbjct  17   YHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSQVKEFFSFQKEAKFTDMKSLV  76

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  437
            FLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ
Sbjct  77   FLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQ  120



>ref|XP_003558594.1| PREDICTED: CASP-like protein 2U2 [Brachypodium distachyon]
Length=209

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 134/185 (72%), Gaps = 3/185 (2%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G   +V   +++RVR AE+  RC  CGLA++ A L+G D Q R  FSI+K A++TDM+
Sbjct  24   YYGPGGRVSASLERRVRAAEVFLRCAACGLAVLAAALLGADRQSRTFFSIQKVARYTDMQ  83

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            +LV LVIA+G+ A YSL+Q  RC +S++RG +L ++PLAWAIFS DQ+MAY+ +GAVA A
Sbjct  84   SLVILVIASGMVACYSLIQGARCLLSIVRGGILLSRPLAWAIFSCDQVMAYIIIGAVAVA  143

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             ++A+  K GQ E QWM+ C++Y +FC Q G G+A ++    SM+ +  +SAF+LFRLYG
Sbjct  144  MEAALIGKYGQVEFQWMKTCHLYQRFCTQAGGGVACAIAASASMVGISLLSAFNLFRLYG  203

Query  217  DNKSK  203
            + K +
Sbjct  204  EGKGR  208



>ref|XP_004985347.1| PREDICTED: CASP-like protein Sb01g044070-like [Setaria italica]
Length=208

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G   +V   +++RVR AEL  RC  CGLA++ A L+G D Q R  FS+ K+A+++DM+
Sbjct  23   YYGPAGRVPAALERRVRAAELFLRCATCGLAVLAAALLGADRQTRIFFSMEKEARYSDMQ  82

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            +LVFLVIANG+AA YSL+Q  RC VS++ G VL +KP+AWAIFS DQ+MAY ++ AVA A
Sbjct  83   SLVFLVIANGMAACYSLLQGARCMVSILTGGVLISKPMAWAIFSCDQVMAYFTISAVAVA  142

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             ++A+  K G ++ QWM+ C++Y +FC Q G  +A ++   ++M+ +  +SAF+LFRLYG
Sbjct  143  MEAAMIGKYGNTQFQWMKTCHLYKRFCAQAGGAVACAVAASLNMVGISLVSAFNLFRLYG  202

Query  217  DNKSK  203
              K +
Sbjct  203  SGKGR  207



>ref|XP_002468338.1| hypothetical protein SORBIDRAFT_01g044070 [Sorghum bicolor]
 sp|C5WUP3.1|CSPL4_SORBI RecName: Full=CASP-like protein 2U2; Short=SbCASPL2U2 [Sorghum 
bicolor]
 gb|EER95336.1| hypothetical protein SORBIDRAFT_01g044070 [Sorghum bicolor]
Length=208

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 131/185 (71%), Gaps = 3/185 (2%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G+  +V   +++RVR AEL  RC  CGLA++ A L+G D Q R IFS+ K A+FTDM+
Sbjct  23   YYGAAGRVPAALERRVRAAELFMRCAACGLAVLAAALLGADRQTRTIFSVEKTARFTDMQ  82

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            +LVFLVIANG+AA YSL+Q  RC VS++ G VL N+P+AWAIFS DQ+MAY ++ AVA A
Sbjct  83   SLVFLVIANGMAACYSLLQGARCLVSILTGGVLINRPMAWAIFSCDQVMAYFTITAVAVA  142

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             ++A+  K G  + QWM  C+ Y +FC Q G  +A ++   ++M+ +  +SAF+LFRLYG
Sbjct  143  MEAAMIGKYGSLQFQWMNTCHFYKRFCAQAGGAVACAVAASLNMVGISLVSAFNLFRLYG  202

Query  217  DNKSK  203
              K +
Sbjct  203  SGKGR  207



>dbj|BAJ91438.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 132/183 (72%), Gaps = 3/183 (2%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  FSI+K A++TDM+
Sbjct  20   YYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFFSIQKVARYTDMQ  79

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            +LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+MAY+ +GAVA A
Sbjct  80   SLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQVMAYVIIGAVAVA  139

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             ++A+  K G+ E QWM+ C +Y +FC Q G G+A ++    SM+ +  +SAF+LFRLYG
Sbjct  140  MEAALLGKTGEVEFQWMKTCELYQRFCTQAGGGVACAVAASASMVGIALVSAFNLFRLYG  199

Query  217  DNK  209
              K
Sbjct  200  HGK  202



>dbj|BAK05801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 131/183 (72%), Gaps = 3/183 (2%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  FSI+K A++TDM+
Sbjct  20   YYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFFSIQKVARYTDMQ  79

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            +LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+MAY  +GAVA A
Sbjct  80   SLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQVMAYEIIGAVAVA  139

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             ++A+  K G+ E QWM+ C +Y +FC Q G G+A ++    SM+ +  +SAF+LFRLYG
Sbjct  140  MEAALLGKTGEVEFQWMKTCELYQRFCTQAGGGVACAVAASASMVGIALVSAFNLFRLYG  199

Query  217  DNK  209
              K
Sbjct  200  HGK  202



>tpg|DAA43987.1| TPA: hypothetical protein ZEAMMB73_493857 [Zea mays]
Length=206

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 132/186 (71%), Gaps = 4/186 (2%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G+  +V   +++RVR AEL  RC  CGLA++ A L+G D Q R  FS+ K A+FTDM+
Sbjct  20   YYGAAGRVPAALERRVRAAELFMRCAACGLAVLAAALLGADRQTRTFFSVEKAARFTDMQ  79

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIR-GSVLFNKPLAWAIFSGDQLMaylslgavaa  401
            +LVFLVIANG+AA YSL+Q  RC VS++  G VL N+P+AWAIFS DQ+MAY ++ AVA 
Sbjct  80   SLVFLVIANGMAACYSLLQGGRCLVSILTGGGVLINRPMAWAIFSCDQVMAYFTISAVAV  139

Query  400  aaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            A ++A+  K G  + QWM+ C++Y +FC Q G  +A ++   ++M+ +  +SAF+LFRLY
Sbjct  140  AMEAAMIGKYGSQQFQWMKTCHLYKRFCAQAGGAVACAVAASLNMVGVSLVSAFNLFRLY  199

Query  220  GDNKSK  203
            G  K +
Sbjct  200  GSGKGR  205



>ref|XP_003575478.2| PREDICTED: CASP-like protein 2B1 [Brachypodium distachyon]
Length=197

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = -1

Query  721  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  542
            +++ +L EL  RC+IC L  + A L+ TDSQ R  FS+ KKA++TDMKALV LV ANG A
Sbjct  10   ERKAKLWELALRCLICLLGTLAAALVATDSQTRTFFSLEKKARYTDMKALVLLVAANGAA  69

Query  541  AAYSLVQLVRCSVSMIR--GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIG  368
            AAYSL+Q  RC+VS+ R       +K +AW++FSGDQL+AY +L A AAAAQ++   K G
Sbjct  70   AAYSLLQAFRCAVSIARGGSGSSSSKVVAWSVFSGDQLLAYATLAATAAAAQASAIGKKG  129

Query  367  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRL  224
            Q ELQWM IC++YG FC QVG GIA ++   ++ ++L  +SAF+LFRL
Sbjct  130  QPELQWMGICDLYGAFCRQVGGGIACAVGAGVAAVVLAPVSAFNLFRL  177



>ref|XP_002443261.1| hypothetical protein SORBIDRAFT_08g016550 [Sorghum bicolor]
 sp|C5YP66.1|CSPLJ_SORBI RecName: Full=CASP-like protein 2U1; Short=SbCASPL2U1 [Sorghum 
bicolor]
 gb|EES17099.1| hypothetical protein SORBIDRAFT_08g016550 [Sorghum bicolor]
Length=193

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 121/180 (67%), Gaps = 6/180 (3%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
             +++V++AE+  R ++CGL  + A L+ TD+Q R  FS++KKA +TDMKA+VFLV A  +
Sbjct  13   AERKVKVAEVALRALLCGLGALAAALVATDTQTRTFFSLQKKASYTDMKAMVFLVDAAAV  72

Query  544  AAAYSLVQL-VRCS-----VSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  383
            AA YSL+QL  RC       S         + L+W +FS DQ +AY+ L AVAAA Q++V
Sbjct  73   AAGYSLLQLAARCCGGGAMSSGRGDGGGRGRALSWCVFSCDQALAYVLLAAVAAALQASV  132

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             AK GQ ELQWM IC +YG FC Q G G+A++++  ++ ++L  +SAF+LFRLYG   +K
Sbjct  133  VAKRGQPELQWMGICALYGAFCRQAGAGLATAVVAGLAAVLLAFLSAFNLFRLYGSGGTK  192



>sp|D5A8E6.1|CSPL4_PICSI RecName: Full=CASP-like protein 2BC1; Short=PsCASPL2BC1 [Picea 
sitchensis]
 gb|ADE75815.1| unknown [Picea sitchensis]
Length=226

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 111/174 (64%), Gaps = 1/174 (1%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS-IRKKAKFTDMKALVFLVIANG  548
             D+++R+ E+I R  +   A+V A+++GT S  R++   IR  A FT +K L FLVI +G
Sbjct  29   TDRKLRITEVILRFAVVIFALVSAIMVGTASGTRDLGGGIRIHAHFTLLKTLPFLVIVDG  88

Query  547  LAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIG  368
            + A YSL+Q +RC +S+    +L NK LAW IF  DQ +AY+   A A+ A++A  ++ G
Sbjct  89   ILAVYSLLQGLRCFLSLYMRHILLNKALAWTIFCCDQALAYVIFAAAASTAETAYISEQG  148

Query  367  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
              ELQW+++C  +  +C + G G+ ++ +  + M+ + G+S F LFRLYG+ ++
Sbjct  149  LDELQWIKVCMFFRAYCFKSGAGMINAFLAALCMVFVSGMSVFHLFRLYGEKRA  202



>ref|XP_004162507.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 2 
[Cucumis sativus]
Length=128

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  571  VFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaq  392
            +FLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+MAY+++ AVA+AAQ
Sbjct  1    MFLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQIMAYVTVAAVASAAQ  60

Query  391  savyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
            SAV+ K+GQ ELQWM+IC++Y KFCNQVGEG+AS+++V +SM++L  ISA SLFRLY   
Sbjct  61   SAVFGKLGQPELQWMKICDLYKKFCNQVGEGLASAVVVSLSMVVLSCISASSLFRLYNGG  120

Query  211  KSKCNGR  191
            K+K N R
Sbjct  121  KNKSNSR  127



>ref|XP_004162506.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 1 
[Cucumis sativus]
Length=132

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            FLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+MAY+++ AVA+AAQS
Sbjct  6    FLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQIMAYVTVAAVASAAQS  65

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AV+ K+GQ ELQWM+IC++Y KFCNQVGEG+AS+++V +SM++L  ISA SLFRLY   K
Sbjct  66   AVFGKLGQPELQWMKICDLYKKFCNQVGEGLASAVVVSLSMVVLSCISASSLFRLYNGGK  125

Query  208  SKCNGR  191
            +K N R
Sbjct  126  NKSNSR  131



>gb|EPS70050.1| hypothetical protein M569_04716, partial [Genlisea aurea]
Length=118

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = -1

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  389
            F+V  N L AAYS +QL R S    +GS + NKPLAW IFS DQ++AYL   AVAA+  S
Sbjct  1    FVVAVNVLGAAYSALQLARLS----KGSPVLNKPLAWTIFSSDQVLAYLMFSAVAASIPS  56

Query  388  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            AVYA+ G+ +LQWM+ CN+Y  FCN++GEG+  S++VC+SMI L G+S+F+LFRLY    
Sbjct  57   AVYAQYGEPQLQWMKTCNLYRNFCNRMGEGMVGSVVVCMSMIGLSGLSSFTLFRLYNGGA  116

Query  208  SK  203
             K
Sbjct  117  GK  118



>sp|Q0IN16.2|CSPLE_ORYSJ RecName: Full=CASP-like protein 2B1; Short=OsCASPL2B1 [Oryza 
sativa Japonica Group]
 gb|ABA99118.2| plant integral membrane protein TIGR01569 containing protein, 
expressed [Oryza sativa Japonica Group]
Length=198

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            ++++ ++AE+  RC +C LA + A L+GT SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  544  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI  371
            AA YSL+QL RC+ +     GS      +AW++FS DQ +AY  + A AAA QS+V  K 
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQAVAYALMAATAAALQSSVVGKR  126

Query  370  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            GQ ELQWM +C +YG FC +VGEG+A+++   ++ ++L  +SAF+LFRLY
Sbjct  127  GQPELQWMPVCGLYGAFCRRVGEGLAAAVAAGLAAVLLAAVSAFNLFRLY  176



>sp|Q10QH3.2|CSPLL_ORYSJ RecName: Full=CASP-like protein Os03g0196400 [Oryza sativa Japonica 
Group]
 gb|EEC74684.1| hypothetical protein OsI_10377 [Oryza sativa Indica Group]
 gb|EEE58500.1| hypothetical protein OsJ_09768 [Oryza sativa Japonica Group]
Length=195

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 115/183 (63%), Gaps = 26/183 (14%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G   +V   +++R R AE++ RC  CGLA++ A L+G D Q R  FSI+K A++TDM+
Sbjct  22   YYGPGGRVPSSLERRARAAEVLLRCAACGLAVLAAALLGADRQTRVFFSIQKVARYTDMQ  81

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            +LV LVIANG+AA YSL+Q  RC V            +A+ + S           AVAAA
Sbjct  82   SLVLLVIANGMAACYSLIQCARCLV------------MAYIVIS-----------AVAAA  118

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             ++A+  K GQ E QWM+ C++Y +FC Q G G+A ++   ++M+ +  ISAF+LFRLYG
Sbjct  119  MEAALIGKYGQPEFQWMKTCHLYKRFCAQAGGGVACAIAASVNMVGVALISAFNLFRLYG  178

Query  217  DNK  209
            ++ 
Sbjct  179  NSN  181



>ref|XP_008777752.1| PREDICTED: CASP-like protein GSVIVT00013502001, partial [Phoenix 
dactylifera]
Length=71

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  655  AVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLF  476
            A L+G+D+QVR+ FS+ KKAKFTDMKALVFLVI+NG+AA YSL+  VR  VSMI+ SVLF
Sbjct  3    AALVGSDTQVRKFFSLEKKAKFTDMKALVFLVISNGIAAGYSLIPGVRSVVSMIKESVLF  62

Query  475  NKPLAWAIF  449
            NK LAWAIF
Sbjct  63   NKALAWAIF  71



>dbj|BAJ98184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 82/109 (75%), Gaps = 3/109 (3%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  FSI+K A++TDM+
Sbjct  20   YYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFFSIQKVARYTDMQ  79

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  431
            +LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+M
Sbjct  80   SLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQVM  128



>ref|NP_001159013.1| membrane protein [Zea mays]
 sp|B6TGJ8.1|CSPL8_MAIZE RecName: Full=CASP-like protein 2U1; Short=ZmCASPL2U1 [Zea mays]
 gb|ACG36231.1| membrane protein [Zea mays]
Length=190

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 116/179 (65%), Gaps = 10/179 (6%)
 Frame = -1

Query  721  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  542
            +++V +AE+  R V+CGL  + A L+ TD+Q R  FS++KKA +TDMKA+V LV A   A
Sbjct  12   ERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKAMVLLVAAAAAA  71

Query  541  AAYSLVQLVR--CSVSMIRGSVLFNKP-----LAWAIFSGDQLMaylslgavaaaaqsav  383
            A YSL+Q  R  C V+++R S+   +P     LAW +F+ DQ +AY  L AV AA Q++V
Sbjct  72   AGYSLLQAARCCCCVALLRTSI---RPRARLLLAWCVFACDQALAYALLAAVVAALQASV  128

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
             AK G  +LQWM IC +YG FC Q G G+A ++   +   +L  +SAF+LFRLYG   +
Sbjct  129  VAKQGLPQLQWMAICALYGAFCRQAGAGVACAVAAAVDAALLAFLSAFNLFRLYGAKAT  187



>ref|XP_006651131.1| PREDICTED: CASP-like protein Os03g0196400-like [Oryza brachyantha]
Length=209

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 23/161 (14%)
 Frame = -1

Query  697  LIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQL  518
            ++ RC  CGLA++ A L+  D Q R  FSI+K A++TDM++LV LVIANG+AA YSL+Q 
Sbjct  60   VLLRCAACGLAVLAAALLAADRQTRVFFSIQKVARYTDMQSLVLLVIANGMAACYSLIQG  119

Query  517  VRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRIC  338
             RC V            +A+ + S           AVAAA ++A+  K GQ E QWM+ C
Sbjct  120  ARCLV------------MAYIVIS-----------AVAAAMEAALIGKYGQPEFQWMKTC  156

Query  337  NMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGD  215
            ++Y +FC Q G G+A ++   ++M+ +  +SAF+LFRLYG+
Sbjct  157  HLYKRFCAQAGGGVACAIAASVNMVGVALLSAFNLFRLYGN  197



>ref|XP_007026315.1| CASP-like protein POPTRDRAFT_818956 isoform 2, partial [Theobroma 
cacao]
 gb|EOY28937.1| CASP-like protein POPTRDRAFT_818956 isoform 2, partial [Theobroma 
cacao]
Length=209

 Score = 94.7 bits (234),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YH + LKV+D+RVR+AEL+ RCVIC L+++ AVL+ TD+QV+EIFSI+KKA+FTDMKALV
Sbjct  16   YHATNLKVIDRRVRVAELVLRCVICVLSVLAAVLVATDTQVKEIFSIQKKARFTDMKALV  75

Query  568  F  566
            F
Sbjct  76   F  76


 Score = 37.0 bits (84),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 26/49 (53%), Gaps = 0/49 (0%)
 Frame = -3

Query  569  VFGDSQWISCCLLTGSACEVLSEYD*RKCSLQQTPGLGYLFW*SADGVL  423
            VFG SQW SC LL  +   +   Y  RKC+ QQ   LG+  W S +  L
Sbjct  75   VFGGSQWGSCSLLIDTRGALCCGYGERKCAFQQAFCLGHFLWRSVNRRL  123



>ref|XP_004962893.1| PREDICTED: CASP-like protein Sb08g016550-like [Setaria italica]
Length=200

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 122/178 (69%), Gaps = 4/178 (2%)
 Frame = -1

Query  727  VVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANG  548
            V +++V++AE+  R ++C L+ + A L+ TDSQ R  FS +K+A F DMKA+V LV    
Sbjct  5    VAERKVKVAEVSLRALLCLLSALAAALVATDSQTRTFFSFQKRATFRDMKAMVLLVAVAA  64

Query  547  LAAAYSLVQLVRCSVSMIR----GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  380
             AA YSL+Q+ RC V+  +    G  L ++ LAW +FS DQ +AY  L AVAAA Q++V 
Sbjct  65   AAAGYSLLQVARCCVTAAQRAGGGGTLTSRALAWCVFSCDQALAYAVLAAVAAALQASVI  124

Query  379  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
            AK GQ ELQWM IC+MYG FC Q G GIAS++   ++ ++L  +SAF+LFRLYG NK+
Sbjct  125  AKRGQPELQWMGICSMYGAFCRQAGGGIASAVAAAVAAVLLAFLSAFNLFRLYGHNKT  182



>gb|KDP36414.1| hypothetical protein JCGZ_08683 [Jatropha curcas]
Length=178

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 95/154 (62%), Gaps = 1/154 (1%)
 Frame = -1

Query  670  LAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  491
            L ++ ++LIG DS+ + +  + KK    D+KAL+ LV  + +AAAY+L+QL RC  +  +
Sbjct  19   LLLMTSLLIGLDSETKSVVYMEKKVTCKDLKALLVLVYVDAVAAAYNLLQLSRCFKASYK  78

Query  490  GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQ  311
                + + +AW+ F  DQ++ Y++  A AAA + +V   +G +  QWM+ CN + +FC Q
Sbjct  79   SEASY-RSVAWSCFLLDQIVVYITFAATAAAIEHSVLVVVGANAFQWMKWCNRFTRFCFQ  137

Query  310  VGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +G  +  S+  C  M+ +  ISAF+LFRLY  N+
Sbjct  138  IGGSLFCSVTACALMVFISSISAFNLFRLYSPNQ  171



>gb|KJB53802.1| hypothetical protein B456_009G006000 [Gossypium raimondii]
Length=177

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 94/173 (54%), Gaps = 3/173 (2%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            ++  ++  E + R     + ++ A LIG DSQ + IF ++KKA F D++ALV L+    L
Sbjct  1    MELSIQKTEALIRLSTIVMLVLTACLIGLDSQTKVIFYVQKKASFNDLRALVGLLYITSL  60

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsavyAKIG  368
            AAAY+L+QL  C  S  +G+ L +   LAW  +  DQ + Y       AA + +     G
Sbjct  61   AAAYNLLQL--CCSSFYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAAMEHSFLVLTG  118

Query  367  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +   QW++ CN Y +FC Q+G  +    +  + M  +  ISAF+LFRLY   K
Sbjct  119  EENFQWLKWCNKYTRFCTQIGGSLLCGFVAILLMFSIASISAFNLFRLYSPTK  171



>sp|B9IM09.2|CSPLG_POPTR RecName: Full=CASP-like protein 2C1; Short=PtCASPL2C1 [Populus 
trichocarpa]
Length=181

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 95/169 (56%), Gaps = 8/169 (5%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  521
            E I R +   L +  A L+G DSQ + +    K+  + D+ ALV LV  + +AAAY+L+Q
Sbjct  9    EAILRGIAILLLVSTACLVGLDSQTKFVIVYEKEVTYKDLHALVVLVYVDAVAAAYNLLQ  68

Query  520  LVRCSVSMI-----RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  356
            L RCSVS +     +GS    + L+WA F  DQL AY +  A +AA Q +V    G    
Sbjct  69   LCRCSVSALSKGNFKGSY---RYLSWACFVLDQLAAYTTFAAHSAALQHSVLGITGAKVF  125

Query  355  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            QWM+ CN + +FC Q+G  +    I  + M+++  ISAF+LFRLY    
Sbjct  126  QWMKWCNRFTRFCFQIGGALTCGYIASVLMVMISFISAFNLFRLYSPKH  174



>ref|XP_007014187.1| CASP-like protein XL3 [Theobroma cacao]
 gb|EOY31806.1| CASP-like protein XL3 [Theobroma cacao]
Length=181

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 2/156 (1%)
 Frame = -1

Query  670  LAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  491
            L ++ A L+G DSQ + IF + KKA F D++AL+ LV    LAAAY+LVQL   S S  R
Sbjct  19   LLVLTACLVGFDSQTKVIFYVEKKASFKDLRALIGLVYITSLAAAYNLVQLSCYSFSARR  78

Query  490  --GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  317
               S    K LAW  +  DQ   Y+      AA + A+    G+   QWM+ CN Y +FC
Sbjct  79   KGSSPQSYKYLAWLRYVLDQAAVYVVFAGNFAAFEHALLVVTGEQNFQWMKWCNKYTRFC  138

Query  316  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             Q+G  +    +  + M+ +  ISAF+LFRLY   K
Sbjct  139  FQIGGSLLCGCVASLVMVFIASISAFNLFRLYSPKK  174



>ref|XP_008800283.1| PREDICTED: CASP-like protein Os06g0656300 [Phoenix dactylifera]
Length=170

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 94/162 (58%), Gaps = 2/162 (1%)
 Frame = -1

Query  703  AELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLV  524
            AE + R +   LA + AVLIG D+Q + +F +R+KA   D++AL    I   +AA Y L+
Sbjct  9    AESLLRVLCLVLASMAAVLIGLDTQTKTVFFVRRKATVKDLEALWISTIITSIAAGYHLL  68

Query  523  QLVRC--SVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  350
            Q  RC     + +     NK +AWA F  DQ + Y++ G + A  Q+++ A  G   LQW
Sbjct  69   QFCRCLAFAWLTKNPCWSNKFMAWASFLLDQGVTYVTFGGILAGMQASMIAVTGMRALQW  128

Query  349  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRL  224
             ++CN+Y +FC+QV  G+   +   +SM ++  +SA+ LFRL
Sbjct  129  EKLCNIYARFCDQVAAGLVCGIAASLSMAVVSSVSAYHLFRL  170



>emb|CDY68034.1| BnaCnng57380D [Brassica napus]
Length=139

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = -1

Query  496  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI-GQSELQWMRICNMYGKF  320
            ++GSV  NK LAWAIFSGDQ        A  AA+  +    I G+ ELQWM++CNM+GKF
Sbjct  4    MKGSVFLNKSLAWAIFSGDQQAMAYMSVAAIAASSESGVIGIRGEEELQWMKVCNMFGKF  63

Query  319  CNQVGEGIASSLIVCISMIILCGISAFSLFRLYG-DNKSKCN  197
            CN+   G+AS+++   +M+++  ISAFSLFRLYG  N+   N
Sbjct  64   CNRGAGGVASAMLASFAMVLVSRISAFSLFRLYGATNQRPPN  105



>ref|XP_010913647.1| PREDICTED: CASP-like protein 2C1 isoform X1 [Elaeis guineensis]
Length=168

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 92/151 (61%), Gaps = 2/151 (1%)
 Frame = -1

Query  670  LAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV--SM  497
            LA + A+LIG D+Q + +F +R+KA   D++AL    I   +AA Y L+Q  RC V   +
Sbjct  18   LASMAAILIGMDTQTKTVFFVRRKATVKDLEALWISTIITSVAAGYHLLQFCRCLVFAWL  77

Query  496  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  317
            ++     NK +AWA F  DQ + Y++ G + AA Q++  A  G   LQW ++CN+Y +FC
Sbjct  78   MKNPCWSNKFMAWASFLLDQGVTYVTFGGILAALQASTIAVTGIRALQWEKLCNIYTRFC  137

Query  316  NQVGEGIASSLIVCISMIILCGISAFSLFRL  224
            +Q+G G+   +   ++M ++  +SA+ LFRL
Sbjct  138  DQIGAGLICGIAASLAMAVVSSVSAYHLFRL  168



>gb|KHF98180.1| CASP-like protein XL3 [Gossypium arboreum]
Length=180

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 90/166 (54%), Gaps = 2/166 (1%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  521
            E + R     + ++ A LIG DSQ + IF ++KKA F D++ALV L+    LAAAY+L+Q
Sbjct  9    EALIRLSTIVMLVLTACLIGLDSQTKVIFYVQKKASFKDLRALVGLLYITSLAAAYNLLQ  68

Query  520  LVRCSVSM-IRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWM  347
            L   S S   +G+ L +   LAW  +  DQ + Y       AA + +     G+   QW+
Sbjct  69   LCCSSFSASYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAALEHSFLVLTGEENFQWL  128

Query  346  RICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            + CN Y +FC Q+G  +    +  + M  +  ISAF+LFRLY   K
Sbjct  129  KWCNKYTRFCTQIGGSLLCGFVASLLMFSIASISAFNLFRLYSPTK  174



>ref|XP_010260176.1| PREDICTED: CASP-like protein XL3 [Nelumbo nucifera]
Length=181

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 92/167 (55%), Gaps = 3/167 (2%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  524
            E + R    GL ++ A L+GTD Q + +F S+ +KA   D+ ALV L+I   + A Y L+
Sbjct  9    EALLRLFTVGLLVLTACLVGTDKQTKTVFFSVERKATVKDLDALVILMIVETVVAFYHLL  68

Query  523  QLVRCSV--SMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  350
            QL +C           L     AW  F  DQ + Y+  GA  AAAQ++  +  G S+ QW
Sbjct  69   QLGKCFFFPRFKENKALPYSTQAWVFFFLDQTVTYIYFGATIAAAQASALSVTGASDFQW  128

Query  349  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            M++CN+Y +FC Q+G  +   L+  + M I+  ISAF+LFR Y   +
Sbjct  129  MKVCNIYTRFCIQIGGSLFCGLVAALLMSIVSSISAFNLFRHYSPKQ  175



>sp|Q5K4H9.1|CSPL2_GOSHI RecName: Full=CASP-like protein XL3; AltName: Full=CASP-like 
protein 2C1; Short=GhCASPL2C1 [Gossypium hirsutum]
 emb|CAE75666.1| putative membrane protein [Gossypium hirsutum]
Length=180

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 89/166 (54%), Gaps = 2/166 (1%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  521
            E + R     + ++ A LIG DSQ + IF ++KKA F D++ALV L+    LAAAY+L+Q
Sbjct  9    EALIRLSTIVMLVLTACLIGLDSQTKVIFYVQKKASFKDLRALVGLLYITSLAAAYNLLQ  68

Query  520  LVRCSVSM-IRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWM  347
            L   S S   +G+ L +   LAW  +  DQ + Y       AA + +     G+   QW+
Sbjct  69   LCCSSFSASYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAALEHSFLVLTGEENFQWL  128

Query  346  RICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            + CN Y +FC Q+G  +    +  + M  +  ISAF+LFR Y   K
Sbjct  129  KWCNKYTRFCTQIGGSLLCGFVASLLMFSIASISAFNLFRQYSPTK  174



>ref|NP_001142330.1| CASP-like protein 2U1 [Zea mays]
 gb|ACF88205.1| unknown [Zea mays]
 gb|AFW56601.1| membrane protein 9 [Zea mays]
Length=186

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
             +++V +AE+  R V+CGL  + A L+ TD+Q R  FS++KKA +TDMKA+V LV A   
Sbjct  11   AERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKAMVLLVAAAAT  70

Query  544  AAAYSLVQLVR--CSVSMIRGSVLFNKP-----LAWAIFSGDQLMaylslgavaaaaqsa  386
            AA YSL+Q  R  C V+++R S+   +P     LAW +F+ DQ +AY  L AVAAA Q++
Sbjct  71   AAGYSLLQAARCCCCVALLRTSI---RPRARLLLAWCVFACDQALAYALLAAVAAALQAS  127

Query  385  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
            V AK G  +LQWM IC +YG FC Q G G+A ++   +   +L  +SAF+LFRLYG
Sbjct  128  VVAKQGLPQLQWMAICALYGAFCRQAGAGVACAVAAAVDAALLAFLSAFNLFRLYG  183



>ref|XP_011043990.1| PREDICTED: CASP-like protein 2C1 [Populus euphratica]
Length=181

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 91/169 (54%), Gaps = 8/169 (5%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  521
            E I R +   L +  A L+G DSQ + +    K+  + D+ ALV LV  + +AAAY+L+Q
Sbjct  9    EAILRGIAILLLVSTACLVGLDSQTKFVIVYEKEVTYKDLHALVVLVHVDAVAAAYNLLQ  68

Query  520  LVRCSVSM-----IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  356
            L RCSVS      ++GS    + L+WA    DQL  Y +  A  AA + +V    G    
Sbjct  69   LCRCSVSAWGLGNLKGSY---RYLSWACCVLDQLAVYTTFAAHLAALEHSVLVLTGAKVF  125

Query  355  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            QW++ CN + +FC Q+G  +    I  + M ++  ISAF+LFRLY    
Sbjct  126  QWVKWCNKFTRFCFQIGGALTCCFIASVLMAMISFISAFNLFRLYSPKH  174



>gb|ABF94455.1| plant integral membrane protein TIGR01569 containing protein, 
expressed [Oryza sativa Japonica Group]
Length=238

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 115/226 (51%), Gaps = 69/226 (31%)
 Frame = -1

Query  748  YHGSXLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMK  578
            Y+G   +V   +++R R AE++ RC  CGLA++ A L+G D Q R  FSI+K A++TDM+
Sbjct  22   YYGPGGRVPSSLERRARAAEVLLRCAACGLAVLAAALLGADRQTRVFFSIQKVARYTDMQ  81

Query  577  ALV-------------------------------------------FLVIANGLAAAYSL  527
            +LV                                            LVIANG+AA YSL
Sbjct  82   SLVVNNGPSMQKYRGVFDGPKTSFYRKFLLRYFAYCDKIILLDIRRLLVIANGMAACYSL  141

Query  526  VQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWM  347
            +Q  RC V            +A+ + S           AVAAA ++A+  K GQ E QWM
Sbjct  142  IQCARCLV------------MAYIVIS-----------AVAAAMEAALIGKYGQPEFQWM  178

Query  346  RICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            + C++Y +FC Q G G+A ++   ++M+ +  ISAF+LFRLYG++ 
Sbjct  179  KTCHLYKRFCAQAGGGVACAIAASVNMVGVALISAFNLFRLYGNSN  224



>gb|EYU42435.1| hypothetical protein MIMGU_mgv1a014854mg [Erythranthe guttata]
Length=176

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 91/162 (56%), Gaps = 5/162 (3%)
 Frame = -1

Query  688  RCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVR  512
            R +   L ++ A L+G D+Q + IF +  +KA F D+ AL  LV  +  AA Y+L+QL R
Sbjct  11   RIISTVLLVLSACLVGLDTQTKVIFYTFTRKATFRDLDALYLLVWIDSGAAVYNLLQLFR  70

Query  511  C-SVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICN  335
                ++I       K LAW ++  DQ  AY+   A  AA Q++  A  G+   QWM++CN
Sbjct  71   SFRKNLITAPY---KNLAWGVYFLDQAAAYVVFAANTAAIQASALAVTGEESFQWMKLCN  127

Query  334  MYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             Y +FC Q+G  +  S I  I M I+  +SA++LFRLY   +
Sbjct  128  RYTRFCFQIGGALVCSYIAAILMAIISTMSAYALFRLYSPKQ  169



>ref|XP_011069901.1| PREDICTED: CASP-like protein 2C1 isoform X2 [Sesamum indicum]
Length=176

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 90/173 (52%), Gaps = 19/173 (11%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  524
            E   R +   L ++ A L+G DSQ +  F +  +KA F D+ AL  LV  +  AAAY+L+
Sbjct  7    ETFLRVLSTVLLVLTACLVGFDSQTKVFFYTYARKATFRDLNALYVLVWVDAAAAAYNLI  66

Query  523  QLVRCSVSMIRGSVLFNKPLA--------WAIFSGDQLMaylslgavaaaaqsavyAKIG  368
            QL R           F K LA        W  +  DQ  +Y+   A  AA Q++V A  G
Sbjct  67   QLFRS----------FRKDLADNSYTYLRWGTYLLDQAASYVVFAANTAAVQASVLALTG  116

Query  367  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +   QWM++CN Y +FC Q+G  +A  +I  I  +I+  ISA++LFRLY    
Sbjct  117  EKSFQWMKLCNRYTRFCIQIGGALACGVIAAILTVIISSISAYALFRLYSPKH  169



>ref|XP_010265455.1| PREDICTED: CASP-like protein 2C1 [Nelumbo nucifera]
Length=181

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 95/168 (57%), Gaps = 3/168 (2%)
 Frame = -1

Query  703  AELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSL  527
             E + R    G+ ++ A L+GT++Q + +F S+ +KA   D+ ALV LVI   + A Y L
Sbjct  8    TEALLRLSAIGVLVLTACLVGTNTQTKHVFFSVERKATVKDLDALVILVIVESVTAFYHL  67

Query  526  VQLVR--CSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            +QL +            +  +  AW  F  DQ++ Y++ GA  AAAQ+++ A  G  + Q
Sbjct  68   LQLGKYFAFPRFKEKKAISYETQAWICFMLDQIVTYVNFGATVAAAQASMLAVTGSRDFQ  127

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            WM++C +Y +FC Q+G  +   L+  I MI++   SAF+LFRLY   +
Sbjct  128  WMKVCRIYKRFCFQIGGSLTCGLVASILMIMISTFSAFNLFRLYSPKR  175



>ref|XP_007223970.1| hypothetical protein PRUPE_ppa014614mg, partial [Prunus persica]
 gb|EMJ25169.1| hypothetical protein PRUPE_ppa014614mg, partial [Prunus persica]
Length=180

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 95/157 (61%), Gaps = 8/157 (5%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSM----  497
            ++ A L+G DSQ + +  I +KA F D+K+L  LV    +AA Y+L+QL +CS S     
Sbjct  19   VLTACLVGFDSQTKYLIFIYRKATFRDLKSLSVLVYVVSVAAGYNLLQLGKCSKSAWCKE  78

Query  496  -IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKF  320
             ++GS   N  +AW  F  DQ+  Y++ GA +AA +++V A  G  + QWM++CN Y +F
Sbjct  79   NLKGS---NIYVAWLCFLLDQVAVYVTFGANSAALEASVLAIKGAQDFQWMKLCNKYTRF  135

Query  319  CNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            C Q+G  +A   + CI M  +  ISAF+LFRLY   +
Sbjct  136  CFQIGGALACGYVACILMAWISLISAFNLFRLYSPKQ  172



>ref|XP_004163465.1| PREDICTED: CASP-like protein RCOM_0864260-like isoform 3 [Cucumis 
sativus]
Length=75

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  748  YHGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALV  569
            YHGS LKV DKRVR+ EL+ R +ICGL ++ AVL+GTD++V+ IF+IRK+A FTDMKALV
Sbjct  16   YHGSNLKVFDKRVRVVELVLRFLICGLGVLAAVLVGTDTEVKTIFTIRKRATFTDMKALV  75



>emb|CDX94411.1| BnaC01g17730D [Brassica napus]
Length=175

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 93/176 (53%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            R+R +E+I R  I  L I+ +VLIG DSQ ++I  I K+  F  + AL   +  N + AA
Sbjct  3    RLRESEVILRLCIVALLILSSVLIGLDSQTKDIAYIHKRVTFRYLFALEIELYINVVVAA  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y++ QL      V    S  +  S L ++   + +F+G             AAAQ ++  
Sbjct  63   YNIAQLGFGWYGVAQKTSNSKWLSYLLDQTAVYVVFAGAS-----------AAAQHSLLV  111

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C+ + +FC Q+G  I  + I  + MIIL  ISAFSLFRLY   +
Sbjct  112  VTGSRELQWMKWCSKFTRFCFQIGSAIILNYIAAVLMIILSFISAFSLFRLYSPKR  167



>ref|XP_009139582.1| PREDICTED: CASP-like protein ARALYDRAFT_657503 [Brassica rapa]
 emb|CDX89392.1| BnaA01g15010D [Brassica napus]
Length=175

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 95/176 (54%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            R+R +E+I R  I  L I+ +VLIG DSQ ++I  I KK  F  + AL   +  N + AA
Sbjct  3    RLRESEVILRLCIVFLLILTSVLIGFDSQTKDIAYIHKKVTFRYLFALEIELYINVVVAA  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y++ QL      V    S  +  S L ++   + +F+G           V+AAAQ ++  
Sbjct  63   YNIAQLGFGWYGVAQKTSNSKWLSYLLDQTAVYVVFAG-----------VSAAAQHSLLV  111

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C+ + +FC Q+G  I  + I  + MIIL  ISAFSLFRLY   +
Sbjct  112  VTGSRELQWMKWCSKFTRFCFQIGSAIILNYIAAMLMIILSFISAFSLFRLYSPKR  167



>ref|XP_011069900.1| PREDICTED: CASP-like protein 2C1 isoform X1 [Sesamum indicum]
Length=179

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 86/176 (49%), Gaps = 22/176 (13%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  524
            E   R +   L ++ A L+G DSQ +  F +  +KA F D+ AL  LV  +  AAAY+L+
Sbjct  7    ETFLRVLSTVLLVLTACLVGFDSQTKVFFYTYARKATFRDLNALYVLVWVDAAAAAYNLI  66

Query  523  QLVRCSVSMIRGSVLFNKPLA--------WAIFSGDQLMaylslgavaaaaqsavyAKI-  371
            QL R           F K LA        W  +  DQ +   S    AA   +   + + 
Sbjct  67   QLFRS----------FRKDLADNSYTYLRWGTYLLDQELQAASYVVFAANTAAVQASVLA  116

Query  370  --GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G+   QWM++CN Y +FC Q+G  +A  +I  I  +I+  ISA++LFRLY    
Sbjct  117  LTGEKSFQWMKLCNRYTRFCIQIGGALACGVIAAILTVIISSISAYALFRLYSPKH  172



>ref|XP_009396107.1| PREDICTED: CASP-like protein 2C1 [Musa acuminata subsp. malaccensis]
Length=190

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 92/183 (50%), Gaps = 7/183 (4%)
 Frame = -1

Query  718  KRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAA  539
             +V  AE + R +    A + A+L+G D+Q + +F + + A   DM AL  + +   + A
Sbjct  3    SKVLRAESVLRILSLVFAAMAALLVGLDTQTKTVFFVTRTATVKDMDALWVMTVVFSVVA  62

Query  538  AYSLVQLVRCSVSMIRG--SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             Y L+ L RC      G      NK +AW  F  DQ   Y + GA  AA Q+A+    G 
Sbjct  63   GYHLLHLFRCMAFTWLGKNPCHCNKFVAWLYFVLDQGSTYATFGATMAALQAALVGLFGI  122

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY-----GDNKSKC  200
              LQW ++CN+Y +FC+Q+  GI   L+  + M ++  ISA  LF+LY        KS  
Sbjct  123  GSLQWSKLCNIYTRFCDQIAGGIICGLVATLVMAVISAISAHRLFQLYPRTRRSSPKSAG  182

Query  199  NGR  191
             GR
Sbjct  183  GGR  185



>ref|XP_008223711.1| PREDICTED: CASP-like protein POPTRDRAFT_578614 [Prunus mume]
Length=182

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSM----  497
            ++ A L+G DSQ + +  I +KA F D+KAL+ LV    +AA Y+L+QL +CS S     
Sbjct  21   VLTACLVGFDSQTKYVIFIYRKATFRDLKALLVLVYVVSVAAGYNLLQLGKCSKSAWYKE  80

Query  496  -IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKF  320
             ++GS   N  +AW  F  DQ+  Y++ GA +AA +++V A  G  + QW+++CN Y +F
Sbjct  81   NLKGS---NIYVAWLCFLLDQVAVYVTFGANSAALEASVLAIKGAQDFQWIKLCNKYTRF  137

Query  319  CNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            C Q+G  +A   + CI M  +  ISAF+LFRLY   K
Sbjct  138  CFQIGGALACGYVACILMAWISLISAFNLFRLYSPKK  174



>ref|XP_009396704.1| PREDICTED: CASP-like protein 2C1 [Musa acuminata subsp. malaccensis]
Length=187

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 98/170 (58%), Gaps = 2/170 (1%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            ++ R+  AE + R +   LA   A+L+G D++ + +  +RKKA   D+  L  + +   +
Sbjct  1    MESRLLKAEGVLRMLSLALAATAALLVGLDTETKTVLFVRKKATAKDLDGLWTMTLVTSI  60

Query  544  AAAYSLVQLVRC-SVSMI-RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI  371
             A Y L+QL RC +++++ R     +K +AW +F  DQ + Y + GA  A  Q+A+ A  
Sbjct  61   TAGYHLLQLFRCMALALLGRNPCRGSKSVAWFLFLLDQGVTYATFGATMAGLQAALVAVF  120

Query  370  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            G  +LQW ++CN+Y +FC QV  G+   L   ++M ++  +SA  LFRLY
Sbjct  121  GVDDLQWSKLCNIYTRFCEQVAGGMLCGLTASLAMAVVSAVSAHHLFRLY  170



>ref|XP_010046989.1| PREDICTED: CASP-like protein 2C1 [Eucalyptus grandis]
 gb|KCW78728.1| hypothetical protein EUGRSUZ_C00172 [Eucalyptus grandis]
 gb|KCW78729.1| hypothetical protein EUGRSUZ_C00172 [Eucalyptus grandis]
Length=184

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 91/171 (53%), Gaps = 8/171 (5%)
 Frame = -1

Query  703  AELIFRCVICGLAIVGAVLIGTDSQVREI-FSIRKKAKFTDMKALVFLVIANGLAAAYSL  527
             E+  R     L ++ A L+   +Q + I ++  +KA F D+ AL  LV  +G+ A Y+L
Sbjct  8    TEVFLRVCAILLLVLTACLVAMATQTKLIMYTYARKATFRDLNALPVLVYIDGVVAGYNL  67

Query  526  VQLVRCSVSM-----IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQS  362
            +QL RCSVS      I+  +L  K L+W  F  DQ+  Y       AA Q+++ A  G  
Sbjct  68   LQLSRCSVSAYCKREIQCPLL--KNLSWVHFLLDQVAVYTVFATTVAATQASLLAVTGSK  125

Query  361  ELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             +QWM++CN Y +FC QVG  +       I ++++  +S ++LFR Y   K
Sbjct  126  AMQWMKLCNRYTRFCIQVGGALLCGYAASIVLVLMSFLSVYNLFRRYSPTK  176



>ref|XP_002869651.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7MFW5.1|CSPL4_ARALL RecName: Full=CASP-like protein 2C1; Short=AlCASPL2C1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45910.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 90/176 (51%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            R+R  E+I R  I    ++ + LIG DSQ +EI  I KK  F  + AL   +  N + AA
Sbjct  3    RLRETEVILRLCIVFFILLSSCLIGLDSQTKEIAYIHKKVSFRYLLALEAELYINVVVAA  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y+LVQ+      V    S  +  S L ++  A+ +F+G             AAAQ ++  
Sbjct  63   YNLVQIGLGWYNVEQKTSNPKWFSYLLDQTAAYVVFAGTS-----------AAAQHSLLV  111

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C  + +FC Q+G  I  + I    M++L  ISAF+LFRLY   +
Sbjct  112  VTGSRELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSSISAFNLFRLYSPKR  167



>ref|XP_010433586.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 88/176 (50%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            ++R  E+I R  I  L ++ A LIG DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVFIVFLLLLTACLIGLDSQTKEIAYIHKKVSFKYLIALEAELYIDVVVAA  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y+L QL      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLAQLGLHWHSVEKKTSNTKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C  + +FC QVG  I  + I    M++L  ISAF+LFRLY   +
Sbjct  114  --GSKELQWMKWCYKFTRFCFQVGSAIILNYIAAGLMVLLSFISAFNLFRLYSPKR  167



>ref|XP_010448363.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 90/176 (51%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            ++R  E+I R  I  L ++ A LIG DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVCIVFLLLLTACLIGMDSQTKEIAYIHKKVSFKYLVALEAELYIDVVVAA  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y+L QL      V    S  +  S L ++  A+ +F+G             AAAQ ++  
Sbjct  63   YNLAQLGLHWHSVEQKTSNTKWFSYLLDQTAAYVVFAGTS-----------AAAQHSLLV  111

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C  + +FC QVG  I  + I    M++L  ISAF+LFRLY   +
Sbjct  112  VTGSKELQWMKWCYKFTRFCFQVGSAIILNYIAAGLMVLLSFISAFNLFRLYSPKR  167



>emb|CDP02964.1| unnamed protein product [Coffea canephora]
Length=169

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 91/165 (55%), Gaps = 6/165 (4%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  524
             L+ R       ++ A L+  DSQ + +F S+ +KA F D+KAL  LV     AAAY+++
Sbjct  3    TLVLRLFATSSLVLTACLVAFDSQTKLLFYSMVRKASFRDLKALSILVWVASAAAAYNVL  62

Query  523  QLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMR  344
            Q++R  +    G     K LAW  +  DQ +AYL   A +AA Q  V+A  GQS   WM+
Sbjct  63   QILRSRLFPQMG-----KNLAWFGYLLDQAVAYLVFAANSAALQGCVFAVSGQSNFGWMK  117

Query  343  ICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +C+ Y +FC Q+G  +      C++M ++  +SA+ LFRLY    
Sbjct  118  VCDKYTRFCIQIGGALICGYAACLAMAVISALSAYGLFRLYSPKH  162



>ref|XP_004149074.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like [Cucumis 
sativus]
 ref|XP_004163171.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like [Cucumis 
sativus]
 gb|KGN61092.1| hypothetical protein Csa_2G048830 [Cucumis sativus]
Length=188

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 84/150 (56%), Gaps = 5/150 (3%)
 Frame = -1

Query  643  GTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV-SMIRG----SVL  479
            G D +  +IF + KKA F  ++ALV ++  + +AA Y+++QL +C + +  +G       
Sbjct  28   GFDKETVQIFHVDKKASFKSLRALVIIIYVDSMAAGYNILQLCKCWIFAQPKGISKLGTH  87

Query  478  FNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEG  299
            F+  L W  F  DQ+ AYL+  +  A  ++A+ A  G  + QWM++CN + +FC QVG  
Sbjct  88   FHIYLFWLSFFLDQVAAYLTFASNTAGMEAALLAVTGAHDFQWMKLCNRFHRFCYQVGGA  147

Query  298  IASSLIVCISMIILCGISAFSLFRLYGDNK  209
                     +++++  ISAF+LFR Y  N 
Sbjct  148  FLCGYAAFFALLLISFISAFNLFRHYSPNH  177



>ref|XP_009341031.1| PREDICTED: CASP-like protein POPTRDRAFT_578614 [Pyrus x bretschneideri]
Length=192

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 89/155 (57%), Gaps = 3/155 (2%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSM---I  494
            ++ A L+G DSQ + +    +KA F D+ AL+ LV    +AA Y+L+Q+ + S+S     
Sbjct  30   VLTACLVGFDSQTKYVVFFYRKATFRDLNALLLLVYVVSVAAGYNLLQVGKSSLSACFKP  89

Query  493  RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCN  314
               V  N  LAW  F  DQ+  Y++ GA +A  Q+++ A  GQ + QW+++C+ Y +FC 
Sbjct  90   NLKVRTNIYLAWICFLLDQMAVYVTFGANSATFQASLLAVTGQEDFQWIKLCSKYTRFCF  149

Query  313  QVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            Q+G  +      CI M  +  ISAF+LFRLY   +
Sbjct  150  QIGGALTCGYAACIVMAFVSSISAFNLFRLYTPKQ  184



>ref|XP_010438829.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 88/176 (50%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            ++R  E+I R  I  L ++ A LIG DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVCIVFLLLLTACLIGLDSQTKEIAYIHKKVSFKYLIALEAELYIDVVVAA  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y+L QL      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLAQLGLHWHSVEKKTSNTKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C  + +FC QVG  I  + I    M++L  ISAF+LFRLY   +
Sbjct  114  --GSKELQWMKWCYKFTRFCFQVGSAIILNYIGAGLMVLLSFISAFNLFRLYSPKR  167



>dbj|BAF00509.1| hypothetical protein [Arabidopsis thaliana]
Length=82

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  370  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
            G+ +LQWMR+C MYGKFCNQ+  G++S+L+  I+M+ +  ISAFSLFRLYG  K +
Sbjct  22   GEEDLQWMRVCTMYGKFCNQMAIGVSSALLASIAMVFVSCISAFSLFRLYGATKDR  77



>ref|XP_006453396.1| hypothetical protein CICLE_v10009662mg [Citrus clementina]
 ref|XP_006465092.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X1 
[Citrus sinensis]
 ref|XP_006474164.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X1 
[Citrus sinensis]
 ref|XP_006483174.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X1 
[Citrus sinensis]
 gb|ESR66636.1| hypothetical protein CICLE_v10009662mg [Citrus clementina]
Length=179

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 83/151 (55%), Gaps = 8/151 (5%)
 Frame = -1

Query  646  IGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFN--  473
            +G D+Q + IF + +K  + ++ AL  LV     AA Y+L+QL R   S+     L N  
Sbjct  25   VGLDTQSKYIFYVDRKITYKELHALGALVYVASAAAGYNLLQLGR---SVFVSRYLGNSK  81

Query  472  ---KPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGE  302
               + LAW  +  DQ++ Y++ G  +AA + +V A  G  E QWM+ CN + +FC Q+G 
Sbjct  82   GSYRYLAWVSYLLDQMVVYIAFGTNSAAVEHSVLALSGMKEFQWMKWCNKFTRFCFQIGG  141

Query  301  GIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             + S    C  M++   ISAF+LFRLY   K
Sbjct  142  ALVSGYAACALMVLATSISAFNLFRLYSSEK  172



>gb|KDO46523.1| hypothetical protein CISIN_1g030313mg [Citrus sinensis]
Length=179

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 83/151 (55%), Gaps = 8/151 (5%)
 Frame = -1

Query  646  IGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFN--  473
            +G D+Q + IF + +K  + ++ AL  LV     AA Y+L+QL R   S+     L N  
Sbjct  25   VGLDTQSKYIFYVDRKITYKELHALGALVYVASAAAGYNLLQLGR---SVFVSRYLGNSK  81

Query  472  ---KPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGE  302
               + LAW  +  DQ++ Y++ G  +AA + +V A  G  E QWM+ CN + +FC Q+G 
Sbjct  82   GSYRYLAWVSYLLDQMVVYIAFGTNSAAVEHSVLALSGMKEFQWMKWCNKFTRFCFQIGG  141

Query  301  GIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             + S    C  M++   ISAF+LFRLY   K
Sbjct  142  ALVSGYAACALMVLATSISAFNLFRLYSSEK  172



>ref|XP_006282730.1| hypothetical protein CARUB_v10005865mg [Capsella rubella]
 gb|EOA15628.1| hypothetical protein CARUB_v10005865mg [Capsella rubella]
Length=176

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 90/176 (51%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            ++R  E+I R  I  L ++ A L+G DSQ +EI  I KK  F  + AL   +  +   AA
Sbjct  4    KLRETEVILRLCIVFLLLLTACLVGLDSQTKEIAYIHKKVSFRYLIALEAELYIDVGVAA  63

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y+LVQL      V    S  +  S L ++  A+ +F+G             AAAQ ++  
Sbjct  64   YNLVQLGLHWHNVEQKTSNPKWFSYLLDQTAAYVVFAGT-----------TAAAQHSMLV  112

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C  + +FC Q+G  I  + I    M++L  ISAF+LFRLY   +
Sbjct  113  VTGSQELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSFISAFNLFRLYSPKR  168



>ref|NP_567729.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8L8U9.1|CSPLS_ARATH RecName: Full=CASP-like protein 2C1; Short=AtCASPL2C1 [Arabidopsis 
thaliana]
 gb|AAM67108.1| unknown [Arabidopsis thaliana]
 dbj|BAD43134.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43495.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43765.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43774.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43852.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01471.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85119.1| uncharacterized protein AT4G25830 [Arabidopsis thaliana]
Length=175

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 89/176 (51%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            ++R  E+I R  I    ++ + LIG DSQ +EI  I K   F  + AL   +  + + AA
Sbjct  3    KLRETEVILRLCIVFFLLLTSCLIGLDSQTKEIAYIHKNVSFRYLLALEAELYIDVVVAA  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y+LVQL      V    S  +  S L ++  A+ +F+G             AAAQ ++  
Sbjct  63   YNLVQLGLGWYNVEQKTSNPKWFSYLLDQTAAYVVFAGTS-----------AAAQHSLLV  111

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C  + +FC Q+G  I  + I    M++L  ISAF+LFRLY   +
Sbjct  112  VTGSRELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSSISAFNLFRLYSPKR  167



>emb|CDY49469.1| BnaCnng17350D [Brassica napus]
Length=174

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 91/176 (52%), Gaps = 18/176 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            R+R  E++ R  I  L ++ +VLIG DSQ +EI  + KK  F  + AL   +  + + A 
Sbjct  3    RLRETEVVPRLCIVFLLLLTSVLIGLDSQTKEIAYMHKKVTFRYLFALEVELYIDVVVAV  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y++VQL      V    S  +  S + ++   + +FSG             AAAQ ++  
Sbjct  63   YNMVQLGLGWYGVAQKTSNSKWLSYILDQTAVYVVFSGAS-----------AAAQHSLLV  111

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
              G  ELQWM+ C  + +FC Q+G  I  + I  + M+IL  +SAF+LFRLY   +
Sbjct  112  VTGSRELQWMKWCYKFTRFCFQIGSAIILNYIAVVLMVILSFLSAFNLFRLYSPKR  167



>ref|XP_004242688.1| PREDICTED: CASP-like protein 2C1 [Solanum lycopersicum]
Length=200

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 87/150 (58%), Gaps = 5/150 (3%)
 Frame = -1

Query  655  AVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRC---SVSMIRG  488
            A L+G DSQ + +F +++ KA F  + AL  LV  +  AA Y+++QL+RC   + S +  
Sbjct  22   ACLVGFDSQTKVVFLTVQIKANFKYLGALSVLVWIDAAAAIYNVLQLLRCFFIATSKVDI  81

Query  487  SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQV  308
              + +K   W  F  DQ++ Y+   A +AA +++  A IG   LQWM+ICN + +FC Q+
Sbjct  82   KQISHKNY-WFFFLLDQVVVYIVFAANSAAIEASAIALIGIKSLQWMKICNRFTRFCIQI  140

Query  307  GEGIASSLIVCISMIILCGISAFSLFRLYG  218
            G  +    I  + + ++  ISAF LFRLY 
Sbjct  141  GAALILGYIAVLILFLVSSISAFQLFRLYS  170



>ref|XP_006413266.1| hypothetical protein EUTSA_v10026381mg [Eutrema salsugineum]
 gb|ESQ54719.1| hypothetical protein EUTSA_v10026381mg [Eutrema salsugineum]
Length=175

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 85/159 (53%), Gaps = 5/159 (3%)
 Frame = -1

Query  685  CVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCS  506
            C++  L ++ + L+G DSQ +E+  I KK  F D+ AL   +  + + AAY++VQL    
Sbjct  14   CIVFFL-LLTSFLVGLDSQTKEVAYIHKKVTFRDLFALEVELYIDVVVAAYNIVQLGFGW  72

Query  505  VSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYG  326
                 G    N    W  +  DQ   Y+     +AAAQ ++    G  ELQWM+ C+ + 
Sbjct  73   FG--AGQKTTNSK--WLSYLLDQTAVYVMFAGTSAAAQHSLLVVTGSRELQWMKWCSKFT  128

Query  325  KFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +FC Q+G  I  + I  I MIIL  +SAF+LFRLY   +
Sbjct  129  RFCFQIGSAIVLNYIAAILMIILSFLSAFNLFRLYSPKR  167



>gb|EEC69375.1| hypothetical protein OsI_38510 [Oryza sativa Indica Group]
Length=132

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            ++++ ++AE+  RC +C LA + A L+GT SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  544  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  437
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>ref|NP_001066880.1| Os12g0514300 [Oryza sativa Japonica Group]
 dbj|BAF29899.1| Os12g0514300 [Oryza sativa Japonica Group]
Length=157

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            ++++ ++AE+  RC +C LA + A L+GT SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  544  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  437
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>ref|XP_006366193.1| PREDICTED: CASP-like protein VIT_11s0052g01140-like [Solanum 
tuberosum]
Length=200

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 86/147 (59%), Gaps = 3/147 (2%)
 Frame = -1

Query  649  LIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCS-VSMIRGSV-L  479
            L+G DSQ + +F ++  KA +  + AL  LV  +  AA+Y+++QL+R   ++  +G +  
Sbjct  24   LVGFDSQTKVVFLTVHIKANYKYLDALSVLVWIDAAAASYNVLQLLRSFFITTSKGDIKQ  83

Query  478  FNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEG  299
            F+    W  F  DQ + Y+   A +AA +++V A IG   LQWM+ICN + +FC Q+G  
Sbjct  84   FSHKNYWFFFLLDQAVVYIVFAANSAAIEASVIALIGIKSLQWMKICNRFTRFCIQMGAA  143

Query  298  IASSLIVCISMIILCGISAFSLFRLYG  218
            +    +  + + ++  ISAF LFRLY 
Sbjct  144  LILGYLAVVILFLISSISAFQLFRLYS  170



>ref|XP_010545424.1| PREDICTED: CASP-like protein 2C1 [Tarenaya hassleriana]
Length=188

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 89/177 (50%), Gaps = 4/177 (2%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            +K+  + +  AE   R  +  + ++ A LIG DSQ R I    KK  F  +K+L   +  
Sbjct  3    MKMRMRHLTTAEAAVRLSVALILLLTACLIGFDSQTRIIAYYHKKVTFRVLKSLEIGMYI  62

Query  553  NGLAAAYSLVQL--VRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  380
            +  AAAY+L+QL  +   V   + S     P  W  +  DQ  AY       AAA++++ 
Sbjct  63   DAAAAAYNLLQLGYLWFRVKQQKDSKSVYVP--WLCYILDQTAAYAVYAGTCAAAENSLL  120

Query  379  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
               G  ELQWM  C+ Y +FC QVG  +  S +    M +L  +SAF LFRLY  ++
Sbjct  121  VVRGSKELQWMEWCSKYTRFCFQVGGAVVCSFLAAALMTLLSALSAFRLFRLYSPSR  177



>emb|CBI17818.3| unnamed protein product [Vitis vinifera]
Length=224

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 83/152 (55%), Gaps = 8/152 (5%)
 Frame = -1

Query  703  AELIFRCVICGLAIVGAVLIGTDSQVREIFS-IRKKAKFTDMKALVFLVIANGLAAAYSL  527
            AE   R     + ++ A L+G D+Q + +FS I+K A F D+ AL  +V  + +AA Y+L
Sbjct  53   AEAFLRLFAILVLVLTACLLGFDTQTKLLFSTIKKTATFRDLGALQVVVYVDSVAAGYNL  112

Query  526  VQLVRCSVSMIRGSVLFNK---PLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  356
            +QL R  +S      L N     L W  F  DQ   Y    A  AA Q+++ A  G+S L
Sbjct  113  LQLGRGFISAKLKGKLINVSYVTLPWVCFLLDQAAVYTVFSANTAALQASIIAVTGESSL  172

Query  355  QWMRICNMYGKFCNQVG----EGIASSLIVCI  272
            QWM++CN Y +FC QVG     G  +SL++CI
Sbjct  173  QWMKVCNRYTRFCIQVGGALLSGYLASLLMCI  204



>gb|EEC69376.1| hypothetical protein OsI_38511 [Oryza sativa Indica Group]
Length=143

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            ++++ ++AE+  RC +C LA + A L+GT SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCALCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  544  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  437
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>ref|XP_003553094.1| PREDICTED: CASP-like protein 10-like [Glycine max]
Length=203

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 88/180 (49%), Gaps = 9/180 (5%)
 Frame = -1

Query  742  GSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  563
            G  L+     +R AE   R V  GL +   VL+  +SQ  E  S+     ++D+ A  +L
Sbjct  21   GDELEGNTSALRTAETFLRLVPVGLCVSALVLMLKNSQQNEYGSV----DYSDLGAFRYL  76

Query  562  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  383
            V ANG+ A YSL   V    +M R S +   P AW  F  DQ++ Y+ L A A + +   
Sbjct  77   VHANGICAGYSLFSAVIA--AMPRPSTM---PRAWTFFLLDQVLTYIILAAGAVSTEVLY  131

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             A+ G +   W   C  +G+FC++V   +A + +     ++L  IS++ LF  Y    S+
Sbjct  132  LAEKGDAATTWSSACGSFGRFCHKVTASVAITFVAVFCYVLLSLISSYKLFTNYDAPASR  191



>ref|XP_006845610.1| hypothetical protein AMTR_s00019p00209400 [Amborella trichopoda]
 gb|ERN07285.1| hypothetical protein AMTR_s00019p00209400 [Amborella trichopoda]
Length=178

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 96/173 (55%), Gaps = 3/173 (2%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            +D R++ +E + R ++  +  V   ++   ++  E   I+K+A   D+  L  LV+   +
Sbjct  1    MDARLKRSEALLR-LLAAMFAVATAVVVATNRETEYMIIQKRATMKDLNCLEVLVMVESI  59

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
            AA Y +VQL++C +S    S      LAW   S DQ++ Y  LGAVAAA Q + +AK G 
Sbjct  60   AAGYQMVQLLKCILSWNSTSCC--TRLAWLTLSFDQVVVYGCLGAVAAAIQGSYFAKFGA  117

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
             ELQW ++CN+Y +FC  +   + + L   ++M ++  +SAF+LF  +   + 
Sbjct  118  RELQWSKLCNIYQRFCLHITYSLITGLCSALAMAVVSAMSAFNLFSHFSPTRP  170



>ref|XP_003610149.1| hypothetical protein MTR_4g128520 [Medicago truncatula]
 gb|KEH15650.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=184

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 88/174 (51%), Gaps = 5/174 (3%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVRE-IFSIRKKAKFTDMKALVFLVIANGLAA  539
            R+   E++ R       +  A ++  D++ +  I  I+KKA + D+ AL  L+     AA
Sbjct  4    RMAKGEVLLRVSAILFLVSTACIVAFDTETKVVILMIKKKATYKDLDALKILLYVTSAAA  63

Query  538  AYSLVQLVRCSVSMIRGSVLFNKP----LAWAIFSGDQLMaylslgavaaaaqsavyAKI  371
             Y+++QL + S S       FN      +AW  F  DQ++ YL+     +A ++ ++A  
Sbjct  64   GYNMLQLCKHSFSACSTIRNFNDSYYMHMAWISFLLDQIVVYLTFATNTSAFEACLFALT  123

Query  370  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            G    QWM++CN + +FC Q+G  I    I  I M ++  ISA+ + R+Y   +
Sbjct  124  GSEAFQWMKVCNKFTRFCYQIGGAILCCYIASILMAMISTISAYKVLRMYSPKR  177



>gb|EAY84708.1| hypothetical protein OsI_06078 [Oryza sativa Indica Group]
Length=195

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 5/169 (3%)
 Frame = -1

Query  703  AELIFR--CVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  530
            AE + R  CV+  +A   A+L+G  ++ + +  +RK A   D++AL  L +A   AA Y 
Sbjct  16   AERLLRGGCVV--MAATAALLLGFSAETKTVLFVRKTAVAKDVQALWVLTVAAAAAAGYH  73

Query  529  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  350
              QLVRC      G       +AW  F  D+  AY+   + AAA Q+ +   IG   LQW
Sbjct  74   FAQLVRCMYCSSSGDA-GAMAVAWTSFLLDKGCAYVVFASTAAALQACMVGLIGVEALQW  132

Query  349  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             ++CN+Y +FC Q   G+  S +    M +L   SA  LFRLY     +
Sbjct  133  SKLCNIYTRFCEQAAAGMLCSFLAAAGMAVLSAFSARRLFRLYSPAGHR  181



>ref|XP_007154779.1| hypothetical protein PHAVU_003G147200g [Phaseolus vulgaris]
 gb|ESW26773.1| hypothetical protein PHAVU_003G147200g [Phaseolus vulgaris]
Length=180

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 84/155 (54%), Gaps = 7/155 (5%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVR---CSVSM  497
            ++ A L+  D+Q + +   I+KKA + D+ AL   V     AA Y+L+QL +   CS   
Sbjct  21   VLSACLVAFDTQTKVVLLGIQKKATYNDLHALKISVYVTSAAAGYNLLQLCKHSTCSRGN  80

Query  496  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  317
             +GS +    +AW     DQ+  Y++LG   A+  +++ A  G   LQWM++C+ + +FC
Sbjct  81   FKGSYM---CMAWISLFLDQIAVYITLGTNTASVAASMMAVTGSEALQWMKVCDKFSRFC  137

Query  316  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
             Q+G  +    +  I M ++  ISA+ +FR+Y   
Sbjct  138  IQIGGALLCGYVASILMALVSTISAYKVFRMYSPK  172



>ref|NP_001046070.1| Os02g0177700 [Oryza sativa Japonica Group]
 sp|Q6ETN2.1|CSPLM_ORYSJ RecName: Full=CASP-like protein 2C2; Short=OsCASPL2C2 [Oryza 
sativa Japonica Group]
 dbj|BAD27988.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF07984.1| Os02g0177700 [Oryza sativa Japonica Group]
 dbj|BAG99819.1| unnamed protein product [Oryza sativa Japonica Group]
Length=195

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 5/169 (3%)
 Frame = -1

Query  703  AELIFR--CVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  530
            AE + R  CV+  +A   A+L+G  ++ + +  +RK A   D++AL  L +A   AA Y 
Sbjct  16   AERLLRGGCVV--MAATAALLLGFSAETKTVLFVRKTAVAKDVQALWVLTVAAAAAAGYQ  73

Query  529  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  350
              QLVRC      G       +AW  F  D+  AY+   + AAA Q+ +   IG   LQW
Sbjct  74   FAQLVRCMYCSSSGDA-GAMAVAWTSFLLDKGCAYVVFASTAAALQACMVGLIGVEALQW  132

Query  349  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             ++CN+Y +FC Q   G+  S +    M +L   SA  LFRLY     +
Sbjct  133  SKLCNIYTRFCEQAAAGMLCSFLAAAGMAVLSAFSARRLFRLYSPAGHR  181



>ref|XP_002989705.1| hypothetical protein SELMODRAFT_272089 [Selaginella moellendorffii]
 sp|D8T2C0.1|CSPL1_SELML RecName: Full=CASP-like protein 2U6; Short=SmCASPL2U6 [Selaginella 
moellendorffii]
 gb|EFJ09182.1| hypothetical protein SELMODRAFT_272089 [Selaginella moellendorffii]
Length=203

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 90/175 (51%), Gaps = 19/175 (11%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI-------FSIRKKAKFTDMKA  575
            LK  D  +R A      V C + +V  VLI TD Q   I        +I K   F   KA
Sbjct  29   LKRTDLMLRFAAF----VCCTVTMV--VLI-TDKQTSAIQVPGFNNLTITKTVSFDLAKA  81

Query  574  LVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaa  395
             V+LV A G+ A Y+L+ LV   +S  R     +K +AW IF  DQL+ Y+ L A AA+ 
Sbjct  82   FVYLVSAAGIGAGYTLLVLVLSIISAER-----SKAIAWFIFVFDQLITYVLLAAAAAST  136

Query  394  qsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            + A        E  W+++C+++G+FC+Q+G  + +SLI  +       ISA+ LF
Sbjct  137  EVAYMGAHAPPEASWLKVCSLFGRFCHQLGASLVTSLISTVLFAFSAAISAYYLF  191



>emb|CAB39604.1| putative mitochondrial protein [Arabidopsis thaliana]
 emb|CAB79438.1| putative mitochondrial protein [Arabidopsis thaliana]
Length=618

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 89/173 (51%), Gaps = 18/173 (10%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            ++R  E+I R  I    ++ + LIG DSQ +EI  I K   F  + AL   +  + + AA
Sbjct  3    KLRETEVILRLCIVFFLLLTSCLIGLDSQTKEIAYIHKNVSFRYLLALEAELYIDVVVAA  62

Query  535  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  377
            Y+LVQL      V    S  +  S L ++  A+ +F+G            +AAAQ ++  
Sbjct  63   YNLVQLGLGWYNVEQKTSNPKWFSYLLDQTAAYVVFAG-----------TSAAAQHSLLV  111

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
              G  ELQWM+ C  + +FC Q+G  I  + I    M++L  ISAF+LFRLY 
Sbjct  112  VTGSRELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSSISAFNLFRLYS  164



>ref|XP_002991776.1| hypothetical protein SELMODRAFT_272229 [Selaginella moellendorffii]
 sp|D8T829.1|CSPL2_SELML RecName: Full=CASP-like protein 2U5; Short=SmCASPL2U5 [Selaginella 
moellendorffii]
 gb|EFJ07180.1| hypothetical protein SELMODRAFT_272229 [Selaginella moellendorffii]
Length=203

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 89/175 (51%), Gaps = 19/175 (11%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI-------FSIRKKAKFTDMKA  575
            LK  D  +R A      V C + +V  VLI TD Q   I        +I K   F   KA
Sbjct  29   LKRTDLMLRFAAF----VCCAVTMV--VLI-TDKQTSAIQVPGFNNLTITKTVSFDLAKA  81

Query  574  LVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaa  395
             V+LV A G+ A Y+L+ LV   +S  R     +K +AW IF  DQL+ Y+ L A AA+ 
Sbjct  82   FVYLVSAAGIGAGYTLLVLVLSIISAER-----SKAIAWFIFVFDQLITYVLLAAAAAST  136

Query  394  qsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            + A        E  W+++C+++G+FC+Q+G  + +S I  +       ISA+ LF
Sbjct  137  EVAYMGAHAPPEASWLKVCSLFGRFCHQLGASLVTSFISTVLFAFSAAISAYYLF  191



>sp|P0DH82.1|CSPL1_MARPO RecName: Full=CASP-like protein 2U1; Short=MpCASPL2U1 [Marchantia 
polymorpha]
Length=216

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 88/167 (53%), Gaps = 6/167 (4%)
 Frame = -1

Query  718  KRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI----FSIRKKAKFTDMKALVFLVIAN  551
            +R+R A ++ R     L +   V + TD Q         +I K A++T++ AL   V  N
Sbjct  33   RRMRTASILMRLTAMALCVTALVTMVTDKQTHYFNFASTTIVKTAEYTNVLALKVFVYTN  92

Query  550  GLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI  371
            G+ A YSL+Q +   V+  + S   +K   W  F  DQ + Y+ +G   AA + A  A+ 
Sbjct  93   GVIAGYSLLQALWTIVA--KSSYSTSKARLWTTFFLDQFIVYVLIGVTGAATEVAYIAEK  150

Query  370  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            G+S++ W + CN +G+FC+QVG  +    +  ++++ L  +SA  LF
Sbjct  151  GESDVAWPKQCNNFGRFCSQVGASVIVCFVAILTLVFLAVLSAKQLF  197



>ref|XP_002273403.2| PREDICTED: CASP-like protein 2C1 [Vitis vinifera]
 sp|A7Q6G6.1|CSPL9_VITVI RecName: Full=CASP-like protein 2C1; Short=VvCASPL2C1 [Vitis 
vinifera]
Length=206

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 77/142 (54%), Gaps = 4/142 (3%)
 Frame = -1

Query  703  AELIFRCVICGLAIVGAVLIGTDSQVREIFS-IRKKAKFTDMKALVFLVIANGLAAAYSL  527
            AE   R     + ++ A L+G D+Q + +FS I+K A F D+ AL  +V  + +AA Y+L
Sbjct  31   AEAFLRLFAILVLVLTACLLGFDTQTKLLFSTIKKTATFRDLGALQVVVYVDSVAAGYNL  90

Query  526  VQLVRCSVSMIRGSVLFNK---PLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  356
            +QL R  +S      L N     L W  F  DQ   Y    A  AA Q+++ A  G+S L
Sbjct  91   LQLGRGFISAKLKGKLINVSYVTLPWVCFLLDQAAVYTVFSANTAALQASIIAVTGESSL  150

Query  355  QWMRICNMYGKFCNQVGEGIAS  290
            QWM++CN Y +FC QVG  + S
Sbjct  151  QWMKVCNRYTRFCIQVGGALLS  172



>ref|NP_001237350.1| CASP-like protein 2C1 [Glycine max]
 sp|C6SZ04.1|CSPL3_SOYBN RecName: Full=CASP-like protein 2C1; Short=GmCASPL2C1 [Glycine 
max]
 gb|ACU14477.1| unknown [Glycine max]
Length=180

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 83/155 (54%), Gaps = 7/155 (5%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV---SM  497
            ++ A L+  D+Q + +F SI KKA + D+ AL  LV     AA Y+L+ L + S+     
Sbjct  21   VLTACLVALDTQTKVVFVSIEKKATYKDLNALKILVYVTCAAAGYNLLLLCKHSIWSRKN  80

Query  496  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  317
             +GS L    +AW  FS DQ+  Y++  A  A   +AV A  G    QW+++C+ + +FC
Sbjct  81   FKGSYL---CMAWICFSLDQIAVYMTFAANTATMGAAVLAISGSEAFQWLKVCDKFTRFC  137

Query  316  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
             ++G  +       + M ++  ISA+ +FR+Y   
Sbjct  138  VEIGGALLCGYAASMLMALISTISAYKVFRMYSPK  172



>gb|KHN22710.1| CASP-like protein 3 [Glycine soja]
Length=180

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 83/155 (54%), Gaps = 7/155 (5%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV---SM  497
            ++ A L+  D+Q + +F SI KKA + D+ AL  LV     AA Y+L+ L + S+     
Sbjct  21   VLTACLVALDTQTKVVFISIEKKATYKDLNALKILVYVTCAAAGYNLLLLCKHSIWSRKN  80

Query  496  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  317
             +GS L    +AW  FS DQ+  Y++  A  A   +AV A  G    QW+++C+ + +FC
Sbjct  81   FKGSYL---CMAWICFSLDQIAVYMTFAANTATMGAAVLAISGSEAFQWLKVCDKFTRFC  137

Query  316  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
             ++G  +       + M ++  ISA+ +FR+Y   
Sbjct  138  VEIGGALLCGYAASMLMALISTISAYKVFRMYSPK  172



>ref|XP_009798279.1| PREDICTED: CASP-like protein 2C1 [Nicotiana sylvestris]
Length=190

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 87/156 (56%), Gaps = 4/156 (3%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV--SMI  494
            ++ A L+G DSQ + +F ++ +KA F DM AL FLV  +   A+Y+++ ++RC +  +  
Sbjct  19   VLTACLMGFDSQTKLLFDTVERKASFNDMDALFFLVWIDAAVASYNVLHVLRCFLIPTTA  78

Query  493  RGSV-LFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  317
            +G V   +    W  F  DQ   Y    A +AA +++  A  G   LQWM++CN + +FC
Sbjct  79   KGDVKQRSYKNYWLFFFLDQAAVYTVFAAQSAAVEASAIALAGVRSLQWMKLCNRFTRFC  138

Query  316  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             Q+G  +       + ++++  +SAF LFRLY   K
Sbjct  139  IQIGGALLCGYAAVLVLVVVSSLSAFQLFRLYSPKK  174



>ref|XP_006855416.1| hypothetical protein AMTR_s00057p00159510 [Amborella trichopoda]
 gb|ERN16883.1| hypothetical protein AMTR_s00057p00159510 [Amborella trichopoda]
Length=184

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 8/132 (6%)
 Frame = -1

Query  616  FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGS--VLFNKPLAWAIFSG  443
            F I ++AKF    A ++ V+AN +A AYS+   V   VS    S  +LF+ P   A+F+G
Sbjct  54   FPITQEAKFNQSPAFIYFVVANAVACAYSIFTAVVSGVSKKSPSDKLLFHLPFFDAVFAG  113

Query  442  DQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMI  263
                  +   A  A+A  A     G S   W  IC ++GKFC  VG   A SL+  I+ +
Sbjct  114  ------IVGSATGASAAIAYVGLKGNSHAMWPAICPVFGKFCRYVGGSTAVSLVASIAFV  167

Query  262  ILCGISAFSLFR  227
            +L G+S+ SL+R
Sbjct  168  LLVGLSSHSLYR  179



>ref|XP_004507839.1| PREDICTED: CASP-like protein 3-like isoform X1 [Cicer arietinum]
Length=182

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 90/173 (52%), Gaps = 7/173 (4%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            R+   E++ R +     ++ A L+  D++ + +  + KK  + D+  L  LV      A 
Sbjct  4    RMARGEILLRVLAILFLLLTACLVAFDTETKLLLFVEKKVTYKDLDVLKILVYITSTVAG  63

Query  535  YSLVQLVR-----CSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI  371
            Y+++QL +     C     +GS      +AW     DQ+  YL+LG+ +AA ++A++A  
Sbjct  64   YNMLQLCKYSFSACPTWSFKGSDY--NYMAWISLLVDQIGVYLTLGSNSAAFEAAMFAYN  121

Query  370  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
            G    QWM++C+ Y +FCN +G  +    +  I M ++  ISA+ +FR+Y  N
Sbjct  122  GSEAFQWMKVCDKYSRFCNLIGVALLCGYVASILMALISTISAYKVFRIYSPN  174



>gb|AFK47158.1| unknown [Lotus japonicus]
Length=207

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 9/164 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R+ E   R    GL +   V++  +SQ  E  ++     +TD+ A  +LV ANG+ A Y
Sbjct  29   LRIVETFLRLFPIGLCVTALVIMLKNSQENEYGTL----DYTDLSAFRYLVHANGICAGY  84

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL   V   +++ R S +   P AW  F  DQL+ Y+ L A A + +     + G     
Sbjct  85   SLFSAVI--IALPRPSTM---PRAWTFFVLDQLLTYIILAAGALSMEVLYLTEKGDPPAA  139

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            W   C  +G FC++    IA + +  I  ++L  IS++ LF  Y
Sbjct  140  WSSACGYFGPFCHKATASIAITFVAVICYVVLSLISSYKLFSKY  183



>ref|XP_010691480.1| PREDICTED: CASP-like protein 2C1 [Beta vulgaris subsp. vulgaris]
Length=197

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 90/174 (52%), Gaps = 5/174 (3%)
 Frame = -1

Query  721  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSI-RKKAKFTDMKALVFLVIANGL  545
            ++ VR+  L+    +  L++   VL+ TD Q R  FS+ RKK  +     L   +    +
Sbjct  7    NRLVRIEALLRFFALLTLSLASIVLV-TDQQSRIYFSVYRKKVNYKLATILEVSLYVYSI  65

Query  544  AAAYSLVQLVRC-SVSMIRGSVLF--NKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
             A Y+L+QLVRC + +      L   N  L W  F  DQ+  Y+      A+ + ++ A 
Sbjct  66   GAGYNLLQLVRCMAFTNYEEDKLSWSNHILIWIYFLLDQMAVYVVFAICCASIELSLLAL  125

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
             G  +LQWM++C  Y +FC Q+G  I+ + +  I+MI++  IS F+L R Y  N
Sbjct  126  TGVEDLQWMKLCANYVRFCVQIGGYISCAGLASIAMIVISAISTFNLLRWYSPN  179



>ref|XP_006657208.1| PREDICTED: CASP-like protein Os06g0656300-like [Oryza brachyantha]
Length=191

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 77/142 (54%), Gaps = 6/142 (4%)
 Frame = -1

Query  637  DSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKP---  467
            ++Q   +  IRKKA   D++AL  L +A   +A Y L+QL++C      G     KP   
Sbjct  39   NTQTETVLLIRKKATVRDVQALWVLAMATAASAGYHLLQLLKC---FYLGRFAGGKPCRG  95

Query  466  LAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASS  287
            +AW  F  D+  AY++     AAAQ+ + A  G   LQW ++C++Y +FC QV   +   
Sbjct  96   VAWLCFLLDKGCAYVTFATTVAAAQACMVALDGAHALQWNKLCHIYTRFCEQVAGSLVCG  155

Query  286  LIVCISMIILCGISAFSLFRLY  221
            ++  +   +L  +SA +LFRLY
Sbjct  156  MLAAVGAALLSAVSARNLFRLY  177



>gb|KHN08760.1| CASP-like protein 10 [Glycine soja]
Length=203

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 87/180 (48%), Gaps = 9/180 (5%)
 Frame = -1

Query  742  GSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  563
            G  L+     +R AE   R V  GL +   VL+  +SQ  E  S+     ++D+ A  +L
Sbjct  21   GDELEGNTSALRTAETFLRLVPVGLCVSALVLMLKNSQQNEYGSV----DYSDLGAFRYL  76

Query  562  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  383
            V ANG+ A YSL   V    +M R S +     AW  F  DQ++ Y+ L A A + +   
Sbjct  77   VHANGICAGYSLFSAVI--AAMPRPSTMTR---AWTFFLLDQVLTYIILAAGAVSTEVLY  131

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             A+ G +   W   C  +G+FC++V   +A + +     ++L  IS++ LF  Y    S+
Sbjct  132  LAEKGDAATTWSSACGSFGRFCHKVTASVAITFVAVFCYVLLSLISSYKLFTNYDAPASR  191



>ref|XP_010531897.1| PREDICTED: CASP-like protein 2A1 [Tarenaya hassleriana]
Length=199

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 93/191 (49%), Gaps = 8/191 (4%)
 Frame = -1

Query  742  GSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFL  563
            G+  + +   +R AE + R     L +   V++  DS+  +  S+     ++++ A  +L
Sbjct  12   GAAEEEMSAGIRTAETMLRLAPVALCVAALVVMLKDSESSDFGSV----SYSNLIAFRYL  67

Query  562  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  383
            V ANG+ A YSL  L     +M R S  F  P AW  F  DQ++ Y+ LGA A +++   
Sbjct  68   VHANGICAGYSL--LSAAITAMSRSSSTF--PRAWTFFCLDQVLTYMVLGAGAVSSEVIY  123

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
             A  G S + W   C+ +G FC++    +  + +V    + L  +S++ LF LYG   S 
Sbjct  124  IAYRGDSAITWSEACSSFGSFCHKATASVVITFVVVSLYVFLSLLSSYKLFSLYGPPPSS  183

Query  202  CNGR*RKTIYV  170
                 + T+ V
Sbjct  184  SVHSHKDTVQV  194



>ref|XP_009783950.1| PREDICTED: CASP-like protein 2A1 [Nicotiana sylvestris]
Length=189

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 91/174 (52%), Gaps = 13/174 (7%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE + R +   L +V  V++  +SQ  +  S+     ++D+    +LV ANG+ AAY
Sbjct  17   MRTAETMLRLLPMALCVVALVIMLKNSQTNDFGSL----SYSDLGTFRYLVHANGICAAY  72

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL+  +  +V   R + +   P AW  F  DQ++ Y+ L A AA+ +    A  G + + 
Sbjct  73   SLLSAIVSAVP--RPTTM---PKAWTFFLLDQILTYVILAAGAASTEVVYLAYKGDTAVT  127

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY----GDNKSK  203
            W   C ++G FC +  E +A + IV +  + +  +S++ LF  Y    GD K+K
Sbjct  128  WSETCGLFGGFCRKATESVAITFIVGLCYVGISLLSSYRLFSKYDAPIGDYKNK  181



>ref|XP_002276206.1| PREDICTED: CASP-like protein 1E2 [Vitis vinifera]
 sp|A7NW78.1|CSPL5_VITVI RecName: Full=CASP-like protein 1E2; Short=VvCASPL1E2 [Vitis 
vinifera]
Length=195

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 88/175 (50%), Gaps = 15/175 (9%)
 Frame = -1

Query  727  VVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREI----------FSIRKKAKFTDMK  578
            V   ++R  +L+ R V   L +V AVL+G D Q + +            +   AK+  + 
Sbjct  22   VTGGKLRPFDLVLRVVALALTLVAAVLLGVDKQTKVVSLQLLPTLPPMDVPVTAKWRYLS  81

Query  577  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            A V+ V++N +A +Y+ + L+  SV   +G    NK L  AI   D +M  L   +  AA
Sbjct  82   AFVYFVVSNAIACSYAALSLL-LSVGNSKG----NKGLGLAITVMDLVMVALLFSSNGAA  136

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSL  233
                +    G S ++W ++CN++GKFCNQV   +  S    ++  +L  ++AF+L
Sbjct  137  GAIGLMGYEGNSRVRWGKVCNVFGKFCNQVAVALGLSFFGGLAFFLLVVMAAFAL  191



>dbj|BAJ84836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=207

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 83/171 (49%), Gaps = 9/171 (5%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV A
Sbjct  27   LSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVYA  82

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A 
Sbjct  83   NGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLAY  137

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
             G  E+ W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y
Sbjct  138  NGDKEVTWSEACGVFGGFCRQARTSVAITFGTVVCYILLSLISSYRLFSAY  188



>ref|XP_009611405.1| PREDICTED: CASP-like protein 2C1 [Nicotiana tomentosiformis]
Length=242

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 89/159 (56%), Gaps = 10/159 (6%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV--SMI  494
            ++ A L+G DSQ + +F ++ +KA F D+ AL  LV  +   A+Y+++Q++RC +  +  
Sbjct  71   VLTACLMGFDSQTKLLFDTVERKASFKDLNALFVLVWIDAAVASYNVLQVLRCFLIPTTS  130

Query  493  RGSVLFNKPLA----WAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYG  326
            +G +   K ++    W  F  DQ   Y    A +AA +++  A  G   LQWM++CN + 
Sbjct  131  KGDI---KQMSYKNYWLFFFLDQAAVYTVFAAQSAAVEASAIALAGVRSLQWMKLCNRFT  187

Query  325  KFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
            +FC Q+G  +       + ++++  +SAF LFRLY   K
Sbjct  188  RFCIQIGGALLCGYAAILLLVVVSSLSAFQLFRLYSPKK  226



>dbj|BAJ85571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=207

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 83/171 (49%), Gaps = 9/171 (5%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV A
Sbjct  27   LSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVYA  82

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A 
Sbjct  83   NGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLAY  137

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
             G  E+ W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y
Sbjct  138  NGDKEVTWSEACGVFGGFCRQARTSVAITFGSVVCYILLSLISSYRLFSAY  188



>gb|EMT22680.1| hypothetical protein F775_30108 [Aegilops tauschii]
Length=204

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 83/171 (49%), Gaps = 9/171 (5%)
 Frame = -1

Query  733  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIA  554
            L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV A
Sbjct  24   LSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVYA  79

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            NGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A 
Sbjct  80   NGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLAY  134

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
             G  E+ W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y
Sbjct  135  NGDKEVTWSEACGVFGGFCRQARTSVAITFGSVVCYILLSLISSYRLFSAY  185



>ref|XP_003549486.1| PREDICTED: CASP-like protein 3-like [Glycine max]
 gb|KHN17582.1| CASP-like protein 3 [Glycine soja]
Length=180

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 82/155 (53%), Gaps = 7/155 (5%)
 Frame = -1

Query  664  IVGAVLIGTDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV---SM  497
            ++ A L+  D+Q + +F SI KKA   D+ AL  LV     +A Y+L+ L + S+     
Sbjct  21   VLTACLVALDTQTKVVFLSIEKKATCRDLNALKILVYVTSASAGYNLLLLCKHSIWSRKN  80

Query  496  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  317
             +GS L    +AW  F  DQ+  Y++  A  AA  +A+ A  G    QW+++C+ + +FC
Sbjct  81   FKGSYL---CMAWICFLLDQIAVYMTFAANTAAMGAAMLAITGSDAFQWLKVCDKFTRFC  137

Query  316  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  212
             Q+G  +       I M ++  ISA+ +FR+Y   
Sbjct  138  VQIGGALLCGYAASIIMALISTISAYQVFRMYSPK  172



>ref|XP_002979076.1| hypothetical protein SELMODRAFT_444075 [Selaginella moellendorffii]
 gb|EFJ20033.1| hypothetical protein SELMODRAFT_444075 [Selaginella moellendorffii]
Length=1020

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 51/176 (29%), Positives = 86/176 (49%), Gaps = 13/176 (7%)
 Frame = -1

Query  709  RLAELIFRCVICGLAIVGAVLIGTDSQV-----------REIFSIRKKAKFTDMKALVFL  563
            R++ ++ R  +  L I+   L+ TD +            R +F + K AK+  +  L F 
Sbjct  31   RISIILLRSFLLVLVIISEALMVTDRETGSVPLPFFGLPRPVF-VTKTAKYELVTGLKFY  89

Query  562  VIANGLAAAYSLVQLV-RCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  386
            V A G+   Y+++ L+    +   +G+V+  K +AW  F  D +M YL L + A A +  
Sbjct  90   VDALGVVIGYTVLHLLFNIGLVATKGTVVDCKSVAWISFIADSMMGYLLLSSAAVATEIG  149

Query  385  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
              A+ G   + W ++CN +G FC      +    I  +   ++ GISA+ LFRLYG
Sbjct  150  YLAEEGAPAVLWRKVCNAFGYFCTVYAISVVICFIAALVSFVVVGISAYHLFRLYG  205



>ref|XP_003579514.1| PREDICTED: CASP-like protein 2A1 [Brachypodium distachyon]
Length=204

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 83/170 (49%), Gaps = 9/170 (5%)
 Frame = -1

Query  730  KVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIAN  551
             V + RVR  E + R V  GL +    ++  D+Q  E  ++     ++D+    +LV AN
Sbjct  26   TVAEARVRPVETLLRAVPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFRYLVYAN  81

Query  550  GLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI  371
            GL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A  
Sbjct  82   GLCAAYSLVSAFYTAVP--RPATLCR---SWIVFLLDQVFTYLILAAGAASAELLYLAYN  136

Query  370  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            G  E+ W   C ++G FC Q    +  +    +  I+L  IS++ LF  Y
Sbjct  137  GDKEVTWSEACGVFGGFCRQARTSVGITFGSVLCYILLSLISSYRLFSAY  186



>ref|NP_001049263.2| Os03g0196400 [Oryza sativa Japonica Group]
 dbj|BAF11177.2| Os03g0196400, partial [Oryza sativa Japonica Group]
Length=103

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 4/71 (6%)
 Frame = -1

Query  376  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCN  197
            K GQ E QWM+ C++Y +FC Q G G+A ++   ++M+ +  ISAF+LFRLYG++    N
Sbjct  34   KYGQPEFQWMKTCHLYKRFCAQAGGGVACAIAASVNMVGVALISAFNLFRLYGNS----N  89

Query  196  GR*RKTIYVVA  164
            G  + T   +A
Sbjct  90   GGGKATTTTMA  100



>ref|XP_007141978.1| hypothetical protein PHAVU_008G242000g [Phaseolus vulgaris]
 gb|ESW13972.1| hypothetical protein PHAVU_008G242000g [Phaseolus vulgaris]
Length=208

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 85/164 (52%), Gaps = 9/164 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +RL E + R     L++   +++  +S+  E  S+     +TD+ A  +LV  NG+ A Y
Sbjct  39   LRLVETLLRLFPILLSVTALIIMLKNSEENEYGSV----SYTDLSAFRYLVHMNGICAGY  94

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL  ++  ++  +      + P+ W +F  DQ++ YL LGA A + +    A+ G S   
Sbjct  95   SLFSVIFAALPSLS-----SMPINWTLFLLDQVLTYLILGAGAVSMEVLYLAEKGNSATT  149

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            W   C  +G FC++V   IA + +V I  ++L  IS++ LF  Y
Sbjct  150  WSSACRAFGSFCDKVTASIAITFVVVICYVLLSLISSYKLFTNY  193



>sp|P0DI24.1|CSPL3_PTEAA RecName: Full=CASP-like protein 2U1; Short=PaCASPL2U1 [Pteridium 
aquilinum subsp. aquilinum]
Length=196

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 94/171 (55%), Gaps = 7/171 (4%)
 Frame = -1

Query  718  KRVRLAELIFRCVICGLAIVGAVLIGTDSQ--VREI--FSIRKKAKFTDMKALVFLVIAN  551
            +R  + EL+ RC    + ++  +L+  D Q  V+E+   S+  + +++    LV+LV AN
Sbjct  8    RRRNVGELVLRCAATLVCMLSLMLLVRDQQIAVQEVGVTSVTTQLRYSSSTGLVYLVYAN  67

Query  550  GLAAAYSLVQLVRCSVSMIRGSVLF-NKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
            GL A Y  V ++  S +   GSV+  NK  AWA+F  DQ++A + L A +AA++ A   +
Sbjct  68   GLVALYCFVVVLTSSFN--GGSVMRRNKSGAWALFVLDQVLACILLSAASAASEIAFLVE  125

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
             G  +  W   C +YG FC  +   IA+S I  I +  +C +SA  LF+ Y
Sbjct  126  KGAKKTIWDSKCIVYGHFCRMLEVSIATSFIAVIMLGSICVLSAKQLFQQY  176



>ref|XP_010062716.1| PREDICTED: CASP-like protein 2A1 [Eucalyptus grandis]
Length=200

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 89/185 (48%), Gaps = 10/185 (5%)
 Frame = -1

Query  745  HGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  566
            HG      ++RVR AE++ R V  GL +   V++  +S+  +  S+     ++D+ A  +
Sbjct  17   HGGENGGENERVRTAEMLMRVVPMGLCVAALVMMLRNSESNDYGSL----SYSDLGAFRY  72

Query  565  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  386
            LV ANG+ A YSL+  +   V+M R   +     AW  F  DQ++ Y  L A A + +  
Sbjct  73   LVHANGICAGYSLLSAI--IVAMPRPPTISR---AWTFFLLDQVLTYTILAAGAVSTEVL  127

Query  385  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
              A  G   + W   C  +G FC++    +A +L      ++L  +S++ LF  + D   
Sbjct  128  YLAYKGDVAITWSSACGSFGGFCHKATASVAITLAAAACYMVLSLVSSYRLFSRF-DAPV  186

Query  205  KCNGR  191
             C  +
Sbjct  187  ACTSK  191



>ref|XP_002447595.1| hypothetical protein SORBIDRAFT_06g005640 [Sorghum bicolor]
 sp|C5YDQ9.1|CSPLG_SORBI RecName: Full=CASP-like protein 2A1; Short=SbCASPL2A1 [Sorghum 
bicolor]
 gb|EES11923.1| hypothetical protein SORBIDRAFT_06g005640 [Sorghum bicolor]
Length=208

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 9/174 (5%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            RVR  E + R    GL +    ++  D Q  E  ++     ++D+    +LV ANGL AA
Sbjct  33   RVRPVETLLRAAPLGLCVAAMTVMLRDQQSNEYGTV----AYSDLGGFKYLVYANGLCAA  88

Query  535  YSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  356
            YSLV     +V   R + +     +W +F  DQ+  YL L A AAAA+    A  G  E+
Sbjct  89   YSLVSAFYTAVP--RPATVSR---SWVVFLLDQVFTYLILAAGAAAAELLYLAYNGDKEV  143

Query  355  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  194
             W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y    S   G
Sbjct  144  TWSEACGVFGSFCRQARTSVAITFGTVLCFILLSLISSYRLFSAYEAPPSSALG  197



>ref|NP_564017.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8VZQ3.2|CSPL3_ARATH RecName: Full=CASP-like protein 2A1; Short=AtCASPL2A1 [Arabidopsis 
thaliana]
 gb|AAD50013.1|AC007651_8 Unknown protein [Arabidopsis thaliana]
 gb|AAM63874.1| unknown [Arabidopsis thaliana]
 gb|AAN12953.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29557.1| uncharacterized protein AT1G17200 [Arabidopsis thaliana]
Length=204

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 79/161 (49%), Gaps = 8/161 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            W   C+ YG FC++    +  +  V    I+L  IS++ LF
Sbjct  142  WSDACSSYGGFCHRATASVIITFFVVCFYIVLSLISSYKLF  182



>ref|XP_004503085.1| PREDICTED: CASP-like protein 10-like [Cicer arietinum]
Length=216

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 85/160 (53%), Gaps = 10/160 (6%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  521
            E + R +  GL +   +++  +SQ  +  S+     +TD+ A  +LV ANG+ A YSL+ 
Sbjct  43   ETLLRLLSVGLCVSALLIMVKNSQQNDYTSL----SYTDLGAFRYLVHANGICAGYSLLS  98

Query  520  LVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRI  341
             V   V++ R ++    P AW  F  DQ++ Y+ L A A++A+    A+ G     WM  
Sbjct  99   AVI--VAVPRSTL----PPAWTFFFLDQVLTYIMLSAGASSAEVVYLAENGDDATLWMSA  152

Query  340  CNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            C  +G+FC++V   I  + +  I  ++L  IS++ LF  Y
Sbjct  153  CEPFGRFCHKVTASITITFVALICYVLLSLISSYKLFTKY  192



>ref|XP_010327104.1| PREDICTED: CASP-like protein 2A1 [Solanum lycopersicum]
Length=189

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 85/163 (52%), Gaps = 12/163 (7%)
 Frame = -1

Query  709  RLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  530
             + E+I R +  GL +V  V++  +SQ  +  S+     ++D+    +LV ANG+ AAYS
Sbjct  18   NIGEIILRLLPMGLCVVALVIMLKNSQTNDYGSL----SYSDLGTFRYLVHANGICAAYS  73

Query  529  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  350
            L+  +  ++   R + L   P AW IF  DQ++ Y+ L A AA+ +    A  G + + W
Sbjct  74   LISAIVAALP--RPTTL---PRAWTIFLLDQILTYIILAAGAASTEVIYLAYKGDTNVTW  128

Query  349  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
               C  +G FC +    ++ + IV +  +   GIS  S +RL+
Sbjct  129  SETCGSFGGFCKKATASVSITFIVSLCYV---GISLLSSYRLF  168



>sp|D2KQI6.1|CSPL1_BETVM RecName: Full=CASP-like protein Ni6; AltName: Full=CASP-like 
protein 1D1; Short=BvCASPL1D1 [Beta vulgaris subsp. maritima]
 gb|ADA71986.1| Ni6 protein [Beta vulgaris subsp. maritima]
Length=194

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 82/169 (49%), Gaps = 6/169 (4%)
 Frame = -1

Query  721  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSI----RKKAKFTDMKALVFLVIA  554
            D + R+ ++I R ++   +I   VL+ T  Q   I S        AKF +  A ++LV A
Sbjct  23   DNKYRVVDVILRVLLLAASIASVVLMVTSKQTEIIVSPFGSRPNAAKFQNSPAFIYLVAA  82

Query  553  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  374
              +A  YS++  +  S+S +R  ++  K L W +   D L+  +   A   A        
Sbjct  83   LSVAGLYSIITAL-VSLSYMRKPIVPPK-LFWILLIHDVLLLGIVAAATGTAGGVGYIGL  140

Query  373  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFR  227
             G + ++W +I N+Y KFC  VG  I  SL     +++L  ++A SL+R
Sbjct  141  KGNTHVRWGKIRNVYDKFCRHVGASIIVSLFAAAVLVLLVFVNANSLYR  189



>gb|KCW69848.1| hypothetical protein EUGRSUZ_F03189 [Eucalyptus grandis]
Length=217

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 89/185 (48%), Gaps = 10/185 (5%)
 Frame = -1

Query  745  HGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVF  566
            HG      ++RVR AE++ R V  GL +   V++  +S+  +  S+     ++D+ A  +
Sbjct  34   HGGENGGENERVRTAEMLMRVVPMGLCVAALVMMLRNSESNDYGSL----SYSDLGAFRY  89

Query  565  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  386
            LV ANG+ A YSL+  +   V+M R   +     AW  F  DQ++ Y  L A A + +  
Sbjct  90   LVHANGICAGYSLLSAI--IVAMPRPPTISR---AWTFFLLDQVLTYTILAAGAVSTEVL  144

Query  385  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  206
              A  G   + W   C  +G FC++    +A +L      ++L  +S++ LF  + D   
Sbjct  145  YLAYKGDVAITWSSACGSFGGFCHKATASVAITLAAAACYMVLSLVSSYRLFSRF-DAPV  203

Query  205  KCNGR  191
             C  +
Sbjct  204  ACTSK  208



>gb|AAL36294.1| unknown protein [Arabidopsis thaliana]
Length=204

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 79/161 (49%), Gaps = 8/161 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            W   C+ YG FC++    +  +  V    I+L  IS++ LF
Sbjct  142  WSDACSSYGGFCHRATASVIITFFVVCFYIVLSLISSYKLF  182



>ref|XP_002890211.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7KFC7.1|CSPLB_ARALL RecName: Full=CASP-like protein 2A1; Short=AlCASPL2A1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66470.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 79/161 (49%), Gaps = 8/161 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            W   C+ YG FC++    +  +  V    I+L  IS++ LF
Sbjct  142  WSDACSSYGGFCHRATASVIITFFVVCFYILLSLISSYKLF  182



>ref|XP_003600618.1| hypothetical protein MTR_3g064310 [Medicago truncatula]
Length=216

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 87/171 (51%), Gaps = 11/171 (6%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE   R +  GL +   VL+  +S+  +  S+     + D+ A  +LV ANG+ A Y
Sbjct  41   LRTAETFLRLLPIGLCVAALVLMLKNSEENDYGSV----SYNDLGAFRYLVHANGICAGY  96

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL+  V   V+  R ++L     AW  F  DQ++ Y+ L A A++ +    A+ G S   
Sbjct  97   SLLSAVV--VAAPRPTLL----RAWTFFFLDQVLTYIILSAGASSMEVVYLAENGDSATV  150

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKC  200
            W   C  +G+FC++V   +A + +     +IL  IS+F LF  Y D  + C
Sbjct  151  WNSACGSFGQFCHKVTASVAITFVALFCYVILSLISSFKLFSNY-DVPASC  200



>gb|AES70869.2| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=217

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 87/171 (51%), Gaps = 11/171 (6%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE   R +  GL +   VL+  +S+  +  S+     + D+ A  +LV ANG+ A Y
Sbjct  42   LRTAETFLRLLPIGLCVAALVLMLKNSEENDYGSV----SYNDLGAFRYLVHANGICAGY  97

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL+  V   V+  R ++L     AW  F  DQ++ Y+ L A A++ +    A+ G S   
Sbjct  98   SLLSAVV--VAAPRPTLL----RAWTFFFLDQVLTYIILSAGASSMEVVYLAENGDSATV  151

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKC  200
            W   C  +G+FC++V   +A + +     +IL  IS+F LF  Y D  + C
Sbjct  152  WNSACGSFGQFCHKVTASVAITFVALFCYVILSLISSFKLFSNY-DVPASC  201



>sp|P0DI21.1|CSPL2_OSMLA RecName: Full=CASP-like protein 2U1; Short=OlCASPL2U1 [Osmunda 
lancea]
Length=177

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 89/169 (53%), Gaps = 5/169 (3%)
 Frame = -1

Query  697  LIFRCVICGLAIVGAVLIGTDSQVREIF----SIRKKAKFTDMKALVFLVIANGLAAAYS  530
            ++ R V   L+I   VL+  D QV  +      +  +AK + ++A V+LV +NGL A Y 
Sbjct  1    MVLRIVASLLSIAALVLMAKDKQVVYLNLAGEELTLEAKHSYVEAFVYLVYSNGLVAIYC  60

Query  529  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  350
             + LV   V  +       K  AW IF  DQ +AY+ L A AA+ + A  AK G +++ W
Sbjct  61   FL-LVFALVFRLIDKAGCGKSAAWIIFLLDQGLAYVLLAAAAASTEVAYVAKRGNNKVGW  119

Query  349  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
              +C+ +G FCN VG  I  + I  ++M  L  +SA  LF+ YG  + +
Sbjct  120  SEVCSTFGHFCNLVGVSIVITFISVLAMATLSVMSARRLFKTYGPERKQ  168



>ref|XP_011098144.1| PREDICTED: CASP-like protein 2A1 [Sesamum indicum]
Length=194

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 84/172 (49%), Gaps = 9/172 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE + R +   L +   V++  DSQ  +  S+     ++D+ A  +LV A+G+ A Y
Sbjct  22   MRTAETLLRVLPMALCVAALVIMLKDSQTNDYGSL----SYSDLGAFRYLVHASGVCAGY  77

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL+  V  +V   R S +     AWA F  DQL+ Y+ L A A +A+    A  G + + 
Sbjct  78   SLLSAVVAAVP--RPSTMSR---AWAFFLLDQLLTYIILAAGAISAEVVYLAYKGDTSIT  132

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCN  197
            W R C  +G FC +    IA + +  +    L  IS++ LF  Y    +  N
Sbjct  133  WSRTCGSFGGFCRKATASIAITFVATLCYAALSLISSYRLFSKYDAPAAYSN  184



>gb|KHN14990.1| CASP-like protein 10 [Glycine soja]
Length=205

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 82/172 (48%), Gaps = 9/172 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE   R    GL +   VL+   SQ  E  S+     ++D+ A  +LV ANG+ A Y
Sbjct  33   LRTAETFLRLFPVGLCVSALVLMLKSSQQNEYGSV----DYSDLGAFRYLVHANGICAGY  88

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL   V    +M   S +   P AW  F  DQ++ Y+ L A A + +    A+ G +   
Sbjct  89   SLFSAVI--AAMPCPSTI---PRAWTFFLLDQVLTYIILAAGAVSTEVLYLAENGDAATT  143

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCN  197
            W   C  +G+FC++V   +A + +     ++L  +S++ LF  Y    S+  
Sbjct  144  WSSACGSFGRFCHKVTASVAITFVAVFCYVLLSLVSSYKLFTKYDAPASRAT  195



>ref|NP_001239767.1| CASP-like protein 2A2 [Glycine max]
 sp|C6TCJ2.1|CSPLA_SOYBN RecName: Full=CASP-like protein 2A2; Short=GmCASPL2A2 [Glycine 
max]
 gb|ACU19544.1| unknown [Glycine max]
Length=206

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 82/170 (48%), Gaps = 9/170 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE   R    GL +   VL+   SQ  E  S+     ++D+ A  +LV ANG+ A Y
Sbjct  34   LRTAETFLRLFPVGLCVSALVLMLKSSQQNEYGSV----DYSDLGAFRYLVHANGICAGY  89

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL   V    +M   S +   P AW  F  DQ++ Y+ L A A + +    A+ G +   
Sbjct  90   SLFSAVI--AAMPCPSTI---PRAWTFFLLDQVLTYIILAAGAVSTEVLYLAENGDAATT  144

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  203
            W   C  +G+FC++V   +A + +     ++L  +S++ LF  Y    S+
Sbjct  145  WSSACGSFGRFCHKVTASVAITFVAVFCYVLLSLVSSYKLFTKYDAPASR  194



>gb|EEC81102.1| hypothetical protein OsI_23961 [Oryza sativa Indica Group]
Length=189

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 77/142 (54%), Gaps = 3/142 (2%)
 Frame = -1

Query  637  DSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRC---SVSMIRGSVLFNKP  467
            ++Q   +  IRKKA   D++AL  L +A   AA Y L+QL+RC   S           + 
Sbjct  35   NTQTETVLFIRKKATVKDVQALWVLAMAAAAAAGYHLLQLLRCFYLSRFADGKPCRHRRA  94

Query  466  LAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASS  287
            +AW  F  D+  AY++     AAAQ+ V A  G   LQW ++CN+Y +FC QV   +  +
Sbjct  95   IAWLCFLLDKGCAYITFATTVAAAQACVVALYGTHALQWTKLCNIYTRFCEQVAGSLVCA  154

Query  286  LIVCISMIILCGISAFSLFRLY  221
            ++  +   +L  +SA +LFRLY
Sbjct  155  MLAAVGTALLSVVSARNLFRLY  176



>ref|XP_006304211.1| hypothetical protein CARUB_v10010315mg [Capsella rubella]
 gb|EOA37109.1| hypothetical protein CARUB_v10010315mg [Capsella rubella]
Length=204

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 78/160 (49%), Gaps = 8/160 (5%)
 Frame = -1

Query  709  RLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  530
            R AE + R    GL +   V++  DSQ  E  SI     ++++ A  +LV ANG+ A YS
Sbjct  31   RTAETMLRLAPVGLCVAALVVMLKDSQDNEFGSI----SYSNLTAFRYLVHANGICAGYS  86

Query  529  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  350
            L  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + W
Sbjct  87   L--LSAAMAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAITW  142

Query  349  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
               C+ YG FC++    +  +  V    ++L  IS++ LF
Sbjct  143  SDACSSYGSFCHKATASVIITFFVVCFYVVLSLISSYKLF  182



>ref|NP_001058251.1| Os06g0656300 [Oryza sativa Japonica Group]
 sp|Q67W83.1|CSPLD_ORYSJ RecName: Full=CASP-like protein 2C1; Short=OsCASPL2C1 [Oryza 
sativa Japonica Group]
 dbj|BAD37569.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD37586.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF20165.1| Os06g0656300 [Oryza sativa Japonica Group]
 dbj|BAG87329.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=194

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 77/142 (54%), Gaps = 3/142 (2%)
 Frame = -1

Query  637  DSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRC---SVSMIRGSVLFNKP  467
            ++Q   +  IRKKA   D++AL  L +A   AA Y L+QL+RC   S           + 
Sbjct  40   NTQTETVLFIRKKATVKDVQALWVLAMAAAAAAGYHLLQLLRCFYLSRFADGKPCRHRRA  99

Query  466  LAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASS  287
            +AW  F  D+  AY++     AAAQ+ V A  G   LQW ++CN+Y +FC QV   +  +
Sbjct  100  IAWLCFLLDKGCAYITFATTVAAAQACVVALYGTHALQWTKLCNIYTRFCEQVAGSLVCA  159

Query  286  LIVCISMIILCGISAFSLFRLY  221
            ++  +   +L  +SA +LFRLY
Sbjct  160  MLAAVGTALLSVVSARNLFRLY  181



>sp|P0DH61.1|CSPL6_SELML RecName: Full=CASP-like protein 2U10; Short=SmCASPL2U10 [Selaginella 
moellendorffii]
Length=221

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 87/180 (48%), Gaps = 13/180 (7%)
 Frame = -1

Query  721  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQV-----------REIFSIRKKAKFTDMKA  575
            +   R++ ++ R  +  L I+   L+ TD +            R +F + K AK+  +  
Sbjct  27   EHEFRISIILLRSFLLVLVIISEALMVTDRETGSVPLPFFGLPRPVF-VTKTAKYELVTG  85

Query  574  LVFLVIANGLAAAYSLVQLV-RCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            L F V A G+   Y+++ L+    +   +G+V+  K +AW  F  D +M YL L + A A
Sbjct  86   LKFYVDALGVVIGYTVLHLLFNIGLVATKGTVVDCKSVAWISFIADSMMGYLLLSSAAVA  145

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             +    A+ G   + W ++CN +G FC      +    I  +   ++ GISA+ LFRLYG
Sbjct  146  TEIGYLAEEGAPAVLWRKVCNAFGYFCTVYAISVVICFIAALVSFVVVGISAYHLFRLYG  205



>emb|CDX96785.1| BnaA08g23280D [Brassica napus]
Length=204

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 81/164 (49%), Gaps = 8/164 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE + R    GL I   V++  DSQ  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCIAALVIMLQDSQDNEFGSI----SYSNLSAFRYLVHANGICAGY  85

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL+     ++S + GS     P  W  F  DQ++ Y+ L A A + +    A  G   + 
Sbjct  86   SLLS---AAISAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGDDAIT  141

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            W   C+ +G FC++    +  + +V    ++L  IS++ LF  +
Sbjct  142  WSDACSSFGSFCHRATASVIITFVVVCFYVVLSLISSYKLFTRF  185



>emb|CDX81811.1| BnaC08g37900D [Brassica napus]
Length=204

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 81/165 (49%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V    R AE + R    GL +   V+   DSQ  E  S+     ++++ A  +LV ANG+
Sbjct  26   VSTAFRTAETMLRLAPVGLCLAALVITLKDSQNNEFGSV----SYSNLSAFGYLVHANGI  81

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+     +++ +RGS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMRGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            + + W   C+ +G FC++    +  + +V    +IL  IS++ LF
Sbjct  138  NAITWSDACSSFGSFCHRATASVIITFVVVCLYVILSLISSYKLF  182



>gb|KFK43914.1| hypothetical protein AALP_AA1G190800 [Arabis alpina]
Length=205

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 77/165 (47%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DS+  E  SI     + ++ A  +LV ANG+
Sbjct  27   VSPGIRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYNNLTAFRYLVHANGI  82

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL  L     +M R S     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  83   CAGYSL--LSAAIAAMPRSSSTM--PRVWTFFCFDQILTYVVLAAGAVSTEVLYLAYKGD  138

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
              + W   C+ YG FC++    +  +  V    ++L  IS++ LF
Sbjct  139  DAITWSDACSSYGSFCHRATASVIITFFVVCFYVVLSIISSYKLF  183



>emb|CDY48478.1| BnaC05g13380D [Brassica napus]
Length=204

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 81/165 (49%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DSQ  E      +  ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRVAPVGLCVAALVIMLKDSQTNE----YGEVSYSNLTAFRYLVHANGI  81

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+     +++ + GS     P  W IF  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTIFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
              + W   C+ +G FC++    +  + +V    ++L  IS++ LF
Sbjct  138  DAITWSDACSSFGSFCHKATASVIITFVVVCFYVVLSLISSYKLF  182



>ref|XP_011030770.1| PREDICTED: CASP-like protein 2A1 [Populus euphratica]
 ref|XP_011015697.1| PREDICTED: CASP-like protein 2A1 [Populus euphratica]
Length=201

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 81/168 (48%), Gaps = 9/168 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V+   R AE + R V   L +   V++  ++Q  +  S+     ++D+ A  +LV  NG+
Sbjct  24   VENTTRTAETMLRLVPMALCVSALVVMLKNTQTNDYGSL----SYSDLGAFRYLVHVNGI  79

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+  V   V+M R S +   P AW  F  DQ++ Y  L A   + +    A  G 
Sbjct  80   CAGYSLLSAVI--VAMPRASTM---PRAWTFFLLDQVLTYAILAAGTVSTEVLYLASKGD  134

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            + + W   C  +G FC++    IA + +V I    L  +S++ LF  Y
Sbjct  135  TAITWSEACVSFGGFCHKALISIAITFVVVICYAALSLLSSYKLFSKY  182



>sp|D8ST12.2|CSPL3_SELML RecName: Full=CASP-like protein 2U11; Short=SmCASPL2U11 [Selaginella 
moellendorffii]
Length=221

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 86/180 (48%), Gaps = 13/180 (7%)
 Frame = -1

Query  721  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQV-----------REIFSIRKKAKFTDMKA  575
            +   R++ ++ R  +  L I+   L+ TD +            R +F + K AK+  +  
Sbjct  27   EHEFRISIILLRSFLLVLVIISEALMVTDRETGSVPLPFFGLPRPVF-VTKTAKYELVTG  85

Query  574  LVFLVIANGLAAAYSLVQLV-RCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  398
            L F V A G+   Y+++ L+    +   +G+V+  K +AW  F  D +M YL L   A A
Sbjct  86   LKFYVDALGVVIGYTVLHLLFNIGLVATKGTVVDCKSVAWISFIADSMMGYLLLSGAAVA  145

Query  397  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  218
             +    A+ G   + W ++CN +G FC      +    I  +   ++ GISA+ LFRLYG
Sbjct  146  TEIGYLAEEGAPAVLWRKVCNAFGYFCTVYAISVVICFIAALVSFVVVGISAYHLFRLYG  205



>ref|XP_006360011.1| PREDICTED: CASP-like protein VIT_01s0010g01870-like isoform X1 
[Solanum tuberosum]
Length=189

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 88/173 (51%), Gaps = 13/173 (8%)
 Frame = -1

Query  709  RLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  530
             + E++ R     L +V  V++  DSQ  +  S+     ++D+    +LV ANG+ AAYS
Sbjct  18   NIGEIMLRLFPMALCVVALVIMLKDSQTNDYGSL----SYSDLGIFRYLVHANGICAAYS  73

Query  529  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  350
            L+  +  ++   R + L   P AW IF  DQ++ Y+ L A AA+ +    A  G +++ W
Sbjct  74   LLSAIVAALP--RPTTL---PRAWTIFLLDQILTYIILAAGAASTEVIYLAYKGDTDVTW  128

Query  349  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY----GDNKSK  203
               C  +G FC +    ++ + IV +  + +  +S++ LF  Y    G N +K
Sbjct  129  SETCGSFGVFCKKATASVSITFIVSLCYVGISLLSSYRLFSKYDAPIGQNNNK  181



>gb|EPS73896.1| hypothetical protein M569_00863, partial [Genlisea aurea]
Length=163

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 73/145 (50%), Gaps = 9/145 (6%)
 Frame = -1

Query  637  DSQVREIFSI-RKKAKFTDMKALVFLVIANGLAAAYSLVQLVR-CSVSMIRGSVLFNKPL  464
            D Q + +  I  + A +  + AL  +V  +   AAY L+QLVR C +         N   
Sbjct  19   DRQTKTLLHIFTRTADYKSLDALYDVVWIDTAGAAYCLLQLVRICKLPS-------NLNA  71

Query  463  AWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSL  284
            AW I+  D + AY+      AA Q+++ A  G+S  QWM+ C+ Y +FC ++G  +   +
Sbjct  72   AWGIYFFDLIAAYVIFAGNVAALQASILALTGESSFQWMKQCDTYKRFCVEIGVALFFGI  131

Query  283  IVCISMIILCGISAFSLFRLYGDNK  209
               ISM +   IS + LFRLY   K
Sbjct  132  SAGISMAVTSSISGYHLFRLYSPTK  156



>ref|XP_002317605.1| integral membrane family protein [Populus trichocarpa]
 sp|B9I0G0.1|CSPLA_POPTR RecName: Full=CASP-like protein 2A1; Short=PtCASPL2A1 [Populus 
trichocarpa]
 gb|EEE98217.1| integral membrane family protein [Populus trichocarpa]
Length=201

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 82/168 (49%), Gaps = 9/168 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V+   R AE + R V   L +   V++  ++Q  +  S+     ++D+ A  +LV  NG+
Sbjct  24   VENTTRTAETMLRLVPMALCVSALVVMLKNTQTNDYGSL----SYSDLGAFRYLVHVNGI  79

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+  V   V+M R S +   P AWA F  DQ++ Y+ L A   + +    A  G 
Sbjct  80   CAGYSLLSAVI--VAMPRASTM---PRAWAFFLLDQVLTYVILAAGTVSTEVLYLASKGD  134

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            + + W   C  +G FC++    I  + +V I    L  +S++ LF  Y
Sbjct  135  TTITWSEACVSFGGFCHKALISIVITFVVVICYAALSLLSSYKLFSKY  182



>ref|XP_007022201.1| CASP-like protein isoform 1 [Theobroma cacao]
 ref|XP_007022203.1| CASP-like protein isoform 1 [Theobroma cacao]
 gb|EOY13726.1| CASP-like protein isoform 1 [Theobroma cacao]
 gb|EOY13728.1| CASP-like protein isoform 1 [Theobroma cacao]
Length=198

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 80/164 (49%), Gaps = 9/164 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R  E + R V   L I   V++  +SQ  E  S+     ++D+ A  +LV ANG+ A Y
Sbjct  39   MRTTETMLRLVPMALCIAALVVMLKNSQSNEFGSV----SYSDLGAFRYLVHANGICAGY  94

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL+  +    +M R S +   P AW +F  DQ++ Y+ L A A + +       G + + 
Sbjct  95   SLLSAII--AAMPRPSTM---PRAWTLFLLDQILTYIILAAGAVSTEVLYLTNKGDAAVT  149

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            W   C  +  FC++    +  + +V    ++L  IS++ LF  Y
Sbjct  150  WSAACGTFASFCHKATTSVIITFVVVACYVVLSLISSYRLFSKY  193



>ref|XP_002517919.1| conserved hypothetical protein [Ricinus communis]
 sp|B9RW00.1|CSPL6_RICCO RecName: Full=CASP-like protein 1C1; Short=RcCASPL1C1 [Ricinus 
communis]
 gb|EEF44437.1| conserved hypothetical protein [Ricinus communis]
Length=163

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 73/154 (47%), Gaps = 10/154 (6%)
 Frame = -1

Query  718  KRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAA  539
            K  R+  L+ R +  G A+V A+++ T  +    F++  +AK++D  A  + VI N +  
Sbjct  3    KAKRVFTLLLRLIAFGTALVAAIVMATSHESGSFFTVSYEAKYSDTPAFKYFVIVNAIVT  62

Query  538  AYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSE  359
             YS + L   S S++   V+            D +   L   +++AA   A   K G S 
Sbjct  63   VYSFLALFLPSESLLWRLVIVT----------DVVFTMLVTSSISAAVAVAQVGKKGNSH  112

Query  358  LQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  257
              W+ IC    KFC+QV   +A++ I  I+  IL
Sbjct  113  AGWLPICGQVPKFCDQVTGALAAAFISLITYAIL  146



>ref|XP_004975109.1| PREDICTED: CASP-like protein 6-like [Setaria italica]
Length=209

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 82/175 (47%), Gaps = 9/175 (5%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            RVR  E + R    GL +    ++  D Q  E  ++     ++D+    +LV ANGL AA
Sbjct  34   RVRPVETLLRAAPLGLCVAAMAIMLKDQQTNEYGTV----AYSDLGGFKYLVYANGLCAA  89

Query  535  YSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  356
            YSLV     +V   R + +     +W +F  DQ+  YL L A AAAA+    A  G  E+
Sbjct  90   YSLVTAFYTAVP--RPATVSR---SWVVFLLDQVFTYLILAAGAAAAELLYLAYNGDKEV  144

Query  355  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNGR  191
             W   C ++G FC +    +A +    +  I+L  IS++ LF  Y    S   G 
Sbjct  145  TWSEACGVFGVFCRKARTSVAITFGSVLCFILLSLISSYRLFSAYEAPPSSALGN  199



>ref|XP_006442224.1| hypothetical protein CICLE_v10022266mg [Citrus clementina]
 ref|XP_006477978.1| PREDICTED: CASP-like protein RCOM_0477780-like [Citrus sinensis]
 gb|ESR55464.1| hypothetical protein CICLE_v10022266mg [Citrus clementina]
 gb|KDO50478.1| hypothetical protein CISIN_1g028477mg [Citrus sinensis]
Length=208

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 86/177 (49%), Gaps = 10/177 (6%)
 Frame = -1

Query  721  DKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  542
            +  +R AE I R V   L +   VL+  +S+  +  S+     ++D+ A  +LV ANG+ 
Sbjct  33   NAALRTAEPIARLVPMALCVAALVLMLKNSETSDFGSL----SYSDLGAFRYLVHANGIC  88

Query  541  AAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQS  362
            A YSL+  +    +M R S +     AW  F  DQL+ YL L A A + +     + G  
Sbjct  89   AGYSLLSAII--AAMPRPSTMSQ---AWTFFFLDQLLTYLILAAGAVSTEVLYLERKGDL  143

Query  361  ELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNGR  191
             + W  +C  +G FC++    +  + +     ++L  IS++ LF  Y D    C+G+
Sbjct  144  AITWSAVCGSFGGFCHKAIASVIITFVAVACYVVLSLISSYKLFSKY-DAPIACSGK  199



>ref|XP_009117714.1| PREDICTED: CASP-like protein At1g17200 [Brassica rapa]
Length=201

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 82/165 (50%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DSQ  E  S+     ++++ A  +LV ANG+
Sbjct  23   VSTAIRTAETMLRLAPVGLCLAALVIMLKDSQNNEFGSV----SYSNLSAFWYLVHANGI  78

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  79   CAGYSLLS---AAIAAMPGSSS-TTPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  134

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            + + W   C+ +G FC++    +  + +V    ++L  IS++ LF
Sbjct  135  NAITWSDACSSFGSFCHRATASVIITFVVVCLYVLLSLISSYKLF  179



>sp|P0DH67.1|CSPL9_SELML RecName: Full=CASP-like protein 2U1; Short=SmCASPL2U1 [Selaginella 
moellendorffii]
Length=204

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 92/175 (53%), Gaps = 9/175 (5%)
 Frame = -1

Query  745  HGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS-IRKKAKFTDMKALV  569
            H   LK VD  VR+    F    C LA++  VL+  + Q   I   I  +AK+ + KA V
Sbjct  31   HRKLLKGVDFLVRIKAFAF----C-LAVI--VLLKNNVQTTVIAPGIVLQAKYNNTKAPV  83

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGS-VLFNKPLAWAIFSGDQLMaylslgavaaaaq  392
             L++   +   Y+ +Q V   +S IR   VL N  LAW  F  DQ++ YL LG+ AA A+
Sbjct  84   SLLVLASICCGYAFLQAVVSLLSFIRDKRVLNNTVLAWLTFLLDQVLTYLLLGSAAATAE  143

Query  391  savyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFR  227
            +A  AK G+ ++QW  +C  + +FC+     +  S I  I+  +   ISA+ LFR
Sbjct  144  AAYIAKRGEDKVQWKAVCGPFKRFCDHFAATVFLSFIAVIAFAVSAAISAYYLFR  198



>sp|P0DH65.1|CSPL8_SELML RecName: Full=CASP-like protein 2U2; Short=SmCASPL2U2 [Selaginella 
moellendorffii]
Length=204

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 92/175 (53%), Gaps = 9/175 (5%)
 Frame = -1

Query  745  HGSXLKVVDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFS-IRKKAKFTDMKALV  569
            H   LK VD  VR+    F    C LA++  VL+  + Q   I   I  +AK+ + KA V
Sbjct  31   HRKLLKGVDFLVRIKAFAF----C-LAVI--VLLKNNVQTTVIAPGIVLQAKYNNTKAPV  83

Query  568  FLVIANGLAAAYSLVQLVRCSVSMIRGS-VLFNKPLAWAIFSGDQLMaylslgavaaaaq  392
             L++   +   Y+ +Q V   +S IR   VL N  LAW  F  DQ++ YL LG+ AA A+
Sbjct  84   SLLVLASICCGYAFLQAVVSLLSFIRDKRVLNNTVLAWLTFLLDQVLTYLLLGSAAATAE  143

Query  391  savyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFR  227
            +A  AK G+ ++QW  +C  + +FC+     +  S I  I+  +   ISA+ LFR
Sbjct  144  AAYIAKRGEDKVQWKAVCGPFKRFCDHFAATVFLSFIAVIAFAVSAAISAYYLFR  198



>dbj|BAJ89574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=198

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 76/144 (53%), Gaps = 2/144 (1%)
 Frame = -1

Query  646  IGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV--SMIRGSVLFN  473
            +G D++   +  IRKKA   D+ AL  L  A G AA Y L+ L+RC             +
Sbjct  40   MGLDTETETVLLIRKKATVKDVHALWVLTAAAGAAAGYHLLHLLRCVYLGRFAHNPCRNS  99

Query  472  KPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIA  293
            + LAWA    D+  AYL+  A  AAAQ+ + A  G   LQW ++CN++ +FC QV   + 
Sbjct  100  RALAWAFLLLDKGCAYLTFAATVAAAQACLIALDGAQALQWNKLCNIFTRFCQQVAGSLV  159

Query  292  SSLIVCISMIILCGISAFSLFRLY  221
               +  +   +L  +SA +LFRLY
Sbjct  160  CGGLAAVGTAVLSALSARNLFRLY  183



>ref|XP_008451819.1| PREDICTED: CASP-like protein F16 [Cucumis melo]
Length=199

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 84/174 (48%), Gaps = 9/174 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R A+ + R V  GL I   +++  +S+  +  S+     ++D+ A  FLV ANG+ A Y
Sbjct  25   MRAADTLLRLVPMGLCIAALIVMLKNSEANDYGSV----AYSDLGAFKFLVHANGICAGY  80

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            S +     +V+ +      +K  AW +F  DQL+ YL+L A   + +    A  G +E+ 
Sbjct  81   SFLS---AAVAAMSPPSTISK--AWTLFFLDQLLTYLTLAAGTVSTEVLYLAYNGDTEIT  135

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNGR  191
            W   C  +GKFC++    +  + IV      +  +S++ LF  Y       N +
Sbjct  136  WSAACGTFGKFCSKATASVVITFIVVAFYAFISILSSYKLFSRYNAPLPHPNSK  189



>ref|XP_006465093.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X2 
[Citrus sinensis]
 ref|XP_006474165.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X2 
[Citrus sinensis]
 ref|XP_006483175.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X2 
[Citrus sinensis]
Length=125

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 10/118 (8%)
 Frame = -1

Query  544  AAAYSLVQLVRCSVSMIR------GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  383
            AA Y+L+QL R SV + R      GS    + LAW  +  DQ++ Y++ G  +AA + +V
Sbjct  5    AAGYNLLQLGR-SVFVSRYLGNSKGSY---RYLAWVSYLLDQMVVYIAFGTNSAAVEHSV  60

Query  382  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  209
             A  G  E QWM+ CN + +FC Q+G  + S    C  M++   ISAF+LFRLY   K
Sbjct  61   LALSGMKEFQWMKWCNKFTRFCFQIGGALVSGYAACALMVLATSISAFNLFRLYSSEK  118



>ref|NP_001131228.1| CASP-like protein 2A1 [Zea mays]
 sp|B4FBQ7.1|CSPL6_MAIZE RecName: Full=CASP-like protein 2A1; Short=ZmCASPL2A1; AltName: 
Full=Salicylic acid-induced protein 1-A [Zea mays]
 gb|ACF79550.1| unknown [Zea mays]
 gb|ACG42502.1| salicylic acid-induced fragment 1 protein [Zea mays]
 gb|ACG42633.1| salicylic acid-induced fragment 1 protein [Zea mays]
 gb|ACG48255.1| salicylic acid-induced fragment 1 protein [Zea mays]
Length=213

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 82/174 (47%), Gaps = 9/174 (5%)
 Frame = -1

Query  715  RVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  536
            RVR  E + R    GL +    ++  + Q  E  ++     ++D+    +LV ANGL AA
Sbjct  38   RVRPVETLLRAAPLGLCVAAMTVMLRNQQSNEYGAV----AYSDLGGFKYLVYANGLCAA  93

Query  535  YSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  356
            YSLV     +V   R + +     +W +F  DQ+  YL L A AAAA+    A  G  E+
Sbjct  94   YSLVSAFYTAVP--RPATVSR---SWLVFLLDQVFTYLILAAGAAAAELLYLAYNGDKEV  148

Query  355  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  194
             W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y    S   G
Sbjct  149  TWSEACGVFGSFCRQARTSVAITFGTVLCFILLSLISSYRLFSAYEAPPSSALG  202



>ref|XP_010476864.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=204

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 80/165 (48%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+
Sbjct  26   VGPGMRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLAAFRYLVHANGI  81

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G 
Sbjct  82   CAGYSL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGD  137

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            + + W   C+ YG FC++    +  +  V    ++L  IS++ LF
Sbjct  138  AAITWSDACSSYGSFCHKATASVIITFFVVCFYVVLSLISSYKLF  182



>ref|XP_010498065.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=204

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 80/165 (48%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+
Sbjct  26   VGPGMRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLTAFRYLVHANGI  81

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G 
Sbjct  82   CAGYSL--LSAAIAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGD  137

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            + + W   C+ YG FC++    +  +  V    ++L  IS++ LF
Sbjct  138  AAITWSDACSSYGSFCHKATASVIITFFVVCFYVVLSLISSYKLF  182



>ref|XP_010459293.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=248

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 80/165 (48%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+
Sbjct  70   VGPGMRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLTAFRYLVHANGI  125

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G 
Sbjct  126  CAGYSL--LSAAIAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGD  181

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            + + W   C+ YG FC++    +  +  V    ++L  IS++ LF
Sbjct  182  AAITWSDACSSYGSFCHKATASVIITFFVVCFYVVLSLISSYKLF  226



>emb|CDO98909.1| unnamed protein product [Coffea canephora]
Length=196

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 84/165 (51%), Gaps = 16/165 (10%)
 Frame = -1

Query  742  GSXLKVVDKR-VRLAELIFRCVICGLAIVGAVLIGTDSQVREI----------FSIRKKA  596
            G  ++V +K  +R +++I R +     +V A+++G D Q + +           ++   A
Sbjct  16   GKEVEVANKSSLRGSDVILRFLAFASTLVAAIVLGVDKQTKLVSMTVVSTLPPITVPVTA  75

Query  595  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  416
            K+  M A V+ V+AN +A AY+ + L+     ++ G+    K LA  I + D +M  L  
Sbjct  76   KWHYMSAFVYFVVANVVACAYAALSLL-----LVLGNRGAKKGLALMIITLDLVMVALLS  130

Query  415  gavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLI  281
                AA    +    G S +QW ++CN++G+FCNQV   I  SL+
Sbjct  131  SGGGAALAVGLIGYRGNSHVQWNKVCNVFGRFCNQVAGAIVVSLL  175



>ref|XP_009149166.1| PREDICTED: CASP-like protein At1g17200 isoform X1 [Brassica rapa]
Length=204

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 80/165 (48%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DSQ  E   +     ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRLAPVGLCVAALVIMLKDSQTNEYGDV----SYSNLTAFRYLVHANGI  81

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
              + W   C+ +G FC++    +  + +V    ++L  IS++ LF
Sbjct  138  DAITWSDACSSFGSFCHKATASVIITFVVVCFYVVLSLISSYKLF  182



>emb|CDY26265.1| BnaA06g11520D [Brassica napus]
Length=204

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 80/165 (48%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DSQ  E      +  ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRLAPVGLCVAALVIMLKDSQTNEY----GEVSYSNLTAFRYLVHANGI  81

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
              + W   C+ +G FC++    +  + +V    ++L  IS++ LF
Sbjct  138  DAITWSDACSSFGSFCHKATASVIITFVVVCFYVVLSLISSYKLF  182



>emb|CDY21755.1| BnaA09g45060D [Brassica napus]
Length=201

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 82/165 (50%), Gaps = 8/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V   +R AE + R    GL +   V++  DSQ  E  S+     ++++ A  +LV ANG+
Sbjct  23   VSTAIRTAETMLRLAPVGLCLAALVIMLKDSQNNEFGSV----SYSNLSAFWYLVHANGI  78

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  79   CAGYSLLS---AAIAAMPGSSS-TMPRVWTFFCLDQVLTYVVLAAGAVSTEVLYLAYKGD  134

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            + + W   C+ +G FC++    +  + +V    ++L  IS++ LF
Sbjct  135  NAITWSDACSSFGSFCHRATASVIITFVVVCLYVLLSLISSYKLF  179



>gb|KJB12801.1| hypothetical protein B456_002G037500 [Gossypium raimondii]
Length=207

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 82/165 (50%), Gaps = 9/165 (5%)
 Frame = -1

Query  724  VDKRVRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGL  545
            V+  +R AE + R V   L +   V++  +SQ  +  S+     ++D+ A  +LV ANG+
Sbjct  31   VNTSMRTAETMLRLVPMALGVAALVVMLKNSQSNDFGSV----SYSDLGAFRYLVHANGI  86

Query  544  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  365
             A YSL+  +  +V   R S +   P AW  F  DQ++ Y+ LGA A + +    A  G 
Sbjct  87   CAGYSLLSAIIAAVP--RPSTM---PRAWTFFLLDQILTYIILGAAAVSTEVLYLANKGD  141

Query  364  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  230
            S + W   C  +  FC++    +  + +  I   +L  +S++ LF
Sbjct  142  SAITWSAACGTFAGFCHKATIAVVITFVAVICYAVLSLVSSYRLF  186



>ref|XP_006366767.1| PREDICTED: CASP-like protein VIT_01s0010g01870-like [Solanum 
tuberosum]
Length=202

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 83/164 (51%), Gaps = 9/164 (5%)
 Frame = -1

Query  712  VRLAELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  533
            +R AE + R +  GL +V  V++  + Q  +  SI     ++D+    +LV ANG+ A Y
Sbjct  29   MRTAETMLRLLPMGLCVVALVIMLKNQQTNDYGSI----TYSDLGTFRYLVHANGICAGY  84

Query  532  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  353
            SL+  +   V+++   +  ++  AW  F  DQ++ Y  L A A + +    A  G + + 
Sbjct  85   SLLSAI---VAVVPRPITMSR--AWTFFLLDQILTYAILAAGAVSTEVVYLAYKGDTAVT  139

Query  352  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  221
            W   C  +G FC++    ++ + IVC+    L  +S++ LF  Y
Sbjct  140  WSESCGSFGSFCHKATASVSITFIVCLCYAGLSLLSSYRLFSKY  183



>gb|AFK39780.1| unknown [Lotus japonicus]
Length=190

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 80/156 (51%), Gaps = 3/156 (2%)
 Frame = -1

Query  700  ELIFRCVICGLAIVGAVLIGTDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  521
            +LI R ++   ++V  V++ T +Q  E   + + AKF    A ++ V A  ++  YS++ 
Sbjct  32   DLILRFLLFASSLVAVVVMVTSNQT-EYVPLPRPAKFRYSPAFIYFVAAFSVSGLYSILT  90

Query  520  LVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRI  341
             +  S+S+IR   L  K L + +F  D L+  +   A   A   A     G + + W +I
Sbjct  91   AL-ASLSVIRKPALKTKFLLYFLF-WDALILGILASATGTAGGVAYVGLKGNNHVGWHKI  148

Query  340  CNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSL  233
            CN+Y K+C  VG  I   L+  I  ++L  +SAFSL
Sbjct  149  CNVYDKYCRHVGGSIGVGLVGSIVSVLLVWLSAFSL  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630