BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002D21

Length=826
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004231484.1|  PREDICTED: nucleolin 1 isoform X1                  164   1e-42   Solanum lycopersicum
ref|XP_010315558.1|  PREDICTED: nucleolin 1 isoform X2                  164   1e-42   
ref|XP_006367329.1|  PREDICTED: nucleolin 2-like                        159   9e-41   Solanum tuberosum [potatoes]
dbj|BAC02896.1|  tobacco nucleolin                                      157   2e-40   Nicotiana tabacum [American tobacco]
ref|XP_009624911.1|  PREDICTED: nucleolin 1 isoform X1                  157   3e-40   Nicotiana tomentosiformis
ref|XP_009624912.1|  PREDICTED: nucleolin 1 isoform X2                  157   3e-40   Nicotiana tomentosiformis
ref|XP_009778554.1|  PREDICTED: nucleolin 1 isoform X1                  155   2e-39   Nicotiana sylvestris
ref|XP_009778556.1|  PREDICTED: nucleolin 1 isoform X2                  155   2e-39   Nicotiana sylvestris
gb|EYU35586.1|  hypothetical protein MIMGU_mgv1a002998mg                142   4e-35   Erythranthe guttata [common monkey flower]
ref|XP_011070437.1|  PREDICTED: nucleolin 1-like                        139   8e-34   Sesamum indicum [beniseed]
ref|XP_004505721.1|  PREDICTED: nucleolin 2-like isoform X2             137   3e-33   
ref|XP_004505720.1|  PREDICTED: nucleolin 2-like isoform X1             137   3e-33   Cicer arietinum [garbanzo]
ref|XP_002307174.1|  nucleolin family protein                           137   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006380517.1|  hypothetical protein POPTR_0007s07800g             136   6e-33   
gb|ABK94939.1|  unknown                                                 136   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006380518.1|  hypothetical protein POPTR_0007s07800g             136   7e-33   
ref|XP_011008909.1|  PREDICTED: nucleolin 2 isoform X2                  135   1e-32   Populus euphratica
ref|XP_011008908.1|  PREDICTED: nucleolin 1 isoform X1                  135   1e-32   Populus euphratica
ref|XP_009383653.1|  PREDICTED: nucleolin 2-like isoform X2             135   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383652.1|  PREDICTED: nucleolin 2-like isoform X1             135   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022060.1|  PREDICTED: nucleolin 1-like isoform X2             135   1e-32   Populus euphratica
ref|XP_011022059.1|  PREDICTED: nucleolin 1-like isoform X1             136   2e-32   Populus euphratica
ref|XP_009420546.1|  PREDICTED: nucleolin 2-like                        133   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003581679.1|  PREDICTED: nucleolin 2-like                        133   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_010909800.1|  PREDICTED: nucleolin 2-like                        132   4e-31   Elaeis guineensis
ref|XP_010549154.1|  PREDICTED: nucleolin 1                             130   9e-31   Tarenaya hassleriana [spider flower]
ref|XP_004972658.1|  PREDICTED: nucleolin 1-like                        129   1e-30   Setaria italica
ref|XP_008787581.1|  PREDICTED: nucleolin 2-like isoform X5             130   2e-30   Phoenix dactylifera
ref|XP_008787580.1|  PREDICTED: nucleolin 2-like isoform X4             130   2e-30   Phoenix dactylifera
ref|XP_010249944.1|  PREDICTED: nucleolin 2-like isoform X3             130   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008787578.1|  PREDICTED: nucleolin 2-like isoform X2             130   2e-30   Phoenix dactylifera
ref|XP_008787577.1|  PREDICTED: nucleolin 2-like isoform X1             130   3e-30   Phoenix dactylifera
ref|XP_008787579.1|  PREDICTED: nucleolin 2-like isoform X3             130   3e-30   
ref|XP_010249927.1|  PREDICTED: nucleolin 2-like isoform X1             130   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010249935.1|  PREDICTED: nucleolin 2-like isoform X2             130   4e-30   Nelumbo nucifera [Indian lotus]
gb|EPS65245.1|  tobacco nucleolin                                       127   8e-30   Genlisea aurea
emb|CBI27136.3|  unnamed protein product                                127   2e-29   Vitis vinifera
ref|XP_006659905.1|  PREDICTED: nucleolin 1-like                        126   2e-29   Oryza brachyantha
ref|XP_007043310.1|  Nucleolin like 2 isoform 4                         125   3e-29   
ref|XP_010535330.1|  PREDICTED: nucleolin 1-like isoform X2             125   6e-29   Tarenaya hassleriana [spider flower]
ref|XP_010535329.1|  PREDICTED: nucleolin 1-like isoform X1             125   6e-29   Tarenaya hassleriana [spider flower]
gb|EAZ32021.1|  hypothetical protein OsJ_16200                          126   7e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910016.1|  PREDICTED: nucleolin 2-like                        126   7e-29   
ref|NP_001053909.1|  Os04g0620700                                       126   7e-29   
emb|CAH66982.1|  H0714H04.9                                             125   8e-29   Oryza sativa [red rice]
ref|XP_004982918.1|  PREDICTED: nucleolin 2-like isoform X2             125   9e-29   Setaria italica
ref|XP_004982917.1|  PREDICTED: nucleolin 2-like isoform X1             125   1e-28   
ref|XP_007043309.1|  Nucleolin like 2 isoform 3                         125   1e-28   
ref|XP_006652843.1|  PREDICTED: nucleolin 2-like                        125   1e-28   Oryza brachyantha
ref|XP_007043307.1|  Nucleolin like 2 isoform 1                         125   1e-28   
ref|XP_010648403.1|  PREDICTED: nucleolin 2 isoform X2                  125   1e-28   Vitis vinifera
ref|XP_007043308.1|  Nucleolin like 2 isoform 2                         125   1e-28   
ref|XP_010648398.1|  PREDICTED: nucleolin 2 isoform X1                  125   1e-28   Vitis vinifera
ref|XP_010648407.1|  PREDICTED: nucleolin 1 isoform X3                  125   1e-28   
dbj|BAJ99185.1|  predicted protein                                      125   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA74208.1|  protein localized in the nucleoli of pea nuclei; ...    124   2e-28   Pisum sativum [garden pea]
ref|XP_006592048.1|  PREDICTED: nucleolin 2-like isoform X3             122   5e-28   Glycine max [soybeans]
ref|XP_006592047.1|  PREDICTED: nucleolin 2-like isoform X2             122   1e-27   Glycine max [soybeans]
ref|XP_003540672.1|  PREDICTED: nucleolin 2-like isoform X1             122   1e-27   Glycine max [soybeans]
gb|KEH30577.1|  RNA recognition motif                                   121   1e-27   Medicago truncatula
gb|KEH30578.1|  RNA recognition motif                                   121   1e-27   Medicago truncatula
gb|KHN05443.1|  Protein gar2                                            122   1e-27   Glycine soja [wild soybean]
gb|KJB79882.1|  hypothetical protein B456_013G070400                    122   2e-27   Gossypium raimondii
gb|KHG07971.1|  Protein gar2                                            121   2e-27   Gossypium arboreum [tree cotton]
ref|XP_003607240.1|  RNA-binding protein                                121   2e-27   Medicago truncatula
gb|KHN32280.1|  RNA-binding protein 34                                  122   2e-27   Glycine soja [wild soybean]
gb|KJB12389.1|  hypothetical protein B456_002G015800                    121   2e-27   Gossypium raimondii
ref|XP_007222208.1|  hypothetical protein PRUPE_ppa007807mg             119   2e-27   
ref|XP_003537777.1|  PREDICTED: nucleolin 2-like                        122   2e-27   Glycine max [soybeans]
ref|XP_003607239.1|  RNA-binding protein                                121   2e-27   Medicago truncatula
ref|XP_003607231.1|  28 kDa ribonucleoprotein                           121   2e-27   
ref|XP_002467108.1|  hypothetical protein SORBIDRAFT_01g019710          121   2e-27   Sorghum bicolor [broomcorn]
gb|EMT18300.1|  Protein gar2                                            121   3e-27   
ref|XP_010094074.1|  hypothetical protein L484_018090                   120   4e-27   
tpg|DAA49685.1|  TPA: putative nucleolin-like family protein            114   7e-27   
ref|XP_011463448.1|  PREDICTED: nucleolin 1 isoform X8                  119   8e-27   Fragaria vesca subsp. vesca
emb|CAA61298.1|  nuM1                                                   119   8e-27   Medicago sativa [alfalfa]
gb|KDP43309.1|  hypothetical protein JCGZ_24230                         120   8e-27   Jatropha curcas
ref|XP_011463447.1|  PREDICTED: nucleolin 1 isoform X7                  119   1e-26   Fragaria vesca subsp. vesca
ref|XP_011463445.1|  PREDICTED: nucleolin 1 isoform X5                  119   1e-26   Fragaria vesca subsp. vesca
ref|XP_011463446.1|  PREDICTED: nucleolin 1 isoform X6                  119   1e-26   Fragaria vesca subsp. vesca
ref|XP_004297745.1|  PREDICTED: nucleolin 1 isoform X2                  119   1e-26   Fragaria vesca subsp. vesca
ref|XP_011463442.1|  PREDICTED: nucleolin 1 isoform X1                  119   1e-26   Fragaria vesca subsp. vesca
gb|KJB79879.1|  hypothetical protein B456_013G070400                    120   1e-26   Gossypium raimondii
gb|KJB79874.1|  hypothetical protein B456_013G070400                    120   1e-26   Gossypium raimondii
ref|XP_011463444.1|  PREDICTED: nucleolin 1 isoform X4                  119   1e-26   Fragaria vesca subsp. vesca
ref|XP_011463443.1|  PREDICTED: nucleolin 1 isoform X3                  119   1e-26   Fragaria vesca subsp. vesca
gb|KJB79880.1|  hypothetical protein B456_013G070400                    120   1e-26   Gossypium raimondii
gb|KJB79881.1|  hypothetical protein B456_013G070400                    120   1e-26   Gossypium raimondii
gb|KJB79877.1|  hypothetical protein B456_013G070400                    120   1e-26   Gossypium raimondii
ref|XP_010688710.1|  PREDICTED: nucleolin 1                             118   2e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011070700.1|  PREDICTED: nucleolin 2-like                        119   2e-26   
gb|AFW61036.1|  putative nucleolin-like family protein                  114   2e-26   
gb|KHG18558.1|  Nucleolin                                               118   5e-26   Gossypium arboreum [tree cotton]
ref|NP_001132813.1|  uncharacterized protein LOC100194303               114   5e-26   
gb|ACN25922.1|  unknown                                                 115   6e-26   Zea mays [maize]
ref|XP_008221051.1|  PREDICTED: nucleolin 1 isoform X2                  117   6e-26   Prunus mume [ume]
ref|XP_008221050.1|  PREDICTED: nucleolin 2 isoform X1                  117   7e-26   Prunus mume [ume]
gb|KJB79878.1|  hypothetical protein B456_013G070400                    117   8e-26   Gossypium raimondii
gb|KJB79875.1|  hypothetical protein B456_013G070400                    117   8e-26   Gossypium raimondii
gb|KJB79876.1|  hypothetical protein B456_013G070400                    117   1e-25   Gossypium raimondii
gb|KDO52763.1|  hypothetical protein CISIN_1g045516mg                   116   2e-25   Citrus sinensis [apfelsine]
ref|XP_006484546.1|  PREDICTED: nucleolin 2-like                        116   2e-25   Citrus sinensis [apfelsine]
gb|AFW61035.1|  putative nucleolin-like family protein                  115   3e-25   
ref|XP_006437567.1|  hypothetical protein CICLE_v10030875mg             115   3e-25   Citrus clementina [clementine]
ref|XP_008676638.1|  PREDICTED: uncharacterized protein LOC100194...    115   3e-25   
gb|EAZ05877.1|  hypothetical protein OsI_28114                          114   3e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001061178.1|  Os08g0192900                                       114   3e-25   
ref|XP_008676637.1|  PREDICTED: uncharacterized protein LOC100194...    115   4e-25   Zea mays [maize]
gb|AFW61032.1|  putative nucleolin-like family protein                  115   4e-25   
emb|CDP16867.1|  unnamed protein product                                114   8e-25   Coffea canephora [robusta coffee]
ref|XP_007131647.1|  hypothetical protein PHAVU_011G030600g             113   1e-24   Phaseolus vulgaris [French bean]
ref|XP_008350969.1|  PREDICTED: nucleolin 2-like                        108   3e-24   
ref|XP_008340448.1|  PREDICTED: nucleolin 1-like                        110   3e-24   Malus domestica [apple tree]
ref|XP_002527136.1|  nucleic acid binding protein, putative             112   4e-24   
ref|XP_009351719.1|  PREDICTED: nucleolin 1                             110   5e-24   
ref|XP_003573379.1|  PREDICTED: nucleolin 1                             110   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_006836341.1|  hypothetical protein AMTR_s00092p00090110          110   1e-23   
ref|XP_008461860.1|  PREDICTED: nucleolin 1 isoform X2                  110   2e-23   Cucumis melo [Oriental melon]
ref|XP_004172525.1|  PREDICTED: uncharacterized protein LOC101223830    108   2e-23   
ref|XP_008360013.1|  PREDICTED: nucleolin 2-like                        109   3e-23   
dbj|BAK07329.1|  predicted protein                                      105   3e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008389084.1|  PREDICTED: nucleolin 2-like                        109   3e-23   
ref|XP_008461859.1|  PREDICTED: nucleolin 1 isoform X1                  109   3e-23   Cucumis melo [Oriental melon]
ref|XP_010066989.1|  PREDICTED: nucleolin 2 isoform X4                  108   7e-23   
gb|KCW65048.1|  hypothetical protein EUGRSUZ_G02571                     108   7e-23   Eucalyptus grandis [rose gum]
ref|XP_010066988.1|  PREDICTED: nucleolin 2 isoform X3                  108   8e-23   
ref|XP_004148591.1|  PREDICTED: uncharacterized protein LOC101206235    108   9e-23   
ref|XP_010066987.1|  PREDICTED: nucleolin 1 isoform X2                  108   9e-23   Eucalyptus grandis [rose gum]
ref|XP_010066986.1|  PREDICTED: nucleolin 2 isoform X1                  108   9e-23   Eucalyptus grandis [rose gum]
gb|KCW65047.1|  hypothetical protein EUGRSUZ_G02571                     108   1e-22   Eucalyptus grandis [rose gum]
ref|XP_006306519.1|  hypothetical protein CARUB_v10012524mg             107   1e-22   Capsella rubella
ref|XP_011465351.1|  PREDICTED: nucleolin 1-like isoform X7             107   1e-22   Fragaria vesca subsp. vesca
ref|XP_011465350.1|  PREDICTED: nucleolin 1-like isoform X6             107   1e-22   Fragaria vesca subsp. vesca
ref|XP_004301800.1|  PREDICTED: nucleolin 1-like isoform X4             107   2e-22   Fragaria vesca subsp. vesca
ref|XP_011465349.1|  PREDICTED: nucleolin 1-like isoform X5             107   2e-22   Fragaria vesca subsp. vesca
ref|XP_011465346.1|  PREDICTED: nucleolin 1-like isoform X1             107   2e-22   Fragaria vesca subsp. vesca
ref|XP_011465347.1|  PREDICTED: nucleolin 1-like isoform X2             107   2e-22   Fragaria vesca subsp. vesca
ref|XP_011465348.1|  PREDICTED: nucleolin 1-like isoform X3             107   2e-22   Fragaria vesca subsp. vesca
gb|EMT20945.1|  Nucleolin                                               106   2e-22   
ref|XP_002445177.1|  hypothetical protein SORBIDRAFT_07g005510          106   3e-22   Sorghum bicolor [broomcorn]
dbj|BAK02407.1|  predicted protein                                      106   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010500433.1|  PREDICTED: nucleolin 1-like                        105   3e-22   Camelina sativa [gold-of-pleasure]
gb|KFK36056.1|  hypothetical protein AALP_AA4G072000                    105   5e-22   Arabis alpina [alpine rockcress]
ref|XP_010479318.1|  PREDICTED: nucleolin 1-like                        105   5e-22   Camelina sativa [gold-of-pleasure]
gb|EMS57596.1|  Nucleolin                                               105   8e-22   Triticum urartu
ref|XP_010461727.1|  PREDICTED: nucleolin 1-like                        104   8e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006406587.1|  hypothetical protein EUTSA_v10020940mg             101   2e-21   
ref|XP_006406586.1|  hypothetical protein EUTSA_v10020940mg             101   2e-21   
ref|XP_002891463.1|  hypothetical protein ARALYDRAFT_474037             102   8e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_009144995.1|  PREDICTED: nucleolin 1-like                      98.6    5e-20   Brassica rapa
emb|CDY65178.1|  BnaCnng45920D                                        96.3    4e-19   Brassica napus [oilseed rape]
gb|KFK39212.1|  hypothetical protein AALP_AA3G213800                  95.1    2e-18   Arabis alpina [alpine rockcress]
gb|KFK39211.1|  hypothetical protein AALP_AA3G213800                  95.1    2e-18   Arabis alpina [alpine rockcress]
ref|XP_006393330.1|  hypothetical protein EUTSA_v10011361mg           94.4    3e-18   Eutrema salsugineum [saltwater cress]
gb|KJB49997.1|  hypothetical protein B456_008G149100                  91.7    3e-18   Gossypium raimondii
gb|KJB49998.1|  hypothetical protein B456_008G149100                  91.7    4e-18   Gossypium raimondii
gb|KJB49999.1|  hypothetical protein B456_008G149100                  91.7    4e-18   Gossypium raimondii
ref|XP_009107584.1|  PREDICTED: nucleolin 1-like                      94.0    5e-18   
ref|XP_006605422.1|  PREDICTED: nucleolin 2-like isoform X3           94.0    5e-18   Glycine max [soybeans]
ref|XP_006605428.1|  PREDICTED: nucleolin 2-like isoform X9           94.0    6e-18   Glycine max [soybeans]
ref|XP_006605427.1|  PREDICTED: nucleolin 2-like isoform X8           94.0    6e-18   Glycine max [soybeans]
ref|XP_006605438.1|  PREDICTED: nucleolin 2-like isoform X19          94.0    6e-18   Glycine max [soybeans]
ref|XP_006605429.1|  PREDICTED: nucleolin 2-like isoform X10          94.0    7e-18   
ref|XP_006605421.1|  PREDICTED: nucleolin 2-like isoform X2           94.0    7e-18   Glycine max [soybeans]
ref|XP_006605420.1|  PREDICTED: nucleolin 2-like isoform X1           93.6    7e-18   Glycine max [soybeans]
ref|XP_006605430.1|  PREDICTED: nucleolin 2-like isoform X11          93.6    7e-18   Glycine max [soybeans]
ref|XP_006605441.1|  PREDICTED: nucleolin 2-like isoform X22          93.6    7e-18   Glycine max [soybeans]
gb|KGN58514.1|  hypothetical protein Csa_3G653460                     93.6    8e-18   
emb|CDX77274.1|  BnaC08g03190D                                        92.4    1e-17   
ref|XP_006587954.1|  PREDICTED: nucleolin 1-like                      90.1    2e-17   
emb|CDX93706.1|  BnaA06g03420D                                        91.3    3e-17   
ref|XP_009148215.1|  PREDICTED: nucleolin 1-like                      91.7    3e-17   
emb|CDX93704.1|  BnaA06g03440D                                        91.3    4e-17   
ref|XP_009145877.1|  PREDICTED: nucleolin 2-like                      90.9    4e-17   
ref|NP_175322.1|  nucleolin like 1                                    90.1    8e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59893.1|  BnaC06g40890D                                        89.4    1e-16   Brassica napus [oilseed rape]
gb|KHN29567.1|  Polyadenylate-binding protein, cytoplasmic and nu...  89.0    2e-16   Glycine soja [wild soybean]
ref|XP_002983635.1|  hypothetical protein SELMODRAFT_234317           88.6    3e-16   
emb|CDX92252.1|  BnaA05g21550D                                        87.8    5e-16   
ref|XP_002990577.1|  hypothetical protein SELMODRAFT_448081           87.0    1e-15   Selaginella moellendorffii
ref|XP_010487806.1|  PREDICTED: nucleolin 2-like                      85.9    2e-15   
ref|XP_010507224.1|  PREDICTED: nucleolin 2-like isoform X3           85.9    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010507230.1|  PREDICTED: nucleolin 2-like isoform X4           85.5    3e-15   
ref|XP_010507220.1|  PREDICTED: nucleolin 2-like isoform X2           85.5    3e-15   
ref|XP_001773240.1|  predicted protein                                85.9    3e-15   
ref|XP_002885266.1|  hypothetical protein ARALYDRAFT_479366           85.5    3e-15   
ref|XP_010507217.1|  PREDICTED: nucleolin 2-like isoform X1           85.5    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010466013.1|  PREDICTED: nucleolin 2-like isoform X12          85.9    4e-15   
dbj|BAB02219.1|  unnamed protein product                              85.1    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188491.1|  protein NUCLEOLIN LIKE 2                            85.1    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466007.1|  PREDICTED: nucleolin 2-like isoform X7           85.5    5e-15   
ref|XP_010466010.1|  PREDICTED: nucleolin 2-like isoform X9           85.1    5e-15   
ref|XP_010466011.1|  PREDICTED: nucleolin 2-like isoform X10          85.1    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010466005.1|  PREDICTED: nucleolin 2-like isoform X5           84.7    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010466003.1|  PREDICTED: dentin sialophosphoprotein-like i...  84.7    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010466000.1|  PREDICTED: dentin sialophosphoprotein-like i...  84.7    7e-15   
ref|XP_010466004.1|  PREDICTED: dentin sialophosphoprotein-like i...  84.7    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010466008.1|  PREDICTED: nucleolin 2-like isoform X8           84.7    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010466006.1|  PREDICTED: nucleolin 2-like isoform X6           84.7    8e-15   Camelina sativa [gold-of-pleasure]
emb|CDX99340.1|  BnaC05g34550D                                        84.0    9e-15   
ref|XP_009145876.1|  PREDICTED: nucleolin 2-like                      81.3    1e-14   Brassica rapa
ref|XP_010507033.1|  PREDICTED: nucleolin 2-like isoform X3           83.6    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010507028.1|  PREDICTED: nucleolin 2-like isoform X1           83.6    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010465970.1|  PREDICTED: nucleolin 2-like                      83.6    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010507032.1|  PREDICTED: nucleolin 2-like isoform X2           83.6    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010489916.1|  PREDICTED: nucleolin 2-like                      82.8    3e-14   Camelina sativa [gold-of-pleasure]
gb|KHM99054.1|  Protein gar2                                          82.4    4e-14   Glycine soja [wild soybean]
emb|CDX92253.1|  BnaA05g21540D                                        79.3    6e-14   
emb|CDX99339.1|  BnaC05g34540D                                        79.7    2e-13   
gb|EAY95603.1|  hypothetical protein OsI_17455                        79.3    3e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_004513591.1|  PREDICTED: RNA-binding protein 28-like isofo...  79.0    4e-13   Cicer arietinum [garbanzo]
ref|XP_004513590.1|  PREDICTED: RNA-binding protein 28-like isofo...  79.0    4e-13   
ref|XP_004513589.1|  PREDICTED: RNA-binding protein 28-like isofo...  79.0    4e-13   Cicer arietinum [garbanzo]
ref|XP_007156397.1|  hypothetical protein PHAVU_003G282900g           78.2    8e-13   Phaseolus vulgaris [French bean]
ref|XP_007156398.1|  hypothetical protein PHAVU_003G282900g           78.2    9e-13   Phaseolus vulgaris [French bean]
ref|XP_007156396.1|  hypothetical protein PHAVU_003G282900g           77.8    9e-13   Phaseolus vulgaris [French bean]
ref|XP_006297116.1|  hypothetical protein CARUB_v10013117mg           77.8    9e-13   
ref|XP_007156395.1|  hypothetical protein PHAVU_003G282900g           77.8    1e-12   Phaseolus vulgaris [French bean]
ref|XP_006297117.1|  hypothetical protein CARUB_v10013117mg           77.4    1e-12   Capsella rubella
ref|XP_011396887.1|  Protein gar2                                     75.5    1e-12   Auxenochlorella protothecoides
ref|XP_006297118.1|  hypothetical protein CARUB_v10013117mg           77.4    1e-12   Capsella rubella
ref|XP_006297119.1|  hypothetical protein CARUB_v10013117mg           77.4    1e-12   Capsella rubella
ref|XP_005849687.1|  hypothetical protein CHLNCDRAFT_143267           74.7    8e-12   Chlorella variabilis
gb|AAF69708.1|AC016041_13  F27J15.29                                  70.9    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001757595.1|  predicted protein                                72.8    3e-11   
gb|KEH40855.1|  RNA recognition motif                                 72.4    5e-11   Medicago truncatula
emb|CAA39224.1|  glycine-rich protein                                 68.2    7e-11   Solanum lycopersicum
ref|XP_001769822.1|  predicted protein                                70.5    2e-10   
gb|KFK23930.1|  hypothetical protein AALP_AAs47265U000100             65.1    4e-09   Arabis alpina [alpine rockcress]
gb|KFK41492.1|  hypothetical protein AALP_AA2G137300                  65.9    6e-09   Arabis alpina [alpine rockcress]
gb|KFK41567.1|  hypothetical protein AALP_AA2G146000                  64.7    6e-09   Arabis alpina [alpine rockcress]
emb|CDX91450.1|  BnaC04g07000D                                        63.2    1e-08   
ref|XP_010443562.1|  PREDICTED: polyadenylate-binding protein 2-like  63.2    1e-08   
emb|CDY16474.1|  BnaA08g02930D                                        65.1    2e-08   Brassica napus [oilseed rape]
ref|XP_009143396.1|  PREDICTED: polyadenylate-binding protein 2-like  62.4    3e-08   Brassica rapa
ref|XP_010477184.1|  PREDICTED: nucleolin 2-like                      61.6    3e-08   
emb|CDX91454.1|  BnaC04g06960D                                        61.6    5e-08   
emb|CAA88179.1|  gar2                                                 63.2    6e-08   Schizosaccharomyces pombe
ref|NP_593531.1|  nucleolar protein required for rRNA processing      63.2    6e-08   Schizosaccharomyces pombe
gb|KFK41695.1|  hypothetical protein AALP_AA2G161100                  62.0    6e-08   Arabis alpina [alpine rockcress]
gb|KFK41489.1|  hypothetical protein AALP_AA2G137000                  62.4    8e-08   Arabis alpina [alpine rockcress]
gb|EPX72616.1|  gar2                                                  62.8    9e-08   Schizosaccharomyces octosporus yFS286
ref|XP_010469654.1|  PREDICTED: nucleolin 1-like                      62.0    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010485217.1|  PREDICTED: polyadenylate-binding protein 2-like  60.5    1e-07   
tpg|DAA38878.1|  TPA: putative nucleolin-like family protein          62.4    1e-07   
ref|XP_010491460.1|  PREDICTED: nucleolin 1-like                      61.6    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010453613.1|  PREDICTED: uncharacterized protein LOC104735498  60.1    2e-07   
ref|XP_010423112.1|  PREDICTED: nucleolin 1-like                      58.5    2e-07   
ref|XP_010436361.1|  PREDICTED: nucleolin 1-like                      61.2    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002448857.1|  hypothetical protein SORBIDRAFT_05g000362        57.8    3e-07   
gb|KFK25167.1|  hypothetical protein AALP_AA8G075100                  60.5    3e-07   Arabis alpina [alpine rockcress]
emb|CDX91465.1|  BnaC04g06850D                                        58.5    4e-07   
emb|CDY54454.1|  BnaAnng13210D                                        59.3    4e-07   Brassica napus [oilseed rape]
emb|CDX91458.1|  BnaC04g06920D                                        58.9    6e-07   
ref|XP_006400770.1|  hypothetical protein EUTSA_v10015531mg           57.4    7e-07   
ref|XP_006414776.1|  hypothetical protein EUTSA_v10026891mg           58.2    9e-07   
gb|EPY52807.1|  nucleolar protein required for rRNA processing        59.7    9e-07   Schizosaccharomyces cryophilus OY26
emb|CDJ36172.1|  nucleolar phosphoprotein nucleolin, putative         59.3    1e-06   Eimeria mitis
ref|XP_006414774.1|  hypothetical protein EUTSA_v10027509mg           56.2    1e-06   
gb|KFK41491.1|  hypothetical protein AALP_AA2G137200                  58.9    2e-06   Arabis alpina [alpine rockcress]
gb|KFK23548.1|  hypothetical protein AALP_AAs66918U001200             57.4    2e-06   Arabis alpina [alpine rockcress]
ref|XP_010443563.1|  PREDICTED: polyadenylate-binding protein 2-like  57.4    2e-06   Camelina sativa [gold-of-pleasure]
emb|CDJ60925.1|  nucleolar phosphoprotein nucleolin, putative         58.9    2e-06   Eimeria maxima
gb|KIO31343.1|  hypothetical protein M407DRAFT_220481                 58.5    3e-06   Tulasnella calospora MUT 4182
ref|XP_009544258.1|  hypothetical protein HETIRDRAFT_314076           57.4    3e-06   Heterobasidion irregulare TC 32-1
ref|XP_002171551.1|  hypothetical protein SJAG_00259                  58.2    3e-06   Schizosaccharomyces japonicus yFS275
ref|XP_007388527.1|  RNA-binding domain-containing protein            58.2    3e-06   Punctularia strigosozonata HHB-11173 SS5
ref|XP_001742876.1|  hypothetical protein                             58.5    3e-06   Monosiga brevicollis MX1
emb|CDI83845.1|  nucleolar phosphoprotein nucleolin, putative         58.2    3e-06   Eimeria acervulina
gb|EJY70479.1|  hypothetical protein OXYTRI_08772                     57.8    3e-06   Oxytricha trifallax
emb|CDJ50319.1|  nucleolar phosphoprotein nucleolin, putative         58.2    3e-06   Eimeria brunetti
ref|XP_010474315.1|  PREDICTED: nucleolin 2-like                      55.5    4e-06   
ref|XP_006400968.1|  hypothetical protein EUTSA_v10015284mg           55.1    4e-06   
emb|CDY09156.1|  BnaA02g05820D                                        57.0    5e-06   Brassica napus [oilseed rape]
ref|XP_009126872.1|  PREDICTED: histone deacetylase HDT2-like         57.0    5e-06   
gb|KJB17317.1|  hypothetical protein B456_003G040800                  55.8    5e-06   Gossypium raimondii
emb|CDI75493.1|  nucleolar phosphoprotein nucleolin, putative         57.4    5e-06   Eimeria praecox
ref|XP_006289866.1|  hypothetical protein CARUB_v10003477mg           55.1    6e-06   
emb|CDY55162.1|  BnaCnng28280D                                        55.8    6e-06   
gb|EJY71156.1|  RNA-binding proteins (RRM domain)                     57.0    7e-06   
ref|XP_002436725.1|  hypothetical protein SORBIDRAFT_10g007620        55.5    7e-06   
gb|KFK41703.1|  hypothetical protein AALP_AA2G161900                  56.6    7e-06   
ref|XP_002873095.1|  predicted protein                                55.8    8e-06   
emb|CBN77067.1|  Sart3 protein                                        57.0    8e-06   
ref|XP_007047889.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...  55.5    8e-06   
ref|XP_007047888.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...  55.5    8e-06   
gb|KHG00394.1|  Polyadenylate-binding 2                               55.5    9e-06   
gb|KJB17319.1|  hypothetical protein B456_003G040800                  55.5    9e-06   
gb|KJB17316.1|  hypothetical protein B456_003G040800                  54.7    1e-05   
ref|XP_010424438.1|  PREDICTED: nucleolin 1-like                      54.7    1e-05   
gb|ACF87534.1|  unknown                                               55.1    1e-05   
ref|XP_010495045.1|  PREDICTED: nucleolin 2-like                      53.1    1e-05   
ref|WP_034616338.1|  RNA-binding protein                              52.8    1e-05   
ref|XP_010469614.1|  PREDICTED: nucleolin 1-like                      54.7    1e-05   
ref|XP_002883446.1|  predicted protein                                55.8    1e-05   
ref|XP_002871038.1|  predicted protein                                55.1    1e-05   
ref|XP_003881295.1|  putative nucleolar phosphoprotein nucleolin      56.2    1e-05   
emb|CDJ41252.1|  nucleolar phosphoprotein nucleolin, putative         55.8    2e-05   
ref|XP_001435565.1|  hypothetical protein                             55.8    2e-05   
ref|XP_004964965.1|  PREDICTED: polyadenylate-binding protein 2-l...  54.3    2e-05   
ref|XP_004964966.1|  PREDICTED: polyadenylate-binding protein 2-l...  53.9    2e-05   
ref|NP_201329.1|  RNA recognition motif-containing protein            54.3    2e-05   
ref|XP_006394056.1|  hypothetical protein EUTSA_v10004890mg           54.3    2e-05   
ref|NP_001288928.1|  polyadenylate-binding protein 2                  54.3    2e-05   
ref|XP_002866661.1|  polyadenylate-binding protein family protein     54.3    2e-05   
ref|XP_002871317.1|  predicted protein                                55.1    2e-05   
gb|KIJ32303.1|  hypothetical protein M422DRAFT_184633                 54.3    2e-05   
emb|CBN78824.1|  Protein for assembly of pre-ribosomal particles ...  55.5    2e-05   
gb|KJB07918.1|  hypothetical protein B456_001G052500                  53.9    3e-05   
ref|XP_002873094.1|  predicted protein                                54.7    3e-05   
ref|XP_010267253.1|  PREDICTED: polyadenylate-binding protein 2       53.9    3e-05   
emb|CBN76756.1|  conserved unknown protein                            55.5    3e-05   
ref|XP_004143458.1|  PREDICTED: polyadenylate-binding protein 2-like  53.9    3e-05   
ref|XP_010519384.1|  PREDICTED: polyadenylate-binding protein 2-l...  53.9    3e-05   
gb|ESA01445.1|  hypothetical protein GLOINDRAFT_68561                 54.7    3e-05   
ref|XP_006466250.1|  PREDICTED: polyadenylate-binding protein 2-like  53.9    3e-05   
ref|XP_008786202.1|  PREDICTED: polyadenylate-binding protein 2-like  53.9    3e-05   
ref|XP_002490979.1|  Poly(A) binding protein, part of the 3'-end ...  55.1    3e-05   
ref|XP_006394055.1|  hypothetical protein EUTSA_v10004890mg           53.5    4e-05   
ref|XP_011465382.1|  PREDICTED: polyadenylate-binding protein 2-like  53.5    4e-05   
ref|XP_010523297.1|  PREDICTED: polyadenylate-binding protein 2-like  53.1    4e-05   
ref|XP_006281788.1|  hypothetical protein CARUB_v10027958mg           53.9    4e-05   
gb|KDO60716.1|  hypothetical protein CISIN_1g041633mg                 53.9    4e-05   
gb|KIO03051.1|  hypothetical protein M404DRAFT_59789                  53.5    4e-05   
ref|XP_781643.2|  PREDICTED: squamous cell carcinoma antigen reco...  55.1    4e-05   
gb|KFK28208.1|  hypothetical protein AALP_AA8G486500                  53.5    4e-05   
gb|ACU17272.1|  unknown                                               52.8    4e-05   
ref|XP_006280995.1|  hypothetical protein CARUB_v10027002mg           53.9    4e-05   
gb|KJB07914.1|  hypothetical protein B456_001G052500                  53.5    5e-05   
ref|XP_006376950.1|  hypothetical protein POPTR_0012s11480g           53.5    5e-05   
ref|XP_008887909.1|  RNA recognition motif-containing protein         54.7    5e-05   
ref|NP_001152340.1|  polyadenylate-binding protein 2                  53.1    5e-05   
emb|CDY33952.1|  BnaC02g43850D                                        53.1    5e-05   
emb|CCG81513.1|  Gar2                                                 54.3    5e-05   
gb|EPS71398.1|  hypothetical protein M569_03365                       53.1    5e-05   
gb|KDO50217.1|  hypothetical protein CISIN_1g029268mg                 52.4    5e-05   
ref|XP_002309968.1|  hypothetical protein POPTR_0007s05140g           53.1    5e-05   
gb|EXX76493.1|  Nsr1p                                                 54.3    5e-05   
emb|CDY07010.1|  BnaA04g23050D                                        53.5    5e-05   
ref|XP_011022817.1|  PREDICTED: polyadenylate-binding protein 2-l...  53.1    6e-05   
ref|XP_011003544.1|  PREDICTED: polyadenylate-binding protein 1-like  53.1    6e-05   
emb|CDJ66362.1|  nucleolar phosphoprotein nucleolin, putative         54.3    6e-05   
ref|XP_010452589.1|  PREDICTED: nucleolin 2-like                      52.0    6e-05   
ref|XP_008646980.1|  PREDICTED: polyadenylate-binding protein 2-like  51.2    6e-05   
gb|KDO50216.1|  hypothetical protein CISIN_1g029268mg                 52.8    6e-05   
ref|XP_009141809.1|  PREDICTED: uncharacterized protein LOC103865720  53.5    6e-05   
ref|XP_007042910.1|  RNA-binding family protein isoform 2             52.4    6e-05   
ref|XP_002368535.1|  nucleolar phosphoprotein nucleolin, putative     54.3    6e-05   
gb|KFG30860.1|  RNA recognition motif-containing protein              54.3    6e-05   
gb|EPR59683.1|  RNA recognition motif-containing protein              54.3    6e-05   
ref|XP_006492630.1|  PREDICTED: polyadenylate-binding protein 2-l...  52.4    6e-05   
gb|KFG62879.1|  RNA recognition motif-containing protein              54.3    7e-05   
gb|KFH05868.1|  RNA recognition motif-containing protein              54.3    7e-05   
ref|XP_008453839.1|  PREDICTED: polyadenylate-binding protein 2-l...  53.1    7e-05   
ref|XP_002118293.1|  hypothetical protein TRIADDRAFT_62320            54.3    7e-05   
ref|XP_002862489.1|  predicted protein                                51.6    7e-05   
ref|XP_002945845.1|  hypothetical protein VOLCADRAFT_54847            52.8    7e-05   
ref|XP_006366227.1|  PREDICTED: polyadenylate-binding protein 2-A...  52.8    7e-05   
gb|KJB19595.1|  hypothetical protein B456_003G110600                  52.8    7e-05   
ref|XP_007042909.1|  RNA-binding family protein isoform 1             52.4    7e-05   
ref|XP_004307764.1|  PREDICTED: polyadenylate-binding protein 1       52.8    7e-05   
ref|XP_010680512.1|  PREDICTED: polyadenylate-binding protein 2       52.8    7e-05   
ref|XP_006587944.1|  PREDICTED: nucleolin 1-like isoform X1           53.1    8e-05   
ref|XP_006492629.1|  PREDICTED: polyadenylate-binding protein 2-l...  52.4    8e-05   
ref|XP_009611267.1|  PREDICTED: polyadenylate-binding protein 2       52.4    8e-05   
ref|XP_011097543.1|  PREDICTED: polyadenylate-binding protein 2 i...  52.4    8e-05   
ref|XP_010917314.1|  PREDICTED: polyadenylate-binding protein 2-like  52.8    8e-05   
ref|NP_001235474.1|  uncharacterized protein LOC100527139             52.4    8e-05   
gb|KDN39748.1|  RNA-binding domain-containing protein                 53.5    9e-05   
gb|EYU23964.1|  hypothetical protein MIMGU_mgv1a013628mg              52.4    9e-05   
gb|KIH68406.1|  hypothetical protein ANCDUO_01252                     52.0    9e-05   
ref|XP_006821088.1|  PREDICTED: squamous cell carcinoma antigen r...  53.9    9e-05   
gb|ACR34224.1|  unknown                                               52.0    1e-04   
gb|KHN30707.1|  Polyadenylate-binding protein 2                       52.4    1e-04   
ref|XP_010444550.1|  PREDICTED: polyadenylate-binding protein 2-l...  52.4    1e-04   
ref|NP_001149957.1|  polyadenylate-binding protein 2                  52.0    1e-04   
ref|XP_009363742.1|  PREDICTED: polyadenylate-binding protein 2       52.4    1e-04   
ref|XP_007148398.1|  hypothetical protein PHAVU_006G205100g           52.0    1e-04   
gb|KJB19594.1|  hypothetical protein B456_003G110600                  52.4    1e-04   
ref|XP_010444551.1|  PREDICTED: polyadenylate-binding protein 2-l...  52.4    1e-04   
ref|XP_010463257.1|  PREDICTED: polyadenylate-binding protein 2-like  52.4    1e-04   
emb|CDY33970.1|  BnaC02g43670D                                        52.4    1e-04   
ref|XP_008804765.1|  PREDICTED: polyadenylate-binding protein 2-l...  52.4    1e-04   
gb|KJB47020.1|  hypothetical protein B456_008G016100                  52.0    1e-04   
ref|XP_010274505.1|  PREDICTED: polyadenylate-binding protein 2       52.4    1e-04   
ref|XP_010273013.1|  PREDICTED: polyadenylate-binding protein 2 i...  51.2    1e-04   
emb|CCG83374.1|  Protein gar2                                         52.0    1e-04   
gb|KJB79639.1|  hypothetical protein B456_013G060100                  51.6    1e-04   
gb|KFK35374.1|  hypothetical protein AALP_AA5G277000                  51.6    1e-04   
emb|CDP01496.1|  unnamed protein product                              52.4    1e-04   
ref|XP_008804766.1|  PREDICTED: polyadenylate-binding protein 2-l...  52.4    1e-04   
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg           53.1    1e-04   
ref|NP_001237617.1|  uncharacterized protein LOC100527545             52.0    1e-04   
gb|AFK37484.1|  unknown                                               52.0    1e-04   
ref|XP_007144150.1|  hypothetical protein PHAVU_007G133000g           52.0    1e-04   
ref|XP_010273012.1|  PREDICTED: polyadenylate-binding protein 2 i...  50.8    1e-04   
gb|EYB84201.1|  hypothetical protein Y032_0321g2416                   52.8    1e-04   
ref|XP_002525843.1|  poly-A binding protein, putative                 51.6    1e-04   
gb|KGN53719.1|  hypothetical protein Csa_4G110060                     51.6    1e-04   
gb|KHG28448.1|  Polyadenylate-binding 2                               51.6    1e-04   
ref|XP_006279497.1|  hypothetical protein CARUB_v10027046mg           52.4    1e-04   
gb|KJB79638.1|  hypothetical protein B456_013G060100                  51.6    1e-04   
ref|XP_010030027.1|  PREDICTED: polyadenylate-binding protein 2-like  51.6    1e-04   
gb|KJB79637.1|  hypothetical protein B456_013G060100                  51.6    1e-04   
ref|XP_004168611.1|  PREDICTED: polyadenylate-binding protein 2-like  51.6    1e-04   
ref|XP_004137160.1|  PREDICTED: polyadenylate-binding protein 2-like  51.6    1e-04   
ref|XP_004164242.1|  PREDICTED: polyadenylate-binding protein 2-like  52.0    1e-04   
ref|XP_006353217.1|  PREDICTED: polyadenylate-binding protein 2-A...  52.0    1e-04   
ref|XP_003635560.2|  PREDICTED: polyadenylate-binding protein 2       52.0    1e-04   
ref|XP_002496680.1|  ZYRO0D05654p                                     53.1    1e-04   
gb|KHG15936.1|  Polyadenylate-binding 2                               51.6    1e-04   
ref|XP_008462875.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.6    1e-04   
ref|XP_008462873.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.6    1e-04   
ref|XP_007338439.1|  RNA-binding domain-containing protein            53.1    1e-04   
ref|XP_008464885.1|  PREDICTED: polyadenylate-binding protein 2-like  49.7    1e-04   
ref|XP_004250109.1|  PREDICTED: polyadenylate-binding protein 2 i...  52.0    1e-04   
ref|XP_011031058.1|  PREDICTED: polyadenylate-binding protein 3-l...  52.0    1e-04   
ref|XP_009130503.1|  PREDICTED: polyadenylate-binding protein 2-like  51.6    1e-04   
gb|KFH70493.1|  nucleolin                                             52.8    1e-04   
ref|XP_002306300.1|  hypothetical protein POPTR_0005s07440g           52.0    1e-04   
ref|WP_006715862.1|  RNA-binding protein                              49.7    1e-04   
gb|EYB84203.1|  hypothetical protein Y032_0321g2416                   53.1    2e-04   
gb|KHG12327.1|  Polyadenylate-binding 2                               52.0    2e-04   
ref|XP_004495250.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.6    2e-04   
gb|EYB84202.1|  hypothetical protein Y032_0321g2416                   53.1    2e-04   
gb|ACU19123.1|  unknown                                               51.6    2e-04   
ref|XP_007038220.1|  RNA-binding family protein                       51.6    2e-04   
ref|XP_004495249.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.6    2e-04   
ref|XP_008234027.1|  PREDICTED: polyadenylate-binding protein 2       51.6    2e-04   
ref|XP_004146877.1|  PREDICTED: polyadenylate-binding protein 2-like  51.6    2e-04   
ref|XP_009404040.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.6    2e-04   
ref|XP_008453840.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.6    2e-04   
gb|KCW56969.1|  hypothetical protein EUGRSUZ_I02641                   51.6    2e-04   
ref|XP_006423797.1|  hypothetical protein CICLE_v100293173mg          49.3    2e-04   
ref|XP_009390280.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.6    2e-04   
ref|XP_009390281.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.6    2e-04   
emb|CDY37814.1|  BnaAnng04750D                                        50.4    2e-04   
ref|XP_011076455.1|  PREDICTED: polyadenylate-binding protein 1 i...  51.6    2e-04   
ref|XP_007159120.1|  hypothetical protein PHAVU_002G210300g           51.2    2e-04   
ref|XP_006374587.1|  hypothetical protein POPTR_0015s12230g           51.6    2e-04   
ref|XP_008658656.1|  PREDICTED: polyadenylate-binding protein 2 i...  51.6    2e-04   
emb|CAN77560.1|  hypothetical protein VITISV_031100                   50.8    2e-04   
emb|CEP09546.1|  hypothetical protein                                 52.4    2e-04   
ref|XP_002531675.1|  poly-A binding protein, putative                 51.6    2e-04   
ref|XP_004166616.1|  PREDICTED: polyadenylate-binding protein 2-like  51.6    2e-04   
ref|XP_009404041.1|  PREDICTED: polyadenylate-binding protein 2-l...  51.2    2e-04   
ref|XP_004504815.1|  PREDICTED: polyadenylate-binding protein 2-A...  51.2    2e-04   
pdb|2M70|A  Chain A, Structural Determination Of The Citrus Sinen...  50.4    2e-04   
ref|NP_001239931.1|  uncharacterized protein LOC100791351             50.8    2e-04   
ref|XP_003525045.1|  PREDICTED: polyadenylate-binding protein 2 i...  51.2    2e-04   
ref|XP_004504816.1|  PREDICTED: polyadenylate-binding protein 2-A...  50.8    2e-04   
ref|XP_004146890.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  51.6    2e-04   
ref|XP_002279148.1|  PREDICTED: polyadenylate-binding protein 2       51.2    2e-04   
gb|AFW71284.1|  hypothetical protein ZEAMMB73_459562                  51.6    2e-04   
ref|XP_010937392.1|  PREDICTED: polyadenylate-binding protein 2 i...  51.2    2e-04   
gb|KCW56971.1|  hypothetical protein EUGRSUZ_I02641                   51.2    2e-04   
ref|XP_002882217.1|  predicted protein                                50.8    2e-04   
ref|XP_011501159.1|  PREDICTED: RNA-binding protein 34-like           52.0    2e-04   
ref|XP_010937393.1|  PREDICTED: polyadenylate-binding protein 2 i...  51.2    2e-04   
ref|XP_011040326.1|  PREDICTED: polyadenylate-binding protein 1 i...  51.2    2e-04   
gb|KGN53209.1|  hypothetical protein Csa_4G026860                     51.6    2e-04   
gb|ELU39701.1|  RNA recognition motif domain-containing protein       52.4    2e-04   
gb|AAH72838.1|  LOC443584 protein                                     52.0    2e-04   
ref|XP_009132625.1|  PREDICTED: polyadenylate-binding protein 2-like  51.2    2e-04   
ref|XP_009393548.1|  PREDICTED: polyadenylate-binding protein 2-like  51.2    3e-04   
ref|XP_008453809.1|  PREDICTED: polyadenylate-binding protein 2 i...  51.2    3e-04   
ref|XP_006426354.1|  hypothetical protein CICLE_v100264481mg          49.3    3e-04   
ref|XP_011040327.1|  PREDICTED: polyadenylate-binding protein 1 i...  51.2    3e-04   
ref|XP_006279835.1|  hypothetical protein CARUB_v10028183mg           49.7    3e-04   
ref|NP_001240115.1|  uncharacterized protein LOC100784473             50.8    3e-04   
ref|XP_006426355.1|  hypothetical protein CICLE_v100264481mg          49.7    3e-04   
ref|NP_001085272.1|  RNA binding motif protein 34                     52.0    3e-04   
ref|XP_010432248.1|  PREDICTED: nucleolin 1-like isoform X3           49.7    3e-04   
ref|XP_010933557.1|  PREDICTED: polyadenylate-binding protein 2-like  51.2    3e-04   
ref|XP_010491219.1|  PREDICTED: uncharacterized protein LOC104768851  50.8    3e-04   
gb|EMS18176.1|  single-stranded DNA binding protein                   52.0    3e-04   
emb|CDX97815.1|  BnaC04g41240D                                        50.8    3e-04   
ref|XP_002864221.1|  predicted protein                                51.2    3e-04   
gb|KCW56970.1|  hypothetical protein EUGRSUZ_I02641                   50.8    3e-04   
gb|KJB51352.1|  hypothetical protein B456_008G213100                  50.4    3e-04   
ref|XP_008777640.1|  PREDICTED: polyadenylate-binding protein 2-like  50.8    3e-04   
gb|ACU24426.1|  unknown                                               50.8    3e-04   
gb|KFK38051.1|  hypothetical protein AALP_AA3G063900                  51.6    3e-04   
ref|XP_002511041.1|  polyadenylate-binding protein, putative          51.2    3e-04   
ref|XP_010433418.1|  PREDICTED: polyadenylate-binding protein RBP45C  52.0    3e-04   
emb|CDW73009.1|  nucleolin protein                                    52.0    3e-04   
ref|XP_010027917.1|  PREDICTED: polyadenylate-binding protein 2 i...  50.8    3e-04   
ref|XP_008381986.1|  PREDICTED: polyadenylate-binding protein 2 i...  50.8    3e-04   
dbj|GAN07362.1|  conserved hypothetical protein                       51.6    3e-04   
gb|KFK35386.1|  hypothetical protein AALP_AA5G278500                  51.6    3e-04   
ref|XP_010438672.1|  PREDICTED: polyadenylate-binding protein RBP45C  52.0    3e-04   
ref|XP_010094140.1|  Polyadenylate-binding protein 2                  50.4    3e-04   
ref|XP_010027916.1|  PREDICTED: polyadenylate-binding protein 2 i...  50.8    3e-04   
ref|XP_010423367.1|  PREDICTED: uncharacterized protein LOC104708485  50.8    3e-04   
ref|XP_006289028.1|  hypothetical protein CARUB_v10002413mg           48.9    3e-04   
ref|WP_015044625.1|  MULTISPECIES: RNA-binding protein                48.5    3e-04   
gb|KJB12773.1|  hypothetical protein B456_002G038400                  50.8    3e-04   
tpg|DAA46761.1|  TPA: hypothetical protein ZEAMMB73_590191            51.2    3e-04   
ref|XP_010269828.1|  PREDICTED: polyadenylate-binding protein 2-like  50.8    3e-04   



>ref|XP_004231484.1| PREDICTED: nucleolin 1 isoform X1 [Solanum lycopersicum]
Length=632

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 97/130 (75%), Gaps = 5/130 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG DLL RDV+L  A+ERG YTP SG   N +  Q     E TT+FVRGFDKN+ ED 
Sbjct  426  ELNGHDLLGRDVRLDLARERGEYTPRSG---NENSFQRPARSEGTTIFVRGFDKNEAEDQ  482

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSL  472
            IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D DA++KALEL+ S++G  SL
Sbjct  483  IRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDADALNKALELDGSEVGGFSL  542

Query  471  YVDEAKPRND  442
             V EAKPR D
Sbjct  543  NVQEAKPRGD  552



>ref|XP_010315558.1| PREDICTED: nucleolin 1 isoform X2 [Solanum lycopersicum]
Length=631

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 97/130 (75%), Gaps = 5/130 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG DLL RDV+L  A+ERG YTP SG   N +  Q     E TT+FVRGFDKN+ ED 
Sbjct  425  ELNGHDLLGRDVRLDLARERGEYTPRSG---NENSFQRPARSEGTTIFVRGFDKNEAEDQ  481

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSL  472
            IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D DA++KALEL+ S++G  SL
Sbjct  482  IRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDADALNKALELDGSEVGGFSL  541

Query  471  YVDEAKPRND  442
             V EAKPR D
Sbjct  542  NVQEAKPRGD  551



>ref|XP_006367329.1| PREDICTED: nucleolin 2-like [Solanum tuberosum]
Length=626

 Score =   159 bits (401),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 3/127 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG DLL RDV+L  A+ERG YTP SG  D +S ++     + TT+FVRGFDKN+ ED 
Sbjct  418  ELNGHDLLGRDVRLDLARERGEYTPRSG-RDENSFQKPAARSDGTTIFVRGFDKNEAEDQ  476

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSL  472
            IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D DA++KALEL+ S++G  SL
Sbjct  477  IRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDADALNKALELDGSEVGGFSL  536

Query  471  YVDEAKP  451
             V EAKP
Sbjct  537  NVQEAKP  543



>dbj|BAC02896.1| tobacco nucleolin [Nicotiana tabacum]
Length=620

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 100/127 (79%), Gaps = 4/127 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ERG YTP +G  +NS QRQ R   E TT+FVRGFDKN+ ED 
Sbjct  425  ELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGFDKNEAEDQ  482

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSL  472
            IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D+DA++KALEL+ S++G  +L
Sbjct  483  IRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDSDALNKALELDGSEVGGYNL  542

Query  471  YVDEAKP  451
             V EAKP
Sbjct  543  TVQEAKP  549



>ref|XP_009624911.1| PREDICTED: nucleolin 1 isoform X1 [Nicotiana tomentosiformis]
Length=632

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 100/127 (79%), Gaps = 4/127 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ERG YTP +G  +NS QRQ R   E TT+FVRGFDKN+ ED 
Sbjct  426  ELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGFDKNEAEDQ  483

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSL  472
            IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D+DA++KALEL+ S++G  +L
Sbjct  484  IRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDSDALNKALELDGSEVGGYNL  543

Query  471  YVDEAKP  451
             V EAKP
Sbjct  544  TVQEAKP  550



>ref|XP_009624912.1| PREDICTED: nucleolin 1 isoform X2 [Nicotiana tomentosiformis]
Length=631

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 100/127 (79%), Gaps = 4/127 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ERG YTP +G  +NS QRQ R   E TT+FVRGFDKN+ ED 
Sbjct  425  ELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGFDKNEAEDQ  482

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSL  472
            IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D+DA++KALEL+ S++G  +L
Sbjct  483  IRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDSDALNKALELDGSEVGGYNL  542

Query  471  YVDEAKP  451
             V EAKP
Sbjct  543  TVQEAKP  549



>ref|XP_009778554.1| PREDICTED: nucleolin 1 isoform X1 [Nicotiana sylvestris]
Length=628

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 98/127 (77%), Gaps = 4/127 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ERG YTP +G  +NS QRQ R   E TT+FVRGFDKN+ ED 
Sbjct  422  ELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGFDKNEAEDQ  479

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSL  472
            IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D D ++KALEL+ S++G  +L
Sbjct  480  IRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDGDTLNKALELDGSEVGGYNL  539

Query  471  YVDEAKP  451
             V EAKP
Sbjct  540  TVQEAKP  546



>ref|XP_009778556.1| PREDICTED: nucleolin 1 isoform X2 [Nicotiana sylvestris]
Length=627

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 98/127 (77%), Gaps = 4/127 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ERG YTP +G  +NS QRQ R   E TT+FVRGFDKN+ ED 
Sbjct  421  ELNGQDLLGRAVRLDLARERGEYTPRTGREENSFQRQGRS--EGTTIFVRGFDKNEAEDQ  478

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSL  472
            IRS+LE HF SCG+I  TRIPTDPEGYIKGMAYIEFA  D D ++KALEL+ S++G  +L
Sbjct  479  IRSSLEEHFASCGKIFKTRIPTDPEGYIKGMAYIEFANGDGDTLNKALELDGSEVGGYNL  538

Query  471  YVDEAKP  451
             V EAKP
Sbjct  539  TVQEAKP  545



>gb|EYU35586.1| hypothetical protein MIMGU_mgv1a002998mg [Erythranthe guttata]
Length=617

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 92/131 (70%), Gaps = 11/131 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ++NGQ+LL R+V+L  A+ERG   AYTPNSG          R   +  T+FV+GFD  + 
Sbjct  419  QMNGQELLNREVRLDFARERGERPAYTPNSGG--------PRSQSQGPTLFVKGFDTRNG  470

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            ED IRS+LE HFG+CGEI    +PTDPEG +KG+AYI F DN+A +KALELN S+ G+ S
Sbjct  471  EDQIRSSLEEHFGTCGEITRVSLPTDPEGGVKGIAYINFKDNNAFNKALELNGSEFGNGS  530

Query  474  LYVDEAKPRND  442
            L VDEAKPR D
Sbjct  531  LTVDEAKPRFD  541



>ref|XP_011070437.1| PREDICTED: nucleolin 1-like [Sesamum indicum]
Length=599

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG++LL R V+L  A+ERGA TP SG  D  S ++     +  T+FVRGF+K D+ED 
Sbjct  402  ELNGEELLGRSVRLDLARERGANTPYSGGKDTQSFQKGGRA-QGQTIFVRGFNKYDSEDQ  460

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            IRS+LE HFGSCGEI    IP D +G +KGMAY++F D++   +ALELN S+ G S+L V
Sbjct  461  IRSSLEEHFGSCGEITRVSIPKDQDGAVKGMAYLDFKDSNGFKQALELNGSEFGESTLSV  520

Query  465  DEAKPRND  442
            +EA+PR D
Sbjct  521  EEARPRGD  528



>ref|XP_004505721.1| PREDICTED: nucleolin 2-like isoform X2 [Cicer arietinum]
Length=613

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 88/127 (69%), Gaps = 9/127 (7%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ERGA+TPNS              G+S TVFVRGFDK+  ED 
Sbjct  423  ELNGQDLLNRAVRLDLARERGAFTPNSAP--------RGPRGQSQTVFVRGFDKSQGEDE  474

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++LE HF SCGEI    IP D   GY+KG AY++F D+D++ KALEL+ S+LG  +L 
Sbjct  475  IRASLEEHFSSCGEITRVSIPKDYDSGYVKGFAYMDFKDSDSLGKALELHESELGGYTLS  534

Query  468  VDEAKPR  448
            VDEAKPR
Sbjct  535  VDEAKPR  541



>ref|XP_004505720.1| PREDICTED: nucleolin 2-like isoform X1 [Cicer arietinum]
Length=615

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 88/127 (69%), Gaps = 9/127 (7%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ERGA+TPNS              G+S TVFVRGFDK+  ED 
Sbjct  423  ELNGQDLLNRAVRLDLARERGAFTPNSAP--------RGPRGQSQTVFVRGFDKSQGEDE  474

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++LE HF SCGEI    IP D   GY+KG AY++F D+D++ KALEL+ S+LG  +L 
Sbjct  475  IRASLEEHFSSCGEITRVSIPKDYDSGYVKGFAYMDFKDSDSLGKALELHESELGGYTLS  534

Query  468  VDEAKPR  448
            VDEAKPR
Sbjct  535  VDEAKPR  541



>ref|XP_002307174.1| nucleolin family protein [Populus trichocarpa]
 gb|EEE94170.1| nucleolin family protein [Populus trichocarpa]
Length=660

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
             NG+ LL RDV+L  A+ERG  T N+    +S+  Q  G G+S T+FV+GFDK   ED I
Sbjct  450  FNGKSLLGRDVRLDLARERGERTSNTPYSKDSNSFQKGGRGQSQTIFVKGFDKFGAEDEI  509

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            RS+L+ HFGSCGEI    IPTD E G IKGMAY+EF D DAM+KA ELN SQLG S L V
Sbjct  510  RSSLQEHFGSCGEISRISIPTDYETGAIKGMAYLEFNDADAMNKAFELNGSQLGESYLTV  569

Query  465  DEAKPRND  442
            DEAKPR D
Sbjct  570  DEAKPRTD  577



>ref|XP_006380517.1| hypothetical protein POPTR_0007s07800g [Populus trichocarpa]
 gb|ERP58314.1| hypothetical protein POPTR_0007s07800g [Populus trichocarpa]
Length=548

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +L+G  LL RDV+L  A+E+G+ TP S    +SS     G G+S T+FVRGFDK+  ED 
Sbjct  356  KLHGNTLLGRDVRLDLAREKGSNTPYS---KDSSSFPKGGSGQSQTIFVRGFDKSAGEDE  412

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA+SKA ELN SQLG   L 
Sbjct  413  IRSSLQEHFGSCGEIKRVSIPTDYDTGAIKGMAYLEFNDADALSKAFELNGSQLGEYRLT  472

Query  468  VDEAKPRND  442
            VDEAKPR+D
Sbjct  473  VDEAKPRSD  481



>gb|ABK94939.1| unknown [Populus trichocarpa]
Length=590

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +L+G  LL RDV+L  A+E+G+ TP S    +SS     G G+S T+FVRGFDK+  ED 
Sbjct  398  KLHGNTLLGRDVRLDLAREKGSNTPYS---KDSSSFPKGGSGQSQTIFVRGFDKSAGEDE  454

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA+SKA ELN SQLG   L 
Sbjct  455  IRSSLQEHFGSCGEIKRVSIPTDYDTGAIKGMAYLEFNDADALSKAFELNGSQLGEYCLT  514

Query  468  VDEAKPRND  442
            VDEAKPR+D
Sbjct  515  VDEAKPRSD  523



>ref|XP_006380518.1| hypothetical protein POPTR_0007s07800g [Populus trichocarpa]
 gb|ERP58315.1| hypothetical protein POPTR_0007s07800g [Populus trichocarpa]
Length=590

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +L+G  LL RDV+L  A+E+G+ TP S    +SS     G G+S T+FVRGFDK+  ED 
Sbjct  398  KLHGNTLLGRDVRLDLAREKGSNTPYS---KDSSSFPKGGSGQSQTIFVRGFDKSAGEDE  454

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA+SKA ELN SQLG   L 
Sbjct  455  IRSSLQEHFGSCGEIKRVSIPTDYDTGAIKGMAYLEFNDADALSKAFELNGSQLGEYRLT  514

Query  468  VDEAKPRND  442
            VDEAKPR+D
Sbjct  515  VDEAKPRSD  523



>ref|XP_011008909.1| PREDICTED: nucleolin 2 isoform X2 [Populus euphratica]
Length=582

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +L+G+ LL RDV+L  A+E+G+ TP S    +S+  Q  G G+S T+FV+GFDK+  ED 
Sbjct  398  KLHGKTLLGRDVRLDLAREKGSNTPYS---KDSNSFQKGGSGQSQTIFVKGFDKSAGEDE  454

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA++KA ELN SQLG   L 
Sbjct  455  IRSSLQEHFGSCGEIKRISIPTDYDTGAIKGMAYLEFNDADALNKAFELNGSQLGECYLT  514

Query  468  VDEAKPRND  442
            VDEAKPRND
Sbjct  515  VDEAKPRND  523



>ref|XP_011008908.1| PREDICTED: nucleolin 1 isoform X1 [Populus euphratica]
Length=594

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +L+G+ LL RDV+L  A+E+G+ TP S    +S+  Q  G G+S T+FV+GFDK+  ED 
Sbjct  398  KLHGKTLLGRDVRLDLAREKGSNTPYS---KDSNSFQKGGSGQSQTIFVKGFDKSAGEDE  454

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEIK   IPTD + G IKGMAY+EF D DA++KA ELN SQLG   L 
Sbjct  455  IRSSLQEHFGSCGEIKRISIPTDYDTGAIKGMAYLEFNDADALNKAFELNGSQLGECYLT  514

Query  468  VDEAKPRND  442
            VDEAKPRND
Sbjct  515  VDEAKPRND  523



>ref|XP_009383653.1| PREDICTED: nucleolin 2-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=628

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+L  R V+L  A+ERG+YTPN+G  DN S ++   G +S T+FVRGFDK+  ED 
Sbjct  430  EMNGQELFGRAVRLDVARERGSYTPNNGK-DNYSHQKGGTG-QSQTIFVRGFDKSLEEDQ  487

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCGE+    IP D E G  KG+AY++F D DA ++ALELN S+LG  +L 
Sbjct  488  IRSSLEEHFGSCGELTRVSIPKDYESGASKGIAYMDFKDQDAFTQALELNGSELGGYTLT  547

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  548  VDEAKPRGD  556



>ref|XP_009383652.1| PREDICTED: nucleolin 2-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+L  R V+L  A+ERG+YTPN+G  DN S ++   G +S T+FVRGFDK+  ED 
Sbjct  430  EMNGQELFGRAVRLDVARERGSYTPNNGK-DNYSHQKGGTG-QSQTIFVRGFDKSLEEDQ  487

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCGE+    IP D E G  KG+AY++F D DA ++ALELN S+LG  +L 
Sbjct  488  IRSSLEEHFGSCGELTRVSIPKDYESGASKGIAYMDFKDQDAFTQALELNGSELGGYTLT  547

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  548  VDEAKPRGD  556



>ref|XP_011022060.1| PREDICTED: nucleolin 1-like isoform X2 [Populus euphratica]
Length=636

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
             NG+ LL RDV+L  A+ERG  + N+    +S+  Q  G G+S T+FV+GFDK   ED I
Sbjct  437  FNGKSLLGRDVRLDLARERGDRSSNTPYSKDSNSFQKGGRGQSQTIFVKGFDKFCGEDEI  496

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            RS+L+ HFGSCGEI    IPTD E G IKGMAY+EF D DAM+KA ELN SQLG S L V
Sbjct  497  RSSLQEHFGSCGEITRISIPTDYETGAIKGMAYLEFNDADAMNKAFELNGSQLGESYLTV  556

Query  465  DEAKPRND  442
            DEAKPRND
Sbjct  557  DEAKPRND  564



>ref|XP_011022059.1| PREDICTED: nucleolin 1-like isoform X1 [Populus euphratica]
Length=673

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
             NG+ LL RDV+L  A+ERG  + N+    +S+  Q  G G+S T+FV+GFDK   ED I
Sbjct  474  FNGKSLLGRDVRLDLARERGDRSSNTPYSKDSNSFQKGGRGQSQTIFVKGFDKFCGEDEI  533

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            RS+L+ HFGSCGEI    IPTD E G IKGMAY+EF D DAM+KA ELN SQLG S L V
Sbjct  534  RSSLQEHFGSCGEITRISIPTDYETGAIKGMAYLEFNDADAMNKAFELNGSQLGESYLTV  593

Query  465  DEAKPRND  442
            DEAKPRND
Sbjct  594  DEAKPRND  601



>ref|XP_009420546.1| PREDICTED: nucleolin 2-like [Musa acuminata subsp. malaccensis]
Length=728

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+L  R V+L  A+ERGAYTP SG    +   Q    G S T+FVRGFDK+  ED 
Sbjct  531  EMNGQELFGRAVRLDVARERGAYTPQSG--RENYSYQKGSKGNSQTIFVRGFDKSLEEDQ  588

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCG++    IP D E G  KG+AY++F D DA S+ALELN S+LG  +L 
Sbjct  589  IRSSLEEHFGSCGDVTRVSIPRDYESGASKGIAYMDFKDQDAFSQALELNGSELGGYTLT  648

Query  468  VDEAKPRND  442
            V+EAKPR+D
Sbjct  649  VEEAKPRSD  657



>ref|XP_003581679.1| PREDICTED: nucleolin 2-like [Brachypodium distachyon]
Length=741

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG DL+ R V+L  A+ERGAYTP SG  DNSS ++      S T F+RGFD +  ED 
Sbjct  531  ELNGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPGQSS-SNTAFIRGFDASLGEDQ  588

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEI    IP D E G  KG+AY+EF+D  ++SKA EL+ S LG  SLY
Sbjct  589  IRSSLQKHFGSCGEITRVSIPKDYETGASKGIAYMEFSDQSSLSKAFELSGSDLGGFSLY  648

Query  468  VDEAKPRND  442
            VDEA+P+ D
Sbjct  649  VDEARPKQD  657



>ref|XP_010909800.1| PREDICTED: nucleolin 2-like [Elaeis guineensis]
Length=686

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG +LL R V+L  A ERGAYTP SG   NS Q+  +G   S T+FV+GFDK   ED 
Sbjct  502  ELNGMELLGRAVRLDVAHERGAYTPYSGKESNSYQKGGKG--PSYTIFVKGFDKFVEEDQ  559

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG  SL 
Sbjct  560  IRSSLEEHFGSCGEITRLSLPKDYETGAFKGMAYMDFREQDAFSKALELDGSELGGYSLT  619

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  620  VDEAKPRGD  628



>ref|XP_010549154.1| PREDICTED: nucleolin 1 [Tarenaya hassleriana]
Length=610

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 89/126 (71%), Gaps = 4/126 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQ LL R+V+L  A+E+GAYTP SG  +N          + TTVFV+GFD + +ED 
Sbjct  407  ELNGQSLLGREVRLDLAREKGAYTPQSGKTNNFQSGGRG---QGTTVFVKGFDYSLSEDE  463

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RSAL+ HFG CGEI    +PTD E G +KG AY++  D++AM+KALELN S++G  +L 
Sbjct  464  VRSALKDHFGGCGEINRISVPTDRETGSVKGFAYMDVKDSEAMNKALELNGSEMGGYNLT  523

Query  468  VDEAKP  451
            VDEA+P
Sbjct  524  VDEAQP  529



>ref|XP_004972658.1| PREDICTED: nucleolin 1-like [Setaria italica]
Length=567

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E++G+++  R V+L  A+ER AYTP SG  +++   Q    G S++VF+RGFDKN  ED 
Sbjct  361  EMSGKEMQGRAVRLDFAQERNAYTPRSG--NDTGSFQKPVRGASSSVFIRGFDKNLEEDK  418

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFG CGEI    IPTD E G +KG+AY++F D D+MSKALEL+ S +G   L+
Sbjct  419  IRSSLEQHFGECGEITRVSIPTDYETGAVKGIAYLDFKDQDSMSKALELSGSDIGGYELF  478

Query  468  VDEAKPR  448
            VDEAKP+
Sbjct  479  VDEAKPK  485



>ref|XP_008787581.1| PREDICTED: nucleolin 2-like isoform X5 [Phoenix dactylifera]
Length=676

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NG +LL R V+L  A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+  ED 
Sbjct  472  EMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKSPEEDQ  529

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG  SL 
Sbjct  530  IRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELGGYSLT  589

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  590  VDEAKPRGD  598



>ref|XP_008787580.1| PREDICTED: nucleolin 2-like isoform X4 [Phoenix dactylifera]
Length=678

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NG +LL R V+L  A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+  ED 
Sbjct  474  EMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKSPEEDQ  531

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG  SL 
Sbjct  532  IRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELGGYSLT  591

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  592  VDEAKPRGD  600



>ref|XP_010249944.1| PREDICTED: nucleolin 2-like isoform X3 [Nelumbo nucifera]
Length=683

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ER +YTP SG  ++S Q+  +   +  T++VRGFDK+  ED 
Sbjct  490  ELNGQDLLGRSVRLDLARERNSYTPYSGKENSSYQKGGKS--QGQTIYVRGFDKSGGEDQ  547

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS LE HFGSCGEI    IP D   G  KG+AYIEF D D+ SKALELN S+LG  SL 
Sbjct  548  IRSTLEEHFGSCGEITRMSIPKDFDSGAPKGIAYIEFGDGDSFSKALELNGSELGDYSLT  607

Query  468  VDEAKP  451
            V+EA+P
Sbjct  608  VEEARP  613



>ref|XP_008787578.1| PREDICTED: nucleolin 2-like isoform X2 [Phoenix dactylifera]
Length=719

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NG +LL R V+L  A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+  ED 
Sbjct  515  EMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKSPEEDQ  572

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG  SL 
Sbjct  573  IRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELGGYSLT  632

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  633  VDEAKPRGD  641



>ref|XP_008787577.1| PREDICTED: nucleolin 2-like isoform X1 [Phoenix dactylifera]
Length=721

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NG +LL R V+L  A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+  ED 
Sbjct  517  EMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKSPEEDQ  574

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG  SL 
Sbjct  575  IRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELGGYSLT  634

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  635  VDEAKPRGD  643



>ref|XP_008787579.1| PREDICTED: nucleolin 2-like isoform X3 [Phoenix dactylifera]
Length=712

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NG +LL R V+L  A  RGAYTP SG   NS ++  +G   S T+FV+GFDK+  ED 
Sbjct  508  EMNGMELLGRAVRLDVANGRGAYTPYSGKDGNSYEKAGKG--PSYTIFVKGFDKSPEEDQ  565

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG  SL 
Sbjct  566  IRSSLQEHFGSCGEITRVSLPKDYETGAFKGMAYMDFGEQDAFSKALELDGSELGGYSLT  625

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  626  VDEAKPRGD  634



>ref|XP_010249927.1| PREDICTED: nucleolin 2-like isoform X1 [Nelumbo nucifera]
Length=757

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ER +YTP SG  ++S Q+  +   +  T++VRGFDK+  ED 
Sbjct  564  ELNGQDLLGRSVRLDLARERNSYTPYSGKENSSYQKGGKS--QGQTIYVRGFDKSGGEDQ  621

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS LE HFGSCGEI    IP D   G  KG+AYIEF D D+ SKALELN S+LG  SL 
Sbjct  622  IRSTLEEHFGSCGEITRMSIPKDFDSGAPKGIAYIEFGDGDSFSKALELNGSELGDYSLT  681

Query  468  VDEAKP  451
            V+EA+P
Sbjct  682  VEEARP  687



>ref|XP_010249935.1| PREDICTED: nucleolin 2-like isoform X2 [Nelumbo nucifera]
Length=756

 Score =   130 bits (326),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ER +YTP SG  ++S Q+  +   +  T++VRGFDK+  ED 
Sbjct  563  ELNGQDLLGRSVRLDLARERNSYTPYSGKENSSYQKGGKS--QGQTIYVRGFDKSGGEDQ  620

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS LE HFGSCGEI    IP D   G  KG+AYIEF D D+ SKALELN S+LG  SL 
Sbjct  621  IRSTLEEHFGSCGEITRMSIPKDFDSGAPKGIAYIEFGDGDSFSKALELNGSELGDYSLT  680

Query  468  VDEAKP  451
            V+EA+P
Sbjct  681  VEEARP  686



>gb|EPS65245.1| tobacco nucleolin, partial [Genlisea aurea]
Length=494

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+DLL R+V+L  AKERG YTP SG         S       T FVRGFD N+ E  
Sbjct  315  ELNGKDLLGREVRLDLAKERGQYTPQSG-------DASSFQKGGKTAFVRGFDINNDEAQ  367

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            I+ +LE HF SCGE+    +P D EG  KGMAYI+F D DA+ KALE+N S  G++SL V
Sbjct  368  IKGSLEEHFTSCGEVTRISLPKDQEGNFKGMAYIDFKDGDALEKALEMNGSDFGNASLMV  427

Query  465  DEAKP  451
            +EA+P
Sbjct  428  EEARP  432



>emb|CBI27136.3| unnamed protein product [Vitis vinifera]
Length=691

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ++NG+DLL R V+L  A+ERGAYTP SG   NS Q+      ++ T+FVRGFDK+  ED 
Sbjct  506  KMNGKDLLGRAVRLDLARERGAYTPYSGKESNSFQKGGS---QAQTIFVRGFDKSGDEDQ  562

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS LE +FGSCG+I    IP D E G +KG+AY++F D D+ +KALELN ++LG  +L 
Sbjct  563  VRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSFNKALELNGTELGGYTLN  622

Query  468  VDEAKPR  448
            V+EAKPR
Sbjct  623  VEEAKPR  629



>ref|XP_006659905.1| PREDICTED: nucleolin 1-like, partial [Oryza brachyantha]
Length=597

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 87/131 (66%), Gaps = 11/131 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNS----GAFDNssqrqsrggGESTTVFVRGFDKND  658
            ELNGQDL+ R V+L  A+ERGAYTP+S    G+F   ++        S ++FV+GFD + 
Sbjct  401  ELNGQDLMGRAVRLDLARERGAYTPHSRNDTGSFQKQNRGS------SQSIFVKGFDSSL  454

Query  657  TEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGH  481
             E  IR +LEGHF  CGEI    +P D E G  +GMAYI+F D  ++SKALEL+ S LG 
Sbjct  455  EESKIRESLEGHFAECGEITRVSVPMDRETGACRGMAYIDFKDQASLSKALELSGSDLGG  514

Query  480  SSLYVDEAKPR  448
             +LYVDEA+PR
Sbjct  515  YNLYVDEARPR  525



>ref|XP_007043310.1| Nucleolin like 2 isoform 4, partial [Theobroma cacao]
 gb|EOX99141.1| Nucleolin like 2 isoform 4, partial [Theobroma cacao]
Length=487

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP SG  +NS Q+  R   ++ T+FV+GFD++  ED 
Sbjct  290  ELNGEYLMNRSLRLDLARERGAYTPYSGNGNNSFQKGGRS--QTQTIFVKGFDQSLGEDE  347

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCGEI    IP D E G +KG AY++F D D+ +KALEL+ S+L + SL 
Sbjct  348  IRSSLEEHFGSCGEISRVAIPVDRETGGVKGYAYLDFNDGDSFNKALELDGSELSNYSLS  407

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  408  VDEAKPRGE  416



>ref|XP_010535330.1| PREDICTED: nucleolin 1-like isoform X2 [Tarenaya hassleriana]
Length=610

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 90/127 (71%), Gaps = 5/127 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKER-GAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTED  649
            +LNGQDLL R+V+L  A+ER  +YTP SG  +N          + +TVF++GFD + TED
Sbjct  409  QLNGQDLLGREVRLDLARERDSSYTPQSGKSNNFQSGGRG---QGSTVFIKGFDYSLTED  465

Query  648  NIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
            +IRSAL+ HFGSCGEI    +PTD E G IKG AY++  D++ M+KALELN S++G  +L
Sbjct  466  DIRSALKEHFGSCGEITRISVPTDRETGNIKGFAYMDVKDSETMNKALELNGSEMGGYNL  525

Query  471  YVDEAKP  451
             VDEA+P
Sbjct  526  TVDEARP  532



>ref|XP_010535329.1| PREDICTED: nucleolin 1-like isoform X1 [Tarenaya hassleriana]
Length=611

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 90/127 (71%), Gaps = 5/127 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKER-GAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTED  649
            +LNGQDLL R+V+L  A+ER  +YTP SG  +N          + +TVF++GFD + TED
Sbjct  410  QLNGQDLLGREVRLDLARERDSSYTPQSGKSNNFQSGGRG---QGSTVFIKGFDYSLTED  466

Query  648  NIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
            +IRSAL+ HFGSCGEI    +PTD E G IKG AY++  D++ M+KALELN S++G  +L
Sbjct  467  DIRSALKEHFGSCGEITRISVPTDRETGNIKGFAYMDVKDSETMNKALELNGSEMGGYNL  526

Query  471  YVDEAKP  451
             VDEA+P
Sbjct  527  TVDEARP  533



>gb|EAZ32021.1| hypothetical protein OsJ_16200 [Oryza sativa Japonica Group]
Length=728

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL G DL+ R V+L  A+ERGAYTP SG  DNSS ++        T+F++GFD +     
Sbjct  528  ELAGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPAQSS-GNTIFIKGFDTSLDIHQ  585

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++LE HFGSCGEI    IP D E G  KGMAY++FADN ++SKA ELN S LG  SLY
Sbjct  586  IRNSLEEHFGSCGEITRVSIPKDYETGASKGMAYMDFADNGSLSKAYELNGSDLGGYSLY  645

Query  468  VDEAKPRND  442
            VDEA+PR D
Sbjct  646  VDEARPRPD  654



>ref|XP_010910016.1| PREDICTED: nucleolin 2-like [Elaeis guineensis]
Length=848

 Score =   126 bits (317),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 75/129 (58%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG +LL R V+L  A ERG YTP SG   NS Q+  +G   S T+FV+GFDK+  ED 
Sbjct  656  ELNGMELLGRAVRLDVAHERGVYTPYSGKEGNSYQKGGKGL--SYTIFVKGFDKSVEEDQ  713

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCGEI    +P D E G  KGMAY++F + DA SKALEL+ S+LG  SL 
Sbjct  714  IRSSLEEHFGSCGEITRLSLPKDYETGAFKGMAYMDFREQDAFSKALELDGSELGGYSLT  773

Query  468  VDEAKPRND  442
            V+EAKPR D
Sbjct  774  VNEAKPRGD  782



>ref|NP_001053909.1| Os04g0620700 [Oryza sativa Japonica Group]
 sp|Q7XTT4.2|NUCL2_ORYSJ RecName: Full=Nucleolin 2; AltName: Full=Protein NUCLEOLIN LIKE 
2 [Oryza sativa Japonica Group]
 emb|CAD41755.2| OSJNBa0058K23.21 [Oryza sativa Japonica Group]
 dbj|BAF15823.1| Os04g0620700 [Oryza sativa Japonica Group]
 dbj|BAG96085.1| unnamed protein product [Oryza sativa Japonica Group]
Length=707

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL G DL+ R V+L  A+ERGAYTP SG  DNSS ++        T+F++GFD +     
Sbjct  507  ELAGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPAQSS-GNTIFIKGFDTSLDIHQ  564

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++LE HFGSCGEI    IP D E G  KGMAY++FADN ++SKA ELN S LG  SLY
Sbjct  565  IRNSLEEHFGSCGEITRVSIPKDYETGASKGMAYMDFADNGSLSKAYELNGSDLGGYSLY  624

Query  468  VDEAKPRND  442
            VDEA+PR D
Sbjct  625  VDEARPRPD  633



>emb|CAH66982.1| H0714H04.9 [Oryza sativa Indica Group]
Length=704

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL G DL+ R V+L  A+ERGAYTP SG  DNSS ++        T+F++GFD +     
Sbjct  504  ELAGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPAQSS-GNTIFIKGFDTSLDIHQ  561

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++LE HFGSCGEI    IP D E G  KGMAY++FADN ++SKA ELN S LG  SLY
Sbjct  562  IRNSLEEHFGSCGEITRVSIPRDYETGASKGMAYMDFADNGSLSKAYELNGSDLGGYSLY  621

Query  468  VDEAKPRND  442
            VDEA+PR D
Sbjct  622  VDEARPRPD  630



>ref|XP_004982918.1| PREDICTED: nucleolin 2-like isoform X2 [Setaria italica]
Length=674

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E    DL+ R V++  A ERGAYTP SG  DNSS ++        TVF++GFD +  ED 
Sbjct  474  EFANHDLMGRPVRVDLALERGAYTPGSGR-DNSSFKKFAPRS-GNTVFIKGFDTSSGEDQ  531

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRSALEG FGSCGEI    IP D E G  KGMAY++F D D+++KA ELN S LG  SLY
Sbjct  532  IRSALEGLFGSCGEITRVSIPKDYETGACKGMAYMDFKDPDSLNKAYELNGSDLGGYSLY  591

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  592  VDEAKPRPD  600



>ref|XP_004982917.1| PREDICTED: nucleolin 2-like isoform X1 [Setaria italica]
Length=679

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E    DL+ R V++  A ERGAYTP SG  DNSS ++        TVF++GFD +  ED 
Sbjct  474  EFANHDLMGRPVRVDLALERGAYTPGSGR-DNSSFKKFAPRS-GNTVFIKGFDTSSGEDQ  531

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRSALEG FGSCGEI    IP D E G  KGMAY++F D D+++KA ELN S LG  SLY
Sbjct  532  IRSALEGLFGSCGEITRVSIPKDYETGACKGMAYMDFKDPDSLNKAYELNGSDLGGYSLY  591

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  592  VDEAKPRPD  600



>ref|XP_007043309.1| Nucleolin like 2 isoform 3 [Theobroma cacao]
 gb|EOX99140.1| Nucleolin like 2 isoform 3 [Theobroma cacao]
Length=698

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP SG  +NS Q+  R   ++ T+FV+GFD++  ED 
Sbjct  501  ELNGEYLMNRSLRLDLARERGAYTPYSGNGNNSFQKGGRS--QTQTIFVKGFDQSLGEDE  558

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCGEI    IP D E G +KG AY++F D D+ +KALEL+ S+L + SL 
Sbjct  559  IRSSLEEHFGSCGEISRVAIPVDRETGGVKGYAYLDFNDGDSFNKALELDGSELSNYSLS  618

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  619  VDEAKPRGE  627



>ref|XP_006652843.1| PREDICTED: nucleolin 2-like [Oryza brachyantha]
Length=712

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 85/129 (66%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E  G DL+ R VKL  A+ERGAYTP  G+  ++S  +        T+F++GFD     D 
Sbjct  514  EFAGHDLMGRPVKLDLARERGAYTP--GSERDNSSFKKPAQSSGNTIFIKGFDTTLGIDQ  571

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++LE HFG+CGEI    IP D + G  KGMAY++FADN A+SKA ELN S LG  SLY
Sbjct  572  IRTSLEEHFGTCGEITRVSIPKDYDTGASKGMAYMDFADNGALSKAFELNGSDLGGYSLY  631

Query  468  VDEAKPRND  442
            VDEA+PR D
Sbjct  632  VDEARPRPD  640



>ref|XP_007043307.1| Nucleolin like 2 isoform 1 [Theobroma cacao]
 gb|EOX99138.1| Nucleolin like 2 isoform 1 [Theobroma cacao]
Length=726

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP SG  +NS Q+  R   ++ T+FV+GFD++  ED 
Sbjct  529  ELNGEYLMNRSLRLDLARERGAYTPYSGNGNNSFQKGGRS--QTQTIFVKGFDQSLGEDE  586

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCGEI    IP D E G +KG AY++F D D+ +KALEL+ S+L + SL 
Sbjct  587  IRSSLEEHFGSCGEISRVAIPVDRETGGVKGYAYLDFNDGDSFNKALELDGSELSNYSLS  646

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  647  VDEAKPRGE  655



>ref|XP_010648403.1| PREDICTED: nucleolin 2 isoform X2 [Vitis vinifera]
Length=708

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ++NG+DLL R V+L  A+ERGAYTP SG   NS Q+      ++ T+FVRGFDK+  ED 
Sbjct  504  KMNGKDLLGRAVRLDLARERGAYTPYSGKESNSFQKGGS---QAQTIFVRGFDKSGDEDQ  560

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS LE +FGSCG+I    IP D E G +KG+AY++F D D+ +KALELN ++LG  +L 
Sbjct  561  VRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSFNKALELNGTELGGYTLN  620

Query  468  VDEAKP  451
            V+EAKP
Sbjct  621  VEEAKP  626



>ref|XP_007043308.1| Nucleolin like 2 isoform 2 [Theobroma cacao]
 gb|EOX99139.1| Nucleolin like 2 isoform 2 [Theobroma cacao]
Length=697

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP SG  +NS Q+  R   ++ T+FV+GFD++  ED 
Sbjct  500  ELNGEYLMNRSLRLDLARERGAYTPYSGNGNNSFQKGGRS--QTQTIFVKGFDQSLGEDE  557

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+LE HFGSCGEI    IP D E G +KG AY++F D D+ +KALEL+ S+L + SL 
Sbjct  558  IRSSLEEHFGSCGEISRVAIPVDRETGGVKGYAYLDFNDGDSFNKALELDGSELSNYSLS  617

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  618  VDEAKPRGE  626



>ref|XP_010648398.1| PREDICTED: nucleolin 2 isoform X1 [Vitis vinifera]
Length=710

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ++NG+DLL R V+L  A+ERGAYTP SG   NS Q+      ++ T+FVRGFDK+  ED 
Sbjct  506  KMNGKDLLGRAVRLDLARERGAYTPYSGKESNSFQKGGS---QAQTIFVRGFDKSGDEDQ  562

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS LE +FGSCG+I    IP D E G +KG+AY++F D D+ +KALELN ++LG  +L 
Sbjct  563  VRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSFNKALELNGTELGGYTLN  622

Query  468  VDEAKP  451
            V+EAKP
Sbjct  623  VEEAKP  628



>ref|XP_010648407.1| PREDICTED: nucleolin 1 isoform X3 [Vitis vinifera]
Length=699

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ++NG+DLL R V+L  A+ERGAYTP SG   NS Q+      ++ T+FVRGFDK+  ED 
Sbjct  495  KMNGKDLLGRAVRLDLARERGAYTPYSGKESNSFQKGGS---QAQTIFVRGFDKSGDEDQ  551

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS LE +FGSCG+I    IP D E G +KG+AY++F D D+ +KALELN ++LG  +L 
Sbjct  552  VRSTLEEYFGSCGDISRISIPKDYESGSVKGIAYMDFTDGDSFNKALELNGTELGGYTLN  611

Query  468  VDEAKP  451
            V+EAKP
Sbjct  612  VEEAKP  617



>dbj|BAJ99185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=724

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 88/129 (68%), Gaps = 5/129 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG DL  R V+L  A+ERGA TP SG  DNSS ++S    +S T FVRGFD +  ED 
Sbjct  523  ELNGHDLSGRPVRLDFARERGAITPGSGR-DNSSFKKSG---QSNTAFVRGFDSSLGEDE  578

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HF SCG I    IP D E G  KG+AY+EF D +++ KALELN S +G  SL+
Sbjct  579  IRSSLQEHFSSCGAIGRVSIPKDYETGTSKGIAYVEFTDGNSLPKALELNGSNIGEFSLF  638

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  639  VDEAKPRAD  647



>gb|AAA74208.1| protein localized in the nucleoli of pea nuclei; ORF; putative 
[Pisum sativum]
Length=611

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 86/127 (68%), Gaps = 7/127 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQ+LL R V+L  A+ERGA+TPNS    NS +       +S TVFVRGFDK+  ED 
Sbjct  413  ELNGQELLQRGVRLDLARERGAFTPNSTGNQNSGRG------QSQTVFVRGFDKSLGEDE  466

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR+ LE HF SCG+     IP D + GY KG AY++F D+D+ +KA+EL+ S+L    L 
Sbjct  467  IRAKLEQHFASCGQASRVSIPKDYDTGYSKGFAYMDFKDSDSFNKAIELHGSELDGYPLS  526

Query  468  VDEAKPR  448
            +DEAKPR
Sbjct  527  IDEAKPR  533


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  463
            RS +E  F  CGE+   R+ +D +G  KG  ++EFA  +A   ALELN  +L    + +D
Sbjct  368  RSDIESFFQECGEVVDVRLASDEDGRFKGFGHVEFATAEAAQSALELNGQELLQRGVRLD  427

Query  462  EAKPR  448
             A+ R
Sbjct  428  LARER  432



>ref|XP_006592048.1| PREDICTED: nucleolin 2-like isoform X3 [Glycine max]
Length=585

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            LNGQ L  R+++L  A+ERGAYTPNS     ++  Q  G G+S TVFVRGFD +  ED I
Sbjct  374  LNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSGRGQSQTVFVRGFDTSLGEDEI  431

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R +L+ HFGSCG+I    IP D E G +KG AY++F+D D+M KALEL+ ++LG  +L V
Sbjct  432  RGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGYTLTV  491

Query  465  DEAKPRND  442
            DEAKPR++
Sbjct  492  DEAKPRDN  499



>ref|XP_006592047.1| PREDICTED: nucleolin 2-like isoform X2 [Glycine max]
Length=666

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            LNGQ L  R+++L  A+ERGAYTPNS     ++  Q  G G+S TVFVRGFD +  ED I
Sbjct  455  LNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSGRGQSQTVFVRGFDTSLGEDEI  512

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R +L+ HFGSCG+I    IP D E G +KG AY++F+D D+M KALEL+ ++LG  +L V
Sbjct  513  RGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGYTLTV  572

Query  465  DEAKPRND  442
            DEAKPR++
Sbjct  573  DEAKPRDN  580



>ref|XP_003540672.1| PREDICTED: nucleolin 2-like isoform X1 [Glycine max]
Length=744

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            LNGQ L  R+++L  A+ERGAYTPNS     ++  Q  G G+S TVFVRGFD +  ED I
Sbjct  533  LNGQQLFNRELRLDLARERGAYTPNSSN--WNNSSQKSGRGQSQTVFVRGFDTSLGEDEI  590

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R +L+ HFGSCG+I    IP D E G +KG AY++F+D D+M KALEL+ ++LG  +L V
Sbjct  591  RGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGYTLTV  650

Query  465  DEAKPRND  442
            DEAKPR++
Sbjct  651  DEAKPRDN  658



>gb|KEH30577.1| RNA recognition motif [Medicago truncatula]
Length=600

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+LL R V+L  A+ERGA+TPN+   +++   QS G G+S TVFVRGFDKN  ED 
Sbjct  399  EMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGFDKNLGEDE  455

Query  645  IRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
            IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ S+L    L
Sbjct  456  IRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHESELDGYQL  515

Query  471  YVDEAKPRN  445
             VDEAKPR+
Sbjct  516  SVDEAKPRD  524


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 15/119 (13%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGA--FDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEG  625
            +DV++  A + G   PN+ A   +NS          S T+FV     N +    RS +E 
Sbjct  313  KDVEMVDAGKSGKKAPNTPATPIENSG---------SKTLFVG----NLSFSVQRSDIEK  359

Query  624  HFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
             F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D A+ R
Sbjct  360  FFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLDLARER  418



>gb|KEH30578.1| RNA recognition motif [Medicago truncatula]
Length=588

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+LL R V+L  A+ERGA+TPN+   +++   QS G G+S TVFVRGFDKN  ED 
Sbjct  387  EMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGFDKNLGEDE  443

Query  645  IRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
            IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ S+L    L
Sbjct  444  IRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHESELDGYQL  503

Query  471  YVDEAKPRN  445
             VDEAKPR+
Sbjct  504  SVDEAKPRD  512


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 15/119 (13%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGA--FDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEG  625
            +DV++  A + G   PN+ A   +NS          S T+FV     N +    RS +E 
Sbjct  301  KDVEMVDAGKSGKKAPNTPATPIENSG---------SKTLFVG----NLSFSVQRSDIEK  347

Query  624  HFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
             F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D A+ R
Sbjct  348  FFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLDLARER  406



>gb|KHN05443.1| Protein gar2 [Glycine soja]
Length=790

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            LNGQ L  R+++L  A+ERGAYTPNS   + ++  Q  G G+S TVFVRGFD +  ED I
Sbjct  533  LNGQQLFNRELRLDLARERGAYTPNS--SNWNNSSQKSGRGQSQTVFVRGFDTSLGEDEI  590

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R +L+ HFGSCG+I    IP D E G +KG AY++F+D D+M KALEL+ ++LG  +L V
Sbjct  591  RGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGYTLTV  650

Query  465  DEAKPRND  442
            DEAKPR++
Sbjct  651  DEAKPRDN  658



>gb|KJB79882.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=930

 Score =   122 bits (307),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 67/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG+ +NS Q+  RG  ++ T++VRGFD++ ++D 
Sbjct  730  ELNGEYLMNRSLRLDLARERGAYTPSSGSGNNSFQKGGRG--QARTIYVRGFDQSLSQDE  787

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  788  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  847

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  848  VDEAKPRGE  856



>gb|KHG07971.1| Protein gar2 [Gossypium arboreum]
Length=639

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R V+L  A+ERGAYTP SG  +NS Q+  +G  +S T+FV+G D +  ED 
Sbjct  436  ELNGEYLMNRAVRLDLARERGAYTPYSGNGNNSFQKGGKG--QSRTIFVKGLDASLDEDT  493

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++L+ HFGSCGEI    IPTD + G +KG AY++F D  +++KALEL+ S+L + SL 
Sbjct  494  IRNSLQEHFGSCGEISRVAIPTDRDSGAVKGFAYLDFKDEGSLNKALELDGSKLNNQSLS  553

Query  468  VDEAKPRND  442
            VDEAKP+ D
Sbjct  554  VDEAKPKGD  562



>ref|XP_003607240.1| RNA-binding protein [Medicago truncatula]
 gb|AES89437.1| RNA recognition motif [Medicago truncatula]
Length=623

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+LL R V+L  A+ERGA+TPN+   +++   QS G G+S TVFVRGFDKN  ED 
Sbjct  422  EMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGFDKNLGEDE  478

Query  645  IRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
            IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ S+L    L
Sbjct  479  IRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHESELDGYQL  538

Query  471  YVDEAKPRN  445
             VDEAKPR+
Sbjct  539  SVDEAKPRD  547


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 15/119 (13%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGA--FDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEG  625
            +DV++  A + G   PN+ A   +NS          S T+FV     N +    RS +E 
Sbjct  336  KDVEMVDAGKSGKKAPNTPATPIENSG---------SKTLFVG----NLSFSVQRSDIEK  382

Query  624  HFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
             F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D A+ R
Sbjct  383  FFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLDLARER  441



>gb|KHN32280.1| RNA-binding protein 34 [Glycine soja]
Length=735

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 90/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            LNGQ L  R+++L  A+ERGAYTPNS   + ++  Q    G+S T+FVRGFD +  ED I
Sbjct  538  LNGQQLFNRELRLDLARERGAYTPNS--SNWNNSSQKSERGQSQTIFVRGFDTSLGEDEI  595

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R +L+ HFGSCG+I    IP D E G +KG AY++F D D+M KALEL+ ++LG  +L V
Sbjct  596  RGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFGDADSMGKALELHETELGGYTLTV  655

Query  465  DEAKPRND  442
            DEAKPR++
Sbjct  656  DEAKPRDN  663



>gb|KJB12389.1| hypothetical protein B456_002G015800 [Gossypium raimondii]
Length=639

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R V+L  A+ERGAYTP SG  +NS Q+  +G  +S T+FV+G D +  ED 
Sbjct  436  ELNGEYLMNRAVRLDLARERGAYTPYSGNGNNSFQKGGKG--QSRTIFVKGLDASLDEDT  493

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++L+ HFGSCGEI    IPTD + G +KG AY++F D  +++KALEL+ S+L + SL 
Sbjct  494  IRNSLQEHFGSCGEISRVAIPTDRDSGAVKGFAYLDFKDEGSLNKALELDGSKLNNQSLS  553

Query  468  VDEAKPRND  442
            VDEAKP+ D
Sbjct  554  VDEAKPKGD  562



>ref|XP_007222208.1| hypothetical protein PRUPE_ppa007807mg [Prunus persica]
 gb|EMJ23407.1| hypothetical protein PRUPE_ppa007807mg [Prunus persica]
Length=355

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 83/127 (65%), Gaps = 4/127 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG +LL R V+L  A+ERGAYTP SG   NS Q+  +G    +T+F+RGFD +  ED 
Sbjct  152  ELNGVELLGRGVRLDLARERGAYTPQSGKEGNSYQKGGQG---QSTIFIRGFDTSQGEDE  208

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYI-KGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+  FG CGEI    IP D E    KGMAY+EF D D+  KAL+LN S  G+  L 
Sbjct  209  IRSSLQEFFGGCGEITRLSIPKDYETQAPKGMAYLEFQDGDSFKKALQLNQSDFGNGPLT  268

Query  468  VDEAKPR  448
            V EAKPR
Sbjct  269  VQEAKPR  275



>ref|XP_003537777.1| PREDICTED: nucleolin 2-like [Glycine max]
Length=748

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 90/128 (70%), Gaps = 3/128 (2%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            LNGQ L  R+++L  A+ERGAYTPNS   + ++  Q    G+S T+FVRGFD +  ED I
Sbjct  538  LNGQQLFNRELRLDLARERGAYTPNS--SNWNNSSQKSERGQSQTIFVRGFDTSLGEDEI  595

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R +L+ HFGSCG+I    IP D E G +KG AY++F D D+M KALEL+ ++LG  +L V
Sbjct  596  RGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFGDADSMGKALELHETELGGYTLTV  655

Query  465  DEAKPRND  442
            DEAKPR++
Sbjct  656  DEAKPRDN  663



>ref|XP_003607239.1| RNA-binding protein [Medicago truncatula]
 gb|AES89436.1| RNA recognition motif [Medicago truncatula]
Length=635

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+LL R V+L  A+ERGA+TPN+   +++   QS G G+S TVFVRGFDKN  ED 
Sbjct  434  EMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGFDKNLGEDE  490

Query  645  IRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
            IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ S+L    L
Sbjct  491  IRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHESELDGYQL  550

Query  471  YVDEAKPRN  445
             VDEAKPR+
Sbjct  551  SVDEAKPRD  559


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 15/119 (13%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGA--FDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEG  625
            +DV++  A + G   PN+ A   +NS          S T+FV     N +    RS +E 
Sbjct  348  KDVEMVDAGKSGKKAPNTPATPIENSG---------SKTLFVG----NLSFSVQRSDIEK  394

Query  624  HFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
             F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D A+ R
Sbjct  395  FFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLDLARER  453



>ref|XP_003607231.1| 28 kDa ribonucleoprotein [Medicago truncatula]
Length=643

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+LL R V+L  A+ERGA+TPN+   +++   QS G G+S TVFVRGFDKN  ED 
Sbjct  442  EMNGQELLQRAVRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGFDKNLGEDE  498

Query  645  IRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
            IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ S+L    L
Sbjct  499  IRAKLMEHFGGTCGEPTRVSIPKDFESGYSKGFAYMDFKDSDSFSKALELHESELDGYQL  558

Query  471  YVDEAKPRN  445
             VDEAKPR+
Sbjct  559  SVDEAKPRD  567


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  463
            RS +E  F  CGE+   R  +D EG  KG  ++EFA  +A   ALE+N  +L   ++ +D
Sbjct  397  RSDIEKFFQDCGEVVDVRFSSDEEGRFKGFGHVEFASAEAAQSALEMNGQELLQRAVRLD  456

Query  462  EAKPR  448
             A+ R
Sbjct  457  LARER  461



>ref|XP_002467108.1| hypothetical protein SORBIDRAFT_01g019710 [Sorghum bicolor]
 gb|EER94106.1| hypothetical protein SORBIDRAFT_01g019710 [Sorghum bicolor]
Length=664

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E  G+DL+ R +++  A ERGAYTPNSG  DN S R+S       TVF++GFD +  ED 
Sbjct  471  EFGGRDLMGRSLRIDLAVERGAYTPNSGK-DNGSFRKSAQRS-GNTVFIKGFDTSVGEDQ  528

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRSALE HF SCG+I    IP D + G  KGMAY++F D D+++KA E+N + LG  SLY
Sbjct  529  IRSALEEHFRSCGDITRISIPKDYDTGASKGMAYMDFKDPDSLNKAYEMNGTYLGDYSLY  588

Query  468  VDEAKPRND  442
            VDEAKPR D
Sbjct  589  VDEAKPRPD  597



>gb|EMT18300.1| Protein gar2 [Aegilops tauschii]
Length=688

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 89/130 (68%), Gaps = 6/130 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG DL  R V+L  A+ERGA TP SG  DNSS ++     +S T FVRGFD +  E+ 
Sbjct  522  ELNGGDLAGRPVRLDFARERGAITPGSG-RDNSSFKKPG---QSNTAFVRGFDSSLGEEE  577

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SL  472
            IRS+L+GHF SCG+I+   IP D + G  KG+AYIEF D  ++ KALELN S +G   SL
Sbjct  578  IRSSLQGHFSSCGDIRRVSIPKDYDTGASKGIAYIEFDDISSLPKALELNGSNIGEGLSL  637

Query  471  YVDEAKPRND  442
            +VDEAKPR D
Sbjct  638  FVDEAKPRAD  647



>ref|XP_010094074.1| hypothetical protein L484_018090 [Morus notabilis]
 gb|EXB55164.1| hypothetical protein L484_018090 [Morus notabilis]
Length=654

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG++   R VKL  A+ERGAYTP SG  D+ +  Q+RG  +  T+FVRG DK+  ED 
Sbjct  472  ELNGKEFRGRAVKLDFARERGAYTPYSGGKDDRNSFQNRGRDQVKTIFVRGLDKSIGEDE  531

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+ HFGSCGEI    +P D + G IKG+AY++F D  + +KALELN  +L ++ L 
Sbjct  532  IRSSLQEHFGSCGEISRISVPRDYDTGSIKGLAYLDFNDTGSFNKALELNGVELDNNYLT  591

Query  468  VDEAKPR  448
            V+EAKPR
Sbjct  592  VEEAKPR  598



>tpg|DAA49685.1| TPA: putative nucleolin-like family protein [Zea mays]
Length=196

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 81/122 (66%), Gaps = 3/122 (2%)
 Frame = -2

Query  804  LXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEG  625
            + R +++  A ERGAYTP+SG   ++   +        TVF++GFD +  ED IR+ALE 
Sbjct  1    MGRPLRIDMATERGAYTPSSGK--DNGSFKKFAPRSGNTVFIKGFDTSGGEDQIRTALEE  58

Query  624  HFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
            HFGSCG+I    IP D + G  KGMAY++F D D+++KA ELN + LG  SLYVDEAKPR
Sbjct  59   HFGSCGDITRISIPKDYDTGVSKGMAYMDFKDPDSLNKAYELNGTDLGGYSLYVDEAKPR  118

Query  447  ND  442
             D
Sbjct  119  PD  120



>ref|XP_011463448.1| PREDICTED: nucleolin 1 isoform X8 [Fragaria vesca subsp. vesca]
Length=567

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL  R ++L  A+ERG   AYTP+SG   NS QR  +G  +S T+FVRGFD    E
Sbjct  372  LNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFVRGFDTTQGE  429

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE +NS LG+  
Sbjct  430  DEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEFDNSDLGNGC  489

Query  474  -LYVDEAKPRND  442
             L V  AKPR D
Sbjct  490  YLSVQPAKPRGD  501



>emb|CAA61298.1| nuM1 [Medicago sativa]
Length=635

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NGQ+LL R ++L  A+ERGA+TPN+   +++   QS G G+S TVFVRGFDKN  ED 
Sbjct  434  EMNGQELLHRALRLDLARERGAFTPNN---NSNYSAQSGGRGQSQTVFVRGFDKNLGEDE  490

Query  645  IRSALEGHFG-SCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
            IR+ L  HFG +CGE     IP D E GY KG AY++F D+D+ SKALEL+ S+L    L
Sbjct  491  IRAKLMEHFGGTCGEPTRVSIPKDYESGYSKGFAYMDFKDSDSFSKALELHESELDGYQL  550

Query  471  YVDEAKPRN  445
             VDEAKPR+
Sbjct  551  SVDEAKPRD  559


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHF  619
            +DV++  A + G   PN+ A  N +         S T+FV     N + D  RS +E  F
Sbjct  348  KDVEMVDAGKSGKKAPNTPATPNETSG-------SKTLFVG----NLSFDVKRSDIENFF  396

Query  618  GSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
              C E+   R+ +D +G  KG  ++EFA  +A   ALE+N  +L H +L +D A+ R
Sbjct  397  QGCVEVVDVRLASDGDGVFKGFGHVEFATAEAAQSALEMNGQELLHRALRLDLARER  453



>gb|KDP43309.1| hypothetical protein JCGZ_24230 [Jatropha curcas]
Length=743

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            +LNGQ L  R+V+L  A+ERG    YTP SG  +NSSQ+  RG  +  T+FVRGFDK   
Sbjct  538  KLNGQALNGREVRLDLARERGERAPYTPYSGKENNSSQKGGRG--QGQTIFVRGFDKFLG  595

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E+ IRS+LE HF  CGEI    IPTD E G IKGMAY+EF D++A +KALEL+ SQLG  
Sbjct  596  ENEIRSSLEEHFQDCGEITRLSIPTDYESGAIKGMAYLEFKDSEAFNKALELSGSQLGDQ  655

Query  477  SLYVDEAKPR  448
             L V+EAKPR
Sbjct  656  YLTVEEAKPR  665



>ref|XP_011463447.1| PREDICTED: nucleolin 1 isoform X7 [Fragaria vesca subsp. vesca]
Length=583

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL  R ++L  A+ERG   AYTP+SG   NS QR  +G  +S T+FVRGFD    E
Sbjct  388  LNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFVRGFDTTQGE  445

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE +NS LG+  
Sbjct  446  DEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEFDNSDLGNGC  505

Query  474  -LYVDEAKPRND  442
             L V  AKPR D
Sbjct  506  YLSVQPAKPRGD  517



>ref|XP_011463445.1| PREDICTED: nucleolin 1 isoform X5 [Fragaria vesca subsp. vesca]
Length=591

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL  R ++L  A+ERG   AYTP+SG   NS QR  +G  +S T+FVRGFD    E
Sbjct  407  LNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFVRGFDTTQGE  464

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE +NS LG+  
Sbjct  465  DEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEFDNSDLGNGC  524

Query  474  -LYVDEAKPRND  442
             L V  AKPR D
Sbjct  525  YLSVQPAKPRGD  536



>ref|XP_011463446.1| PREDICTED: nucleolin 1 isoform X6 [Fragaria vesca subsp. vesca]
Length=587

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL  R ++L  A+ERG   AYTP+SG   NS QR  +G  +S T+FVRGFD    E
Sbjct  392  LNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFVRGFDTTQGE  449

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE +NS LG+  
Sbjct  450  DEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEFDNSDLGNGC  509

Query  474  -LYVDEAKPRND  442
             L V  AKPR D
Sbjct  510  YLSVQPAKPRGD  521



>ref|XP_004297745.1| PREDICTED: nucleolin 1 isoform X2 [Fragaria vesca subsp. vesca]
Length=601

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL  R ++L  A+ERG   AYTP+SG   NS QR  +G  +S T+FVRGFD    E
Sbjct  406  LNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFVRGFDTTQGE  463

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE +NS LG+  
Sbjct  464  DEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEFDNSDLGNGC  523

Query  474  -LYVDEAKPRND  442
             L V  AKPR D
Sbjct  524  YLSVQPAKPRGD  535



>ref|XP_011463442.1| PREDICTED: nucleolin 1 isoform X1 [Fragaria vesca subsp. vesca]
Length=602

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL  R ++L  A+ERG   AYTP+SG   NS QR  +G  +S T+FVRGFD    E
Sbjct  407  LNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFVRGFDTTQGE  464

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE +NS LG+  
Sbjct  465  DEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEFDNSDLGNGC  524

Query  474  -LYVDEAKPRND  442
             L V  AKPR D
Sbjct  525  YLSVQPAKPRGD  536



>gb|KJB79879.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=859

 Score =   120 bits (301),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 67/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG+ +NS Q+  RG  ++ T++VRGFD++ ++D 
Sbjct  659  ELNGEYLMNRSLRLDLARERGAYTPSSGSGNNSFQKGGRG--QARTIYVRGFDQSLSQDE  716

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  717  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  776

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  777  VDEAKPRGE  785



>gb|KJB79874.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=900

 Score =   120 bits (301),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 67/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG+ +NS Q+  RG  ++ T++VRGFD++ ++D 
Sbjct  700  ELNGEYLMNRSLRLDLARERGAYTPSSGSGNNSFQKGGRG--QARTIYVRGFDQSLSQDE  757

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  758  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  817

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  818  VDEAKPRGE  826



>ref|XP_011463444.1| PREDICTED: nucleolin 1 isoform X4 [Fragaria vesca subsp. vesca]
Length=597

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL  R ++L  A+ERG   AYTP+SG   NS QR  +G  +S T+FVRGFD    E
Sbjct  402  LNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFVRGFDTTQGE  459

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE +NS LG+  
Sbjct  460  DEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEFDNSDLGNGC  519

Query  474  -LYVDEAKPRND  442
             L V  AKPR D
Sbjct  520  YLSVQPAKPRGD  531



>ref|XP_011463443.1| PREDICTED: nucleolin 1 isoform X3 [Fragaria vesca subsp. vesca]
Length=598

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL  R ++L  A+ERG   AYTP+SG   NS QR  +G  +S T+FVRGFD    E
Sbjct  403  LNGSDLFGRPIRLDLARERGERGAYTPHSGKEGNSYQRGGQG--QSQTIFVRGFDTTQGE  460

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRSAL+ HFGSCG+I    IP D + G  KGMAY++F D DA++KALE +NS LG+  
Sbjct  461  DEIRSALQSHFGSCGDITRVSIPKDYDTGAPKGMAYMDFTDADALNKALEFDNSDLGNGC  520

Query  474  -LYVDEAKPRND  442
             L V  AKPR D
Sbjct  521  YLSVQPAKPRGD  532



>gb|KJB79880.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=860

 Score =   120 bits (300),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 67/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG+ +NS Q+  RG  ++ T++VRGFD++ ++D 
Sbjct  660  ELNGEYLMNRSLRLDLARERGAYTPSSGSGNNSFQKGGRG--QARTIYVRGFDQSLSQDE  717

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  718  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  777

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  778  VDEAKPRGE  786



>gb|KJB79881.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=901

 Score =   120 bits (300),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 67/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG+ +NS Q+  RG  ++ T++VRGFD++ ++D 
Sbjct  701  ELNGEYLMNRSLRLDLARERGAYTPSSGSGNNSFQKGGRG--QARTIYVRGFDQSLSQDE  758

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  759  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  818

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  819  VDEAKPRGE  827



>gb|KJB79877.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=860

 Score =   120 bits (300),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 67/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG+ +NS Q+  RG  ++ T++VRGFD++ ++D 
Sbjct  660  ELNGEYLMNRSLRLDLARERGAYTPSSGSGNNSFQKGGRG--QARTIYVRGFDQSLSQDE  717

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  718  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  777

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  778  VDEAKPRGE  786



>ref|XP_010688710.1| PREDICTED: nucleolin 1 [Beta vulgaris subsp. vulgaris]
Length=599

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R V+L  A+ERGAYTPN+      +    +GGG+ T++FVRGFDK   ED 
Sbjct  399  ELNGQDLLNRAVRLDLARERGAYTPNT----RENNSFQKGGGQGTSLFVRGFDKYGDEDE  454

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEG-YIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             RS L+  FG CGEI    IP D E   +KGMA+I+F+D++ ++KA+ELN S+ G S L 
Sbjct  455  TRSGLQELFGPCGEITRISIPPDRENNCLKGMAFIDFSDSNGLNKAIELNGSEFGGSYLT  514

Query  468  VDEAKPR  448
            V+E+KPR
Sbjct  515  VNESKPR  521



>ref|XP_011070700.1| PREDICTED: nucleolin 2-like [Sesamum indicum]
Length=770

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 82/125 (66%), Gaps = 15/125 (12%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+DLL R V+L      G  TP+   F    +       +  T+FVRGF+K D ED 
Sbjct  592  ELNGEDLLGRAVRL------GKDTPS---FQRGGRT------QGQTIFVRGFNKYDGEDQ  636

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            IRS+LE HFGSCGEI    IPTD +G +KGMAYIEF +++A ++ALELN S+ G  +L V
Sbjct  637  IRSSLEEHFGSCGEIARVSIPTDQDGGVKGMAYIEFKESNAFNQALELNGSEFGDGTLQV  696

Query  465  DEAKP  451
            DEAKP
Sbjct  697  DEAKP  701



>gb|AFW61036.1| putative nucleolin-like family protein [Zea mays]
Length=262

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = -2

Query  813  QDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  634
            ++L  R+V+L  AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IRS+
Sbjct  60   KELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIRSS  116

Query  633  LEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYVDE  460
            LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYVDE
Sbjct  117  LEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYVDE  176

Query  459  AKP  451
            AKP
Sbjct  177  AKP  179



>gb|KHG18558.1| Nucleolin [Gossypium arboreum]
Length=902

 Score =   118 bits (296),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 67/129 (52%), Positives = 95/129 (74%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG  +NS Q+  RG  ++ T++VRGF+++ ++D 
Sbjct  702  ELNGEYLMNRSLRLDLARERGAYTPSSGNGNNSFQKGGRG--QTRTIYVRGFNQSLSQDE  759

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F D D+ +KALELN S+L + SL 
Sbjct  760  AKQSLEEHFGSCGEISRVAIPVDRETGYLRGYAYLDFNDGDSFNKALELNGSELNNYSLT  819

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  820  VDEAKPRGE  828



>ref|NP_001132813.1| uncharacterized protein LOC100194303 [Zea mays]
 gb|ACF81816.1| unknown [Zea mays]
Length=303

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = -2

Query  813  QDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  634
            ++L  R+V+L  AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IRS+
Sbjct  60   KELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIRSS  116

Query  633  LEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYVDE  460
            LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYVDE
Sbjct  117  LEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYVDE  176

Query  459  AKP  451
            AKP
Sbjct  177  AKP  179



>gb|ACN25922.1| unknown [Zea mays]
Length=383

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = -2

Query  813  QDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  634
            ++L  R+V+L  AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IRS+
Sbjct  181  KELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIRSS  237

Query  633  LEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYVDE  460
            LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYVDE
Sbjct  238  LEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYVDE  297

Query  459  AKP  451
            AKP
Sbjct  298  AKP  300



>ref|XP_008221051.1| PREDICTED: nucleolin 1 isoform X2 [Prunus mume]
Length=637

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+G +LL R V+L  A+ERG+YTP+SG   NS Q+  +G    +T+F+RGFD +  ED 
Sbjct  434  ELHGVELLGRGVRLDLARERGSYTPHSGKEGNSYQKGGQG---QSTIFIRGFDTSQGEDE  490

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYI-KGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+  FG CGEI    IP D E    KGMAY+EF D D+  KAL+LN +  G  +L 
Sbjct  491  IRSSLQEFFGGCGEITRLSIPKDYETQAPKGMAYLEFQDGDSFKKALQLNQANFGKCTLT  550

Query  468  VDEAKPRND  442
            V EAKPR D
Sbjct  551  VQEAKPRAD  559



>ref|XP_008221050.1| PREDICTED: nucleolin 2 isoform X1 [Prunus mume]
Length=669

 Score =   117 bits (293),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+G +LL R V+L  A+ERG+YTP+SG   NS Q+  +G    +T+F+RGFD +  ED 
Sbjct  466  ELHGVELLGRGVRLDLARERGSYTPHSGKEGNSYQKGGQG---QSTIFIRGFDTSQGEDE  522

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYI-KGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IRS+L+  FG CGEI    IP D E    KGMAY+EF D D+  KAL+LN +  G  +L 
Sbjct  523  IRSSLQEFFGGCGEITRLSIPKDYETQAPKGMAYLEFQDGDSFKKALQLNQANFGKCTLT  582

Query  468  VDEAKPRND  442
            V EAKPR D
Sbjct  583  VQEAKPRAD  591



>gb|KJB79878.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=858

 Score =   117 bits (294),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 91/129 (71%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG  ++  +       ++ T++VRGFD++ ++D 
Sbjct  659  ELNGEYLMNRSLRLDLARERGAYTPSSGGNNSFQKGGRG---QARTIYVRGFDQSLSQDE  715

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  716  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  775

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  776  VDEAKPRGE  784



>gb|KJB79875.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=899

 Score =   117 bits (294),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 91/129 (71%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG  ++  +       ++ T++VRGFD++ ++D 
Sbjct  700  ELNGEYLMNRSLRLDLARERGAYTPSSGGNNSFQKGGRG---QARTIYVRGFDQSLSQDE  756

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  757  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  816

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  817  VDEAKPRGE  825



>gb|KJB79876.1| hypothetical protein B456_013G070400 [Gossypium raimondii]
Length=859

 Score =   117 bits (293),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 65/129 (50%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R ++L  A+ERGAYTP+SG    ++  Q  G G++ T++VRGFD++ ++D 
Sbjct  660  ELNGEYLMNRSLRLDLARERGAYTPSSGG---NNSFQKGGRGQARTIYVRGFDQSLSQDE  716

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
             + +LE HFGSCGEI    IP D E GY++G AY++F + D+ +KALELN S+L + SL 
Sbjct  717  AKQSLEEHFGSCGEISRVAIPVDRETGYVRGYAYLDFNEGDSFNKALELNGSELNNYSLT  776

Query  468  VDEAKPRND  442
            VDEAKPR +
Sbjct  777  VDEAKPRGE  785



>gb|KDO52763.1| hypothetical protein CISIN_1g045516mg, partial [Citrus sinensis]
Length=675

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQ L  R ++L  A+ERGAYTP SG  +++S ++   G  + T+F++GFD +  ED 
Sbjct  475  ELNGQMLGNRAIRLDFARERGAYTPYSGGNESNSFQKGGRGQAAHTIFIKGFDSSVGEDQ  534

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +R++LE HFGSCGEI    +P D + G +KG+AY++F D D+ +KALE++ +++G  SL 
Sbjct  535  VRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNKALEMSGTEIGGYSLV  594

Query  468  VDEAK  454
            VDEAK
Sbjct  595  VDEAK  599



>ref|XP_006484546.1| PREDICTED: nucleolin 2-like [Citrus sinensis]
Length=686

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQ L  R ++L  A+ERGAYTP SG  +++S ++   G  + T+F++GFD +  ED 
Sbjct  486  ELNGQMLGNRAIRLDFARERGAYTPYSGGNESNSFQKGGRGQAAHTIFIKGFDSSVGEDQ  545

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +R++LE HFGSCGEI    +P D + G +KG+AY++F D D+ +KALE++ +++G  SL 
Sbjct  546  VRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNKALEMSGTEIGGYSLV  605

Query  468  VDEAK  454
            VDEAK
Sbjct  606  VDEAK  610



>gb|AFW61035.1| putative nucleolin-like family protein [Zea mays]
Length=654

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 82/125 (66%), Gaps = 5/125 (4%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  640
              ++L  R+V+L  AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IR
Sbjct  450  QSKELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIR  506

Query  639  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYV  466
            S+LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYV
Sbjct  507  SSLEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYV  566

Query  465  DEAKP  451
            DEAKP
Sbjct  567  DEAKP  571



>ref|XP_006437567.1| hypothetical protein CICLE_v10030875mg [Citrus clementina]
 gb|ESR50807.1| hypothetical protein CICLE_v10030875mg [Citrus clementina]
Length=686

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 88/125 (70%), Gaps = 1/125 (1%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQ L  R ++L  A+ERGAYTP SG  + +S ++   G  + T+F++GFD +  ED 
Sbjct  486  ELNGQMLGNRAIRLDFARERGAYTPYSGGNEGNSFQKGGRGQAAHTIFIKGFDSSVGEDQ  545

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +R++LE HFGSCGEI    +P D + G +KG+AY++F D D+ +KALE++ +++G  SL 
Sbjct  546  VRASLEEHFGSCGEITRISVPKDYDTGSVKGIAYLDFTDADSFNKALEMSGTEIGGYSLV  605

Query  468  VDEAK  454
            VDEAK
Sbjct  606  VDEAK  610



>ref|XP_008676638.1| PREDICTED: uncharacterized protein LOC100194303 isoform X2 [Zea 
mays]
 gb|AFW61033.1| putative nucleolin-like family protein [Zea mays]
Length=659

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 82/125 (66%), Gaps = 5/125 (4%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  640
              ++L  R+V+L  AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IR
Sbjct  455  QSKELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIR  511

Query  639  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYV  466
            S+LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYV
Sbjct  512  SSLEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYV  571

Query  465  DEAKP  451
            DEAKP
Sbjct  572  DEAKP  576



>gb|EAZ05877.1| hypothetical protein OsI_28114 [Oryza sativa Indica Group]
Length=572

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 83/131 (63%), Gaps = 11/131 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNS----GAFDNssqrqsrggGESTTVFVRGFDKND  658
            EL+G DL  R V+L  A ERGAYTP+S    G+F   ++        S ++FV+GFD + 
Sbjct  369  ELHGCDLDGRPVRLDLAHERGAYTPHSRNDTGSFQKQNRGS------SQSIFVKGFDSSL  422

Query  657  TEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGH  481
             E  IR +LEGHF  CGEI    +P D E G  KG+AYI+F D  + SKALEL+ S LG 
Sbjct  423  EESKIRESLEGHFADCGEITRVSVPMDRETGASKGIAYIDFKDQASFSKALELSGSDLGG  482

Query  480  SSLYVDEAKPR  448
             +LYVDEAKP+
Sbjct  483  YNLYVDEAKPK  493



>ref|NP_001061178.1| Os08g0192900 [Oryza sativa Japonica Group]
 sp|Q6Z1C0.1|NUCL1_ORYSJ RecName: Full=Nucleolin 1; AltName: Full=Protein NUCLEOLIN LIKE 
1 [Oryza sativa Japonica Group]
 dbj|BAD05605.1| putative nucleolin [Oryza sativa Japonica Group]
 gb|AAU01907.1| putative nucleolin [Oryza sativa Indica Group]
 dbj|BAF23092.1| Os08g0192900 [Oryza sativa Japonica Group]
 gb|EAZ41784.1| hypothetical protein OsJ_26324 [Oryza sativa Japonica Group]
Length=572

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 83/131 (63%), Gaps = 11/131 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNS----GAFDNssqrqsrggGESTTVFVRGFDKND  658
            EL+G DL  R V+L  A ERGAYTP+S    G+F   ++        S ++FV+GFD + 
Sbjct  369  ELHGCDLDGRPVRLDLAHERGAYTPHSRNDTGSFQKQNRGS------SQSIFVKGFDSSL  422

Query  657  TEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGH  481
             E  IR +LEGHF  CGEI    +P D E G  KG+AYI+F D  + SKALEL+ S LG 
Sbjct  423  EESKIRESLEGHFADCGEITRVSVPMDRETGASKGIAYIDFKDQASFSKALELSGSDLGG  482

Query  480  SSLYVDEAKPR  448
             +LYVDEAKP+
Sbjct  483  YNLYVDEAKPK  493



>ref|XP_008676637.1| PREDICTED: uncharacterized protein LOC100194303 isoform X1 [Zea 
mays]
 gb|AFW61034.1| putative nucleolin-like family protein [Zea mays]
Length=700

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 82/125 (66%), Gaps = 5/125 (4%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  640
              ++L  R+V+L  AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IR
Sbjct  455  QSKELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIR  511

Query  639  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYV  466
            S+LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYV
Sbjct  512  SSLEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYV  571

Query  465  DEAKP  451
            DEAKP
Sbjct  572  DEAKP  576



>gb|AFW61032.1| putative nucleolin-like family protein [Zea mays]
Length=699

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 82/125 (66%), Gaps = 5/125 (4%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  640
              ++L  R+V+L  AK R   TP SG   N    Q    G S+++F+RGFDKN +ED IR
Sbjct  454  QSKELHGREVRLDFAKGRSTQTPRSG---NDGSFQKAARGNSSSIFIRGFDKNLSEDEIR  510

Query  639  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-SLYV  466
            S+LE HF  CGE+    IPTD E G IKGMAYI+F D D++SKALEL+ S +G    LYV
Sbjct  511  SSLEQHFSDCGEMTRVSIPTDHESGAIKGMAYIDFKDQDSVSKALELSGSDIGGGYELYV  570

Query  465  DEAKP  451
            DEAKP
Sbjct  571  DEAKP  575



>emb|CDP16867.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   114 bits (285),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 85/128 (66%), Gaps = 3/128 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNGQDLL R +K+  A+ERG+ TP SG   + S  Q   G +  T+FVRGF+ N  E+ 
Sbjct  518  ELNGQDLLGRTLKVDIARERGSNTPQSG--KDRSSFQKGFGSQGPTIFVRGFESNVDENE  575

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            I+ AL  HF SCGEI    +P    G +KG AYI F+DNDA++KALE +NS+   S+L V
Sbjct  576  IKGALREHFESCGEITRISLPRGDNG-LKGFAYIGFSDNDAINKALEYDNSEFKESTLTV  634

Query  465  DEAKPRND  442
            +EA+PR D
Sbjct  635  EEARPRGD  642



>ref|XP_007131647.1| hypothetical protein PHAVU_011G030600g [Phaseolus vulgaris]
 gb|ESW03641.1| hypothetical protein PHAVU_011G030600g [Phaseolus vulgaris]
Length=693

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 92/131 (70%), Gaps = 5/131 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAK--ERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            ELNG +L  R ++L  A+  +R ++TPNS     ++  Q  G G+S T+FVRGFDK+  E
Sbjct  487  ELNGHELHNRPLRLDSARVRDRSSFTPNSSN--WNNSSQKSGRGQSQTLFVRGFDKSLGE  544

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRS+LE HFGSCGE+    IP D E G +KG AY++F+D D +SKALEL+ ++LG  +
Sbjct  545  DEIRSSLEEHFGSCGEVTRVSIPKDYETGAVKGFAYMDFSDADGISKALELHETELGGYT  604

Query  474  LYVDEAKPRND  442
            L VDEAKPR++
Sbjct  605  LSVDEAKPRDN  615


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  463
            RS +E  F  CGE+   R+ TD +G  KG  ++EFA  +A  KALELN  +L +  L +D
Sbjct  442  RSDVEDFFKDCGEVVDVRLATDEDGRFKGFGHVEFATVEAAQKALELNGHELHNRPLRLD  501

Query  462  EAKPRN  445
             A+ R+
Sbjct  502  SARVRD  507



>ref|XP_008350969.1| PREDICTED: nucleolin 2-like [Malus domestica]
Length=268

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 82/132 (62%), Gaps = 7/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DLL RD++L  A+ERG   AYTP       S+  Q      S T+FVRGFD++  
Sbjct  75   ELNGLDLLGRDIRLDLARERGERGAYTPTG---RESNSYQKGPRSASKTIFVRGFDRSLG  131

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRS+L+  F SCGEI    IP D E G  KGMAY++F+D  + +KALE N  + G  
Sbjct  132  EDEIRSSLQEAFSSCGEITRVSIPKDYETGASKGMAYMDFSDATSFNKALEFNGHEFGDG  191

Query  477  SLYVDEAKPRND  442
             L V+EAKP+ D
Sbjct  192  YLQVEEAKPKGD  203



>ref|XP_008340448.1| PREDICTED: nucleolin 1-like [Malus domestica]
Length=450

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            E NG +LL RDV+L  A+ERG   AYTP +G+  NS Q+  RG   S T+F+RGFD +  
Sbjct  267  EFNGSELLGRDVRLDLARERGEKGAYTP-TGSESNSHQKGPRGA--SKTIFIRGFDSSLG  323

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRS+L+  F SCGEI    IP D E G  KGMAY++F D D+ +KAL L+ S+ G S
Sbjct  324  EDEIRSSLQEVFSSCGEITRVSIPKDYETGASKGMAYMDFTDADSFTKALGLDGSEFGDS  383

Query  477  SLYVDEAKPRND  442
             L V+EAKP+ D
Sbjct  384  YLKVEEAKPKGD  395



>ref|XP_002527136.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF35238.1| nucleic acid binding protein, putative [Ricinus communis]
Length=642

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 87/133 (65%), Gaps = 8/133 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            +LNGQ L  R+V+L  A+ERG    YTP SG  DNS Q+  R   ++  +FVRGFDK   
Sbjct  445  KLNGQSLNGREVRLDLARERGERAPYTPYSGK-DNSFQKGGRS--QTQKIFVRGFDKFLG  501

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IR++L  HF +CGEI    +PTD E G IKGMAY+EF D    +KALE N SQLG  
Sbjct  502  EDEIRNSLGEHFKTCGEITRISLPTDYETGAIKGMAYVEFQDATGFNKALEFNGSQLGDQ  561

Query  477  SLYVDEAK-PRND  442
             L V+EAK PRND
Sbjct  562  YLTVEEAKPPRND  574



>ref|XP_009351719.1| PREDICTED: nucleolin 1 [Pyrus x bretschneideri]
Length=456

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            E NG +LL RDVKL  A+ERG   AYTP +G+  NS Q+  RG   S T+F+RGFD +  
Sbjct  271  EFNGLELLGRDVKLDLARERGEKGAYTP-TGSESNSYQKGPRGA--SKTIFIRGFDSSLG  327

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRS+L+  F SCGEI    IP D E G  KGMAY++F D D+ +KAL L+ S+ G S
Sbjct  328  EDEIRSSLQEVFSSCGEITRVSIPKDYETGASKGMAYMDFTDADSFNKALGLDGSEFGDS  387

Query  477  SLYVDEAKPRND  442
             L V+EAKP+ D
Sbjct  388  YLKVEEAKPKGD  399



>ref|XP_003573379.1| PREDICTED: nucleolin 1 [Brachypodium distachyon]
Length=606

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 82/130 (63%), Gaps = 11/130 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTP---NSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNGQ+L+ R V+L  A ERGA TP   + G+F   S         S +VFV+GFD +  
Sbjct  399  ELNGQELMGRAVRLDLALERGA-TPRPRDGGSFQKPSGGS------SLSVFVKGFDSSQQ  451

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRS+LE HF  CGEI    +P D E G  KG+AY++F D  + SKALEL+ S LG  
Sbjct  452  EDKIRSSLEQHFSKCGEITRVSVPMDYESGESKGIAYMDFTDESSFSKALELSGSDLGGY  511

Query  477  SLYVDEAKPR  448
            +LYV EAKP+
Sbjct  512  NLYVAEAKPK  521



>ref|XP_006836341.1| hypothetical protein AMTR_s00092p00090110 [Amborella trichopoda]
 gb|ERM99194.1| hypothetical protein AMTR_s00092p00090110 [Amborella trichopoda]
Length=662

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 87/129 (67%), Gaps = 9/129 (7%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +LNG+DLL R V+L  A ERG  TP +G  +NS Q+   G G  +T++V+GFDK+   D 
Sbjct  461  KLNGKDLLGRPVRLDVAGERGPRTPGTG--ENSFQKTKGGYGGGSTIYVKGFDKSQDFDQ  518

Query  645  IRSALEGHFGSCGEIKGTRIPTDPEGY----IKGMAYIEFADNDAMSKALELNNSQLGHS  478
            IRS+LE HFG CGEI    IP D   Y     KG+AY++F+D++A+SKALELN S LG  
Sbjct  519  IRSSLEEHFGQCGEITRLAIPKD---YDLDAPKGIAYMDFSDSNALSKALELNGSDLGGY  575

Query  477  SLYVDEAKP  451
            SL V+EA P
Sbjct  576  SLTVEEAMP  584



>ref|XP_008461860.1| PREDICTED: nucleolin 1 isoform X2 [Cucumis melo]
Length=658

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 3/117 (3%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHF  619
            R+V+L  A+E+GAYTP     +NS Q+  RG   S TVFVRGFD++  ED IRSAL+ HF
Sbjct  464  REVRLDMAREKGAYTPYDRERNNSFQKGGRG--PSQTVFVRGFDRSSGEDEIRSALQEHF  521

Query  618  GSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKP  451
            G+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+L  + L V+EAKP
Sbjct  522  GACGDITRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSELHGNYLTVEEAKP  578



>ref|XP_004172525.1| PREDICTED: uncharacterized protein LOC101223830, partial [Cucumis 
sativus]
Length=500

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHF  619
            R+V+L  A+E+G+YTP      N+S ++   G  S TVFVRGFD++  ED IRSAL+ HF
Sbjct  306  REVRLDMAREKGSYTPYDSRERNNSFQKGGRGP-SQTVFVRGFDRSLGEDEIRSALQDHF  364

Query  618  GSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKP  451
            G+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+L  + L VDEAKP
Sbjct  365  GACGDINRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSELHGNYLTVDEAKP  421



>ref|XP_008360013.1| PREDICTED: nucleolin 2-like [Malus domestica]
Length=626

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 7/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DLL RD++L  A+ERG   AYTP +G   NS Q+  RG   S T+FVRGFD++  
Sbjct  471  ELNGLDLLGRDIRLDLARERGERGAYTP-TGRESNSYQKGPRGA--SKTIFVRGFDRSLG  527

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRS+L+  F SCGEI    IP D E G  KGMAY++F+D  + +KALE N  + G  
Sbjct  528  EDEIRSSLQEAFSSCGEITRVSIPKDYETGASKGMAYMDFSDATSFNKALEFNGHEFGDX  587

Query  477  SLYVDEAKPRND  442
             L V+EAKP+ D
Sbjct  588  YLQVEEAKPKGD  599



>dbj|BAK07329.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=241

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGA---YTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL+ R V+L  A ERGA    T + G+F   S         S +VFV+GFD +  E
Sbjct  36   LNGGDLIGRPVRLDLAAERGASALRTRDGGSFGKPSGG------PSLSVFVKGFDSSQQE  89

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRS+L+ HF  CGEI    +P D E G  KG+AY++F D  + SKALEL+ S LG  +
Sbjct  90   DAIRSSLQEHFSKCGEITRVSVPMDHENGASKGIAYMDFTDESSFSKALELSGSDLGGCN  149

Query  474  LYVDEAKPR  448
            LYV EAKP+
Sbjct  150  LYVAEAKPK  158



>ref|XP_008389084.1| PREDICTED: nucleolin 2-like [Malus domestica]
Length=664

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DLL RD++L  A+ERG   AYTP +G   NS Q+  R    S T+FVRGFD++  
Sbjct  471  ELNGLDLLGRDIRLDLARERGERGAYTP-TGRESNSYQKGPRXA--SKTIFVRGFDRSLG  527

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRS+L+  F SCGEI    IP D E G  KGMAY++F+D  + +KALE N  + G  
Sbjct  528  EDEIRSSLQEAFSSCGEITRVSIPKDYETGASKGMAYMDFSDATSFNKALEFNGHEFGDG  587

Query  477  SLYVDEAKPRND  442
             L V+EAKP+ D
Sbjct  588  YLQVEEAKPKGD  599



>ref|XP_008461859.1| PREDICTED: nucleolin 1 isoform X1 [Cucumis melo]
Length=659

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHF  619
            R+V+L  A+E+GAYTP      N+S ++   G  S TVFVRGFD++  ED IRSAL+ HF
Sbjct  464  REVRLDMAREKGAYTPYDSRERNNSFQKGGRG-PSQTVFVRGFDRSSGEDEIRSALQEHF  522

Query  618  GSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKP  451
            G+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+L  + L V+EAKP
Sbjct  523  GACGDITRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSELHGNYLTVEEAKP  579



>ref|XP_010066989.1| PREDICTED: nucleolin 2 isoform X4 [Eucalyptus grandis]
Length=656

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E NG+ L  R +++  A ERGAYTP SG  +     Q  GGG++ TVFV+G DK+  ED 
Sbjct  445  EYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGLDKSIGEDQ  501

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN ++LG   L 
Sbjct  502  LRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGTELGGYPLA  561

Query  468  VDEAKPRND  442
            VDEA+PR++
Sbjct  562  VDEARPRDN  570



>gb|KCW65048.1| hypothetical protein EUGRSUZ_G02571 [Eucalyptus grandis]
Length=651

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E NG+ L  R +++  A ERGAYTP SG  +     Q  GGG++ TVFV+G DK+  ED 
Sbjct  484  EYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGLDKSIGEDQ  540

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN ++LG   L 
Sbjct  541  LRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGTELGGYPLA  600

Query  468  VDEAKPRND  442
            VDEA+PR++
Sbjct  601  VDEARPRDN  609



>ref|XP_010066988.1| PREDICTED: nucleolin 2 isoform X3 [Eucalyptus grandis]
Length=695

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E NG+ L  R +++  A ERGAYTP SG  +     Q  GGG++ TVFV+G DK+  ED 
Sbjct  484  EYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGLDKSIGEDQ  540

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN ++LG   L 
Sbjct  541  LRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGTELGGYPLA  600

Query  468  VDEAKPRND  442
            VDEA+PR++
Sbjct  601  VDEARPRDN  609



>ref|XP_004148591.1| PREDICTED: uncharacterized protein LOC101206235 [Cucumis sativus]
Length=737

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHF  619
            R+V+L  A+E+G+YTP      N+S ++   G  S TVFVRGFD++  ED IRSAL+ HF
Sbjct  543  REVRLDMAREKGSYTPYDSRERNNSFQKGGRG-PSQTVFVRGFDRSLGEDEIRSALQDHF  601

Query  618  GSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKP  451
            G+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+L  + L VDEAKP
Sbjct  602  GACGDINRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSELHGNYLTVDEAKP  658



>ref|XP_010066987.1| PREDICTED: nucleolin 1 isoform X2 [Eucalyptus grandis]
Length=700

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E NG+ L  R +++  A ERGAYTP SG  +     Q  GGG++ TVFV+G DK+  ED 
Sbjct  489  EYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGLDKSIGEDQ  545

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN ++LG   L 
Sbjct  546  LRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGTELGGYPLA  605

Query  468  VDEAKPRND  442
            VDEA+PR++
Sbjct  606  VDEARPRDN  614



>ref|XP_010066986.1| PREDICTED: nucleolin 2 isoform X1 [Eucalyptus grandis]
Length=732

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E NG+ L  R +++  A ERGAYTP SG  +     Q  GGG++ TVFV+G DK+  ED 
Sbjct  521  EYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGLDKSIGEDQ  577

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN ++LG   L 
Sbjct  578  LRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGTELGGYPLA  637

Query  468  VDEAKPRND  442
            VDEA+PR++
Sbjct  638  VDEARPRDN  646



>gb|KCW65047.1| hypothetical protein EUGRSUZ_G02571 [Eucalyptus grandis]
Length=711

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E NG+ L  R +++  A ERGAYTP SG  +     Q  GGG++ TVFV+G DK+  ED 
Sbjct  500  EYNGEYLNDRQMRISLAHERGAYTPQSGKGN---FSQKGGGGQAQTVFVKGLDKSIGEDQ  556

Query  645  IRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +RS+L  HFG+CGE+    IP D   G  KG AYI+F D++  +KALELN ++LG   L 
Sbjct  557  LRSSLSEHFGTCGEVSRISIPKDYDSGEPKGFAYIDFTDSNGFNKALELNGTELGGYPLA  616

Query  468  VDEAKPRND  442
            VDEA+PR++
Sbjct  617  VDEARPRDN  625



>ref|XP_006306519.1| hypothetical protein CARUB_v10012524mg [Capsella rubella]
 gb|EOA39417.1| hypothetical protein CARUB_v10012524mg [Capsella rubella]
Length=535

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 84/132 (64%), Gaps = 10/132 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            EL+G+ LL R+++L  A+ERG   A+TP SG F +          +  TVFV+GFD + +
Sbjct  336  ELHGRPLLGREIRLDVAQERGERPAFTPQSGNFKSGGGGGG----DGQTVFVKGFDSSQS  391

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E++I+ AL  HF SCGEI    +PTD E G  KG+AY++F++     KALELN S +G  
Sbjct  392  EEDIKQALREHFASCGEITRVSVPTDRETGASKGIAYVDFSEGK--EKALELNGSDMGGW  449

Query  477  SLYVDEAKPRND  442
             L VDE +PR++
Sbjct  450  GLVVDEPRPRDN  461



>ref|XP_011465351.1| PREDICTED: nucleolin 1-like isoform X7 [Fragaria vesca subsp. 
vesca]
Length=564

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKE---RGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DL    V+L  A E   RGAYTP+SG        Q  G G+S T+FVRGFD    
Sbjct  371  ELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIFVRGFDTTQG  428

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA EL+ S LG+ 
Sbjct  429  EDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFELDGSDLGNG  488

Query  477  -SLYVDEAKPR  448
              L V  AKP+
Sbjct  489  YCLNVQPAKPK  499



>ref|XP_011465350.1| PREDICTED: nucleolin 1-like isoform X6 [Fragaria vesca subsp. 
vesca]
Length=565

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKE---RGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DL    V+L  A E   RGAYTP+SG        Q  G G+S T+FVRGFD    
Sbjct  372  ELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIFVRGFDTTQG  429

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA EL+ S LG+ 
Sbjct  430  EDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFELDGSDLGNG  489

Query  477  -SLYVDEAKPR  448
              L V  AKP+
Sbjct  490  YCLNVQPAKPK  500



>ref|XP_004301800.1| PREDICTED: nucleolin 1-like isoform X4 [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKE---RGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DL    V+L  A E   RGAYTP+SG        Q  G G+S T+FVRGFD    
Sbjct  385  ELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIFVRGFDTTQG  442

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA EL+ S LG+ 
Sbjct  443  EDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFELDGSDLGNG  502

Query  477  -SLYVDEAKPR  448
              L V  AKP+
Sbjct  503  YCLNVQPAKPK  513



>ref|XP_011465349.1| PREDICTED: nucleolin 1-like isoform X5 [Fragaria vesca subsp. 
vesca]
Length=567

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKE---RGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DL    V+L  A E   RGAYTP+SG        Q  G G+S T+FVRGFD    
Sbjct  374  ELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIFVRGFDTTQG  431

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA EL+ S LG+ 
Sbjct  432  EDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFELDGSDLGNG  491

Query  477  -SLYVDEAKPR  448
              L V  AKP+
Sbjct  492  YCLNVQPAKPK  502



>ref|XP_011465346.1| PREDICTED: nucleolin 1-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=620

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKE---RGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DL    V+L  A E   RGAYTP+SG        Q  G G+S T+FVRGFD    
Sbjct  427  ELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIFVRGFDTTQG  484

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA EL+ S LG+ 
Sbjct  485  EDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFELDGSDLGNG  544

Query  477  -SLYVDEAKPR  448
              L V  AKP+
Sbjct  545  YCLNVQPAKPK  555



>ref|XP_011465347.1| PREDICTED: nucleolin 1-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=606

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKE---RGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DL    V+L  A E   RGAYTP+SG        Q  G G+S T+FVRGFD    
Sbjct  413  ELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIFVRGFDTTQG  470

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA EL+ S LG+ 
Sbjct  471  EDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFELDGSDLGNG  530

Query  477  -SLYVDEAKPR  448
              L V  AKP+
Sbjct  531  YCLNVQPAKPK  541



>ref|XP_011465348.1| PREDICTED: nucleolin 1-like isoform X3 [Fragaria vesca subsp. 
vesca]
Length=598

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKE---RGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG DL    V+L  A E   RGAYTP+SG        Q  G G+S T+FVRGFD    
Sbjct  405  ELNGSDLCGCLVRLDLAHEKGERGAYTPHSG--KEGDSYQKGGQGQSQTIFVRGFDTTQG  462

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            ED IRSAL+ HFGSCGEI    I  D E G  KGMAY++F+D DA++KA EL+ S LG+ 
Sbjct  463  EDEIRSALQSHFGSCGEITRVSILKDYETGAPKGMAYMDFSDADALNKAFELDGSDLGNG  522

Query  477  -SLYVDEAKPR  448
              L V  AKP+
Sbjct  523  YCLNVQPAKPK  533



>gb|EMT20945.1| Nucleolin [Aegilops tauschii]
Length=560

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 78/129 (60%), Gaps = 10/129 (8%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNS---GAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL+ R V+L  A ERGA  P +   G+F   S         S +VFV+GFD +  E
Sbjct  367  LNGGDLMGRPVRLDMAAERGASAPRTRDGGSFGKPSGG------PSLSVFVKGFDSSQQE  420

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRS+L+ HF  CGEI    +P D E G  KG+AY++F D  + SKAL L+ S LG  +
Sbjct  421  DAIRSSLQEHFSKCGEITRVSVPMDYENGASKGIAYMDFTDESSFSKALALSGSDLGGCN  480

Query  474  LYVDEAKPR  448
            LYV EAKP+
Sbjct  481  LYVAEAKPK  489



>ref|XP_002445177.1| hypothetical protein SORBIDRAFT_07g005510 [Sorghum bicolor]
 gb|EES14672.1| hypothetical protein SORBIDRAFT_07g005510 [Sorghum bicolor]
Length=647

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 82/131 (63%), Gaps = 6/131 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKE-RGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTED  649
            E    +L  R+V+L  AK  R   TP SG   N    Q    G S ++FVRGFDK  +ED
Sbjct  439  EKQSTELQGREVRLDFAKGGRNTQTPRSG---NDGSFQKPARGTSNSIFVRGFDKELSED  495

Query  648  NIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS-S  475
             IRSAL+ HF  CG+I    IPTD E G IKGMAY++F D D++SKA+EL+ + +G    
Sbjct  496  EIRSALQEHFKKCGDITRVSIPTDYESGAIKGMAYMDFKDQDSVSKAIELSGTDIGGGYE  555

Query  474  LYVDEAKPRND  442
            LYVDEAKP+ D
Sbjct  556  LYVDEAKPKGD  566



>dbj|BAK02407.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGA---YTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL+ R V+L  A ERGA    T + G+F   S         S +VFV+GFD +  E
Sbjct  366  LNGGDLIGRPVRLDLAAERGASALRTRDGGSFGKPSGG------PSLSVFVKGFDSSQQE  419

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRS+L+ HF  CGEI    +P D E G  KG+AY++F D  + SKALEL+ S LG  +
Sbjct  420  DAIRSSLQEHFSKCGEITRVSVPMDHENGASKGIAYMDFTDESSFSKALELSGSDLGGCN  479

Query  474  LYVDEAKPR  448
            LYV EAKP+
Sbjct  480  LYVAEAKPK  488



>ref|XP_010500433.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=543

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 9/132 (7%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            EL+G+ LL R+++L  A+ERG   A+TP SG  +N       G G+  TVFV+GFD   +
Sbjct  347  ELHGRPLLGREIRLDIAQERGERPAFTPQSGG-NNFRSGGGGGDGQ--TVFVKGFDSAQS  403

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E++I+ AL  HFGSCGEI    +PTD E G  KG+AY+EF   +   KALELN S +G  
Sbjct  404  EEDIKHALREHFGSCGEITRVSVPTDRETGASKGIAYVEF--TEGKEKALELNGSDMGGW  461

Query  477  SLYVDEAKPRND  442
             L VDE +PR++
Sbjct  462  GLVVDEPRPRDN  473



>gb|KFK36056.1| hypothetical protein AALP_AA4G072000 [Arabis alpina]
Length=536

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 79/137 (58%), Gaps = 21/137 (15%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERG---AYTPNS------GAFDNssqrqsrggGESTTVFVRGF  670
            LNG+ LL RD++L  A ERG   AYTP S      G FD           E  TVFV+GF
Sbjct  353  LNGKPLLGRDIRLDMANERGERPAYTPQSNARSGGGGFD-----------EKPTVFVKGF  401

Query  669  DKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNS  493
            D +  ED+I++AL  HF SCGEI    +P D E G  KG+AYI+F+      KA EL+ S
Sbjct  402  DSSLAEDDIKNALGEHFASCGEITRVSVPIDRETGASKGIAYIDFSQVSEKEKAFELDGS  461

Query  492  QLGHSSLYVDEAKPRND  442
             LG  SL VDE +P+ D
Sbjct  462  DLGGYSLKVDEPRPKAD  478



>ref|XP_010479318.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=554

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 10/131 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            EL+G+ LL R+++L  A+ERG   A+TP SG     +  +S GGG+  TVFV+GFD   +
Sbjct  354  ELHGRPLLGREIRLDIAQERGERPAFTPQSGG----NNFRSGGGGDGQTVFVKGFDSAQS  409

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E++I+ AL  HFGSCGEI    +PTD E G  KG+AY+EF  ++   KALELN S +G  
Sbjct  410  EEDIKHALREHFGSCGEITRVSVPTDRETGASKGIAYVEF--SEGKEKALELNGSDMGGW  467

Query  477  SLYVDEAKPRN  445
             L VDE +PR+
Sbjct  468  GLVVDEPRPRD  478



>gb|EMS57596.1| Nucleolin [Triticum urartu]
Length=793

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 80/129 (62%), Gaps = 11/129 (9%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNS---GAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            LNG DL+ R V+L  A ERGA TP +   G+F   S         S +VFV+GFD +  E
Sbjct  589  LNGGDLMGRPVRLDMAAERGA-TPRTRDGGSFGKPSGG------PSLSVFVKGFDSSQQE  641

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            D IRS+L+ HF  CGEI    +P D E G  KG+AY++F D  + SKALEL+ S LG  +
Sbjct  642  DAIRSSLQEHFSKCGEITRVSVPMDYENGASKGIAYMDFTDESSFSKALELSGSDLGGCN  701

Query  474  LYVDEAKPR  448
            LYV EAKP+
Sbjct  702  LYVAEAKPK  710



>ref|XP_010461727.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=543

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 85/132 (64%), Gaps = 11/132 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            EL+G+ LL R+++L  A+ERG   A+TP SG           GGG+  TVFV+GFD + +
Sbjct  354  ELHGRPLLGREIRLDIAQERGERPAFTPQSGG-----NNFRSGGGDGQTVFVKGFDSSQS  408

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E++I+ AL  HFGSCGEI    +PT+ E G  KG+AY+EF   +   KALELN S +G  
Sbjct  409  EEDIKHALREHFGSCGEITRVSVPTERETGASKGIAYVEF--TEGKEKALELNGSDMGGW  466

Query  477  SLYVDEAKPRND  442
             L VDE +PR++
Sbjct  467  GLVVDEPRPRDN  478



>ref|XP_006406587.1| hypothetical protein EUTSA_v10020940mg [Eutrema salsugineum]
 gb|ESQ48040.1| hypothetical protein EUTSA_v10020940mg [Eutrema salsugineum]
Length=378

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 6/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGA--YTP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG+ LL RDV+L  A E+ A   TP +S A  N        G +S T+FVRGFD +  
Sbjct  187  ELNGKPLLGRDVRLDTANEKRASNTTPRSSNAARNYQSSDKGQGSQSKTIFVRGFDSSLG  246

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E  I+SAL  HF +CGEI    IPTDPE G I+G A+I+    D ++KALELN S++G  
Sbjct  247  EHEIKSALRDHFSACGEITRIAIPTDPETGAIRGNAFIDL--KDGLNKALELNGSEVGGR  304

Query  477  SLYVDEAKPRND  442
            ++ V +A PR +
Sbjct  305  NIMVSKALPRGE  316



>ref|XP_006406586.1| hypothetical protein EUTSA_v10020940mg [Eutrema salsugineum]
 gb|ESQ48039.1| hypothetical protein EUTSA_v10020940mg [Eutrema salsugineum]
Length=347

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 6/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGA--YTP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG+ LL RDV+L  A E+ A   TP +S A  N        G +S T+FVRGFD +  
Sbjct  156  ELNGKPLLGRDVRLDTANEKRASNTTPRSSNAARNYQSSDKGQGSQSKTIFVRGFDSSLG  215

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E  I+SAL  HF +CGEI    IPTDPE G I+G A+I+    D ++KALELN S++G  
Sbjct  216  EHEIKSALRDHFSACGEITRIAIPTDPETGAIRGNAFIDL--KDGLNKALELNGSEVGGR  273

Query  477  SLYVDEAKPRND  442
            ++ V +A PR +
Sbjct  274  NIMVSKALPRGE  285



>ref|XP_002891463.1| hypothetical protein ARALYDRAFT_474037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67722.1| hypothetical protein ARALYDRAFT_474037 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 83/135 (61%), Gaps = 14/135 (10%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG------AYTPNSGAFDNssqrqsrggGESTTVFVRGFDK  664
            E +G+ LL R+++L  A+ERG      AYTP SG + +          +   VFV+GFD 
Sbjct  353  EFHGRPLLGREIRLDIAQERGERGERPAYTPQSGNYKSGGDGG-----DEKKVFVKGFDS  407

Query  663  NDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQL  487
            + +ED+IR+AL  HF SCGEIK   +P D + G  KG+AY+ F+  +   KALELN S +
Sbjct  408  SLSEDDIRNALTEHFSSCGEIKSVSVPMDRDTGNSKGIAYVAFS--EGKEKALELNGSDM  465

Query  486  GHSSLYVDEAKPRND  442
            G  SL VDE +PR++
Sbjct  466  GGWSLVVDEPRPRDN  480



>ref|XP_009144995.1| PREDICTED: nucleolin 1-like [Brassica rapa]
 emb|CDY60074.1| BnaA05g36400D [Brassica napus]
Length=440

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            EL+G  +L RD++L  A+ERG   AYTP SGA          GGG   +VFV+GFD +  
Sbjct  256  ELHGTSMLGRDIRLDVAQERGERPAYTPQSGA----GGNFRSGGGGGQSVFVKGFDSSLP  311

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E++I+SAL  HF SCGEI    +P D E G  KG+AY++F   D   KA ELN S +G  
Sbjct  312  EEDIKSALSAHFASCGEITRVSVPCDRETGASKGIAYLDF--KDGTDKAFELNGSDMGGW  369

Query  477  SLYVDEAKPRN  445
            S+ VD+ + ++
Sbjct  370  SIVVDQPREKS  380



>emb|CDY65178.1| BnaCnng45920D [Brassica napus]
Length=482

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 77/130 (59%), Gaps = 12/130 (9%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            EL+G  +L RD++L  A+ERG   AYTP SGA  N             ++FV+GFD +  
Sbjct  294  ELHGTSMLGRDIRLDVAQERGERPAYTPQSGAGGNFRSSGGG----GQSIFVKGFDSSLP  349

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E++I+SAL  HF SCG+I    +P D E G  KG+AY++F   D   KA ELN S +G  
Sbjct  350  EEDIKSALSAHFASCGDITRVSVPCDRETGASKGIAYLDF--KDGTDKAFELNGSDMGGW  407

Query  477  SLYVDEAKPR  448
            S+ VD+  PR
Sbjct  408  SIVVDQ--PR  415



>gb|KFK39212.1| hypothetical protein AALP_AA3G213800 [Arabis alpina]
Length=544

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 77/132 (58%), Gaps = 6/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAY--TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            EL+G++LL R ++L  A E+  +  TP N     N    +   G +S T++V+GFD +  
Sbjct  361  ELHGKELLHRPIRLDFANEKKVFNTTPRNRNDSSNYQSTRRGEGSQSQTIYVKGFDNSLG  420

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E   R AL  HF SCGEI    +P D E G I+GMAYI+F   D   KALELN S+LG  
Sbjct  421  EREARDALREHFSSCGEISRIAVPNDRETGVIRGMAYIDF--KDGFDKALELNGSKLGGR  478

Query  477  SLYVDEAKPRND  442
             + V+EA PR D
Sbjct  479  KIVVNEAAPRGD  490



>gb|KFK39211.1| hypothetical protein AALP_AA3G213800 [Arabis alpina]
Length=543

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 77/132 (58%), Gaps = 6/132 (5%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAY--TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            EL+G++LL R ++L  A E+  +  TP N     N    +   G +S T++V+GFD +  
Sbjct  360  ELHGKELLHRPIRLDFANEKKVFNTTPRNRNDSSNYQSTRRGEGSQSQTIYVKGFDNSLG  419

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E   R AL  HF SCGEI    +P D E G I+GMAYI+F   D   KALELN S+LG  
Sbjct  420  EREARDALREHFSSCGEISRIAVPNDRETGVIRGMAYIDF--KDGFDKALELNGSKLGGR  477

Query  477  SLYVDEAKPRND  442
             + V+EA PR D
Sbjct  478  KIVVNEAAPRGD  489



>ref|XP_006393330.1| hypothetical protein EUTSA_v10011361mg [Eutrema salsugineum]
 gb|ESQ30616.1| hypothetical protein EUTSA_v10011361mg [Eutrema salsugineum]
Length=556

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 82/132 (62%), Gaps = 10/132 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            E +G+ LL RD++L  A+ERG   AYTP SG    + +     GG+  T+FV+GFD +  
Sbjct  361  EFHGRPLLGRDIRLDVAQERGERPAYTPQSGNAGGNFRSGGGDGGQ--TIFVKGFDSSLP  418

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E++I+SAL  HF SCGEI    +P D E G  KG+AYI+F   +   KA EL +  +G  
Sbjct  419  EEDIKSALSEHFASCGEITRVSVPMDRETGASKGIAYIQF--QETAEKAFELTD--MGGW  474

Query  477  SLYVDEAKPRND  442
            +L VDEAKPR +
Sbjct  475  NLVVDEAKPREN  486



>gb|KJB49997.1| hypothetical protein B456_008G149100, partial [Gossypium raimondii]
Length=296

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R V+L  A+ERGAYTP+S   +NS Q+  RG     T++VRGFD++  +D 
Sbjct  181  ELNGEYLMNRAVRLDLARERGAYTPHSSNGNNSFQKGGRGNVR--TIYVRGFDQSLGQDE  238

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKAL  508
            I+++L+ HFG CGEI    IP D E G +KG AY++F D D+ +KAL
Sbjct  239  IKNSLKEHFGPCGEISRVAIPVDWETGGVKGYAYLDFNDGDSFNKAL  285



>gb|KJB49998.1| hypothetical protein B456_008G149100, partial [Gossypium raimondii]
Length=294

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R V+L  A+ERGAYTP+S   +NS Q+  RG     T++VRGFD++  +D 
Sbjct  179  ELNGEYLMNRAVRLDLARERGAYTPHSSNGNNSFQKGGRGNVR--TIYVRGFDQSLGQDE  236

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKAL  508
            I+++L+ HFG CGEI    IP D E G +KG AY++F D D+ +KAL
Sbjct  237  IKNSLKEHFGPCGEISRVAIPVDWETGGVKGYAYLDFNDGDSFNKAL  283



>gb|KJB49999.1| hypothetical protein B456_008G149100, partial [Gossypium raimondii]
Length=304

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ L+ R V+L  A+ERGAYTP+S   +NS Q+  RG     T++VRGFD++  +D 
Sbjct  189  ELNGEYLMNRAVRLDLARERGAYTPHSSNGNNSFQKGGRGNVR--TIYVRGFDQSLGQDE  246

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKAL  508
            I+++L+ HFG CGEI    IP D E G +KG AY++F D D+ +KAL
Sbjct  247  IKNSLKEHFGPCGEISRVAIPVDWETGGVKGYAYLDFNDGDSFNKAL  293



>ref|XP_009107584.1| PREDICTED: nucleolin 1-like [Brassica rapa]
Length=583

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 81/132 (61%), Gaps = 10/132 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AY-TPNSGAFDNssqrqsrggGESTTVFVRGFDKND  658
            ELNG+ LL RD++L  A ERG   AY TP SG  +  S      G +   +FV+GFD + 
Sbjct  384  ELNGRALLGRDIRLDMAAERGDRPAYNTPQSGGGNFRSGGGGGEGQK---IFVKGFDSSL  440

Query  657  TEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGH  481
             E++IR AL  HF SCGEI    IP D E G  +G+AYI+F   +   KA +LN ++LG 
Sbjct  441  PEEDIRQALTQHFASCGEITRVSIPMDRETGASRGIAYIDF--KEGAEKAYDLNGTELGG  498

Query  480  SSLYVDEAKPRN  445
             ++ VDEAKPR+
Sbjct  499  WNIVVDEAKPRD  510



>ref|XP_006605422.1| PREDICTED: nucleolin 2-like isoform X3 [Glycine max]
 ref|XP_006605423.1| PREDICTED: nucleolin 2-like isoform X4 [Glycine max]
 ref|XP_006605424.1| PREDICTED: nucleolin 2-like isoform X5 [Glycine max]
 ref|XP_006605425.1| PREDICTED: nucleolin 2-like isoform X6 [Glycine max]
 ref|XP_006605426.1| PREDICTED: nucleolin 2-like isoform X7 [Glycine max]
Length=730

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  538  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  595

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  596  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  655

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  656  VEKAKPRRD  664


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  219  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  277



>ref|XP_006605428.1| PREDICTED: nucleolin 2-like isoform X9 [Glycine max]
Length=699

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  507  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  564

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  565  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  624

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  625  VEKAKPRRD  633


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  188  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  246



>ref|XP_006605427.1| PREDICTED: nucleolin 2-like isoform X8 [Glycine max]
Length=702

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  510  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  567

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  568  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  627

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  628  VEKAKPRRD  636


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  191  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  249



>ref|XP_006605438.1| PREDICTED: nucleolin 2-like isoform X19 [Glycine max]
 ref|XP_006605439.1| PREDICTED: nucleolin 2-like isoform X20 [Glycine max]
 ref|XP_006605440.1| PREDICTED: nucleolin 2-like isoform X21 [Glycine max]
Length=690

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  498  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  555

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  556  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  615

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  616  VEKAKPRRD  624


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  179  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  237



>ref|XP_006605429.1| PREDICTED: nucleolin 2-like isoform X10 [Glycine max]
Length=694

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  502  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  559

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  560  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  619

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  620  VEKAKPRRD  628


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  183  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  241



>ref|XP_006605421.1| PREDICTED: nucleolin 2-like isoform X2 [Glycine max]
Length=734

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  542  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  599

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  600  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  659

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  660  VEKAKPRRD  668


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  223  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  281



>ref|XP_006605420.1| PREDICTED: nucleolin 2-like isoform X1 [Glycine max]
Length=737

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  545  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  602

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  603  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  662

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  663  VEKAKPRRD  671


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  226  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  284



>ref|XP_006605430.1| PREDICTED: nucleolin 2-like isoform X11 [Glycine max]
 ref|XP_006605431.1| PREDICTED: nucleolin 2-like isoform X12 [Glycine max]
 ref|XP_006605432.1| PREDICTED: nucleolin 2-like isoform X13 [Glycine max]
 ref|XP_006605433.1| PREDICTED: nucleolin 2-like isoform X14 [Glycine max]
 ref|XP_006605434.1| PREDICTED: nucleolin 2-like isoform X15 [Glycine max]
 ref|XP_006605435.1| PREDICTED: nucleolin 2-like isoform X16 [Glycine max]
 ref|XP_006605436.1| PREDICTED: nucleolin 2-like isoform X17 [Glycine max]
 ref|XP_006605437.1| PREDICTED: nucleolin 2-like isoform X18 [Glycine max]
Length=690

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  498  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  555

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  556  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  615

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  616  VEKAKPRRD  624


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R+ LE  F  CGE+   R+ TD EG  +G  ++EFA  +A  KAL+LN ++L    + V
Sbjct  179  RADLENLFKPCGEVVDVRLHTDAEGRFRGFGHVEFATAEAAQKALQLNYTELLRCRIRV  237



>ref|XP_006605441.1| PREDICTED: nucleolin 2-like isoform X22 [Glycine max]
Length=672

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  480  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERA--QSPTVFVTGFDSSLPAEK  537

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  538  LKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFPLR  597

Query  468  VDEAKPRND  442
            V++AKPR D
Sbjct  598  VEKAKPRRD  606



>gb|KGN58514.1| hypothetical protein Csa_3G653460 [Cucumis sativus]
Length=690

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 14/120 (12%)
 Frame = -2

Query  798  RDVKLXXAKERGAYTPNSGAFDNssqrqsrggG---ESTTVFVRGFDKNDTEDNIRSALE  628
            R+V+L  A+E+G+YTP    +D+  +  S   G    S TVFVRGFD++  ED      E
Sbjct  502  REVRLDMAREKGSYTP----YDSRERNNSFQKGGRGPSQTVFVRGFDRSLGED------E  551

Query  627  GHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKP  451
             HFG+CG+I    IP D E G +KGMAY++F D+D+ +KALELN S+L  + L VDEAKP
Sbjct  552  DHFGACGDINRVSIPKDYETGNVKGMAYMDFGDSDSFNKALELNGSELHGNYLTVDEAKP  611



>emb|CDX77274.1| BnaC08g03190D [Brassica napus]
Length=579

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 80/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AY-TPNSGAFDNssqrqsrggGESTTVFVRGFDKND  658
            EL+G+ LL RD++L  A ERG   AY TP S            GGGE   +FV+GFD + 
Sbjct  389  ELHGRALLGRDIRLDLAAERGDRPAYNTPQS-----GGGNFRSGGGEGQKIFVKGFDSSL  443

Query  657  TEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGH  481
             E++IR AL  HF SCGEI    +P D E G  +G+AYI+F   +   KA +LN ++LG 
Sbjct  444  PEEDIRQALTQHFASCGEITRVSLPMDRETGASRGIAYIDF--KEGAEKAYDLNGTELGG  501

Query  480  SSLYVDEAKPRN  445
             ++ VDEAKPR+
Sbjct  502  WNIVVDEAKPRD  513



>ref|XP_006587954.1| PREDICTED: nucleolin 1-like [Glycine max]
Length=378

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  187  ELHNTELLRRPIGVDLAEEKGEYTYSRSNWSNSFQKCERD--QSPTVFVTGFDSSLPAEK  244

Query  645  IRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            I+++LE HFGSCGEI+   IPT    G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  245  IKASLEEHFGSCGEIQRISIPTFHDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFHLR  304

Query  468  VDEAKPRND  442
            V++AKPR +
Sbjct  305  VEKAKPRRE  313



>emb|CDX93706.1| BnaA06g03420D [Brassica napus]
Length=501

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 10/132 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            E +G+ LL R+++L  A+ERG   AYTP SG  +NS      G      VFV+GFD +  
Sbjct  325  EFHGRPLLGRELRLDVAQERGERPAYTPQSGTGNNSRSGGGGGQE----VFVKGFDSSLA  380

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
             ++I+SAL  HF SCGEI    +P D E G  +G+AY+EF   +   KA ELN S +G  
Sbjct  381  PNDIKSALTEHFASCGEITRVSVPVDRETGGSRGIAYVEF--KEGTEKAFELNGSDMGGW  438

Query  477  SLYVDEAKPRND  442
            +L VD+ +P+ +
Sbjct  439  NLVVDQPRPKEN  450



>ref|XP_009148215.1| PREDICTED: nucleolin 1-like [Brassica rapa]
Length=811

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 10/132 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            E +G+ LL R+++L  A+ERG   AYTP SG  +NS      G      VFV+GFD +  
Sbjct  636  EFHGRPLLGRELRLDVAQERGERPAYTPQSGTGNNSRSGGGGGQE----VFVKGFDSSLA  691

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
             ++I+SAL  HF SCGEI    +P D E G  +G+AY+EF   +   KA ELN S +G  
Sbjct  692  PNDIKSALTEHFASCGEITRVSVPVDRETGGSRGIAYVEF--KEGTEKAFELNGSDMGGW  749

Query  477  SLYVDEAKPRND  442
            +L VD+ +P+ +
Sbjct  750  NLVVDQPRPKEN  761



>emb|CDX93704.1| BnaA06g03440D [Brassica napus]
Length=682

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 10/130 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            E +G+ LL R+++L  A+ERG   AYTP SG  +NS      G      VFV+GFD +  
Sbjct  498  EFHGRPLLGRELRLDVAQERGERPAYTPQSGTGNNSRSGGGGGQE----VFVKGFDSSLA  553

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
             ++I+SAL  HF SCGEI    +P D E G  +G+AY+EF   +   KA ELN S +G  
Sbjct  554  PNDIKSALTEHFASCGEITRVSVPVDRETGGSRGIAYVEF--KEGTEKAFELNGSDMGGW  611

Query  477  SLYVDEAKPR  448
            +L VD+ +P+
Sbjct  612  NLVVDQPRPK  621



>ref|XP_009145877.1| PREDICTED: nucleolin 2-like [Brassica rapa]
Length=598

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +LNG+ LL R ++L  A  + A   +S A  N    +   G +  T+FV  FDK+  E +
Sbjct  423  KLNGKQLLGRTIRLSDANAKPAPR-SSNADGNFQSNRKGEGSQVKTIFVSRFDKSVAESD  481

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +R AL GHF  CGEI    +P D E G  +GMAY++  + D   KALELN S+LG   + 
Sbjct  482  MRCALRGHFSDCGEITRISLPCDQETGATRGMAYLDLKEEDGFKKALELNGSELGGWKIL  541

Query  468  VDEAKPR  448
            V E KPR
Sbjct  542  VLEGKPR  548



>ref|NP_175322.1| nucleolin like 1 [Arabidopsis thaliana]
 sp|Q9FVQ1.1|NUCL1_ARATH RecName: Full=Nucleolin 1; AltName: Full=Protein NUCLEOLIN LIKE 
1; Short=AtNUC-L1; AltName: Full=Protein PARALLEL 1; Short=AtPARL1 
[Arabidopsis thaliana]
 gb|AAG29744.1|AC084414_12 nuM1 protein, putative [Arabidopsis thaliana]
 gb|AAO64195.1| putative nucleolin [Arabidopsis thaliana]
 gb|AEE32367.1| nucleolin like 1 [Arabidopsis thaliana]
Length=557

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 79/133 (59%), Gaps = 15/133 (11%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG------AYTPNSGAFDNssqrqsrggGESTTVFVRGFDK  664
            E +G+ LL R+++L  A+ERG      A+TP SG F +          +   +FV+GFD 
Sbjct  356  EFHGRPLLGREIRLDIAQERGERGERPAFTPQSGNFRSGGDGG-----DEKKIFVKGFDA  410

Query  663  NDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQL  487
            + +ED+I++ L  HF SCGEIK   +P D + G  KG+AY+EF  ++   KALELN S +
Sbjct  411  SLSEDDIKNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEF--SEGKEKALELNGSDM  468

Query  486  GHS-SLYVDEAKP  451
            G    L VDE +P
Sbjct  469  GGGFYLVVDEPRP  481



>emb|CDY59893.1| BnaC06g40890D [Brassica napus]
Length=511

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 75/131 (57%), Gaps = 12/131 (9%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            E +G+ LL R+++L  A+ERG   AYTP SG  +N              VFV+GFD +  
Sbjct  332  EFHGRPLLGRELRLDVAQERGERPAYTPQSGTGNNFRSGGG----GGEEVFVKGFDSSLP  387

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
             ++I+SAL  HF SCGEI    +P D E G  +G+AY+EF   +   KA ELN S +G  
Sbjct  388  PNDIKSALREHFASCGEITRVSVPIDRETGGSRGIAYVEF--KEGTKKAFELNGSDMGGW  445

Query  477  SLYVDEAKPRN  445
            ++ VD+  PR 
Sbjct  446  NIVVDQ--PRQ  454



>gb|KHN29567.1| Polyadenylate-binding protein, cytoplasmic and nuclear [Glycine 
soja]
Length=623

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R + +  A+E+G YT +   + NS Q+  R   +S TVFV GFD +   + 
Sbjct  432  ELHNTELLRRPMGVDLAEEKGEYTYSRSNWSNSFQKCERD--QSPTVFVTGFDSSLPAEK  489

Query  645  IRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            I+++LE HFGSCGEI+   IPT    G +KG A++ F D  ++ KAL L+ ++LG   L 
Sbjct  490  IKASLEEHFGSCGEIQRISIPTFHDSGAVKGFAHLGFKDVVSVRKALHLDQNELGGFHLR  549

Query  468  VDEAKPRND  442
            V++AKPR +
Sbjct  550  VEKAKPRRE  558



>ref|XP_002983635.1| hypothetical protein SELMODRAFT_234317 [Selaginella moellendorffii]
 gb|EFJ15131.1| hypothetical protein SELMODRAFT_234317 [Selaginella moellendorffii]
Length=573

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 75/124 (60%), Gaps = 5/124 (4%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGEST--TVFVRGFDKNDTEDN  646
            +GQD+  R +    A  RG  TP SG   +       G  +++  TVFV+GFDK   ED+
Sbjct  375  SGQDMGGRRIYCDLANPRG--TPASGPKRDRPSPGFNGNRKTSGNTVFVKGFDKYQEEDS  432

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR +L  HF SCG I+  +IPTD E G IKG AYIEF+ + A +KA EL+ S L  S+L 
Sbjct  433  IRDSLTKHFKSCGTIERVKIPTDRETGNIKGFAYIEFSTDGAPAKAKELHGSDLDGSNLV  492

Query  468  VDEA  457
            VD+A
Sbjct  493  VDDA  496



>emb|CDX92252.1| BnaA05g21550D [Brassica napus]
Length=601

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 71/127 (56%), Gaps = 4/127 (3%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFD-NssqrqsrggGESTTVFVRGFDKNDTEDN  646
            LNG+ LL R ++L  A  + A  P S   D N    +   G +  T+FV  FDK+  E +
Sbjct  423  LNGKQLLGRTIRLSDANAKPA--PRSSNADGNFQSNRKGEGSQVKTIFVSRFDKSVAESD  480

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +R AL GHF  CGEI    +P D E G  +GMAY++  + D  +KAL LN S+LG   + 
Sbjct  481  MRCALRGHFSDCGEITRISLPCDQETGATRGMAYLDLKEEDGFNKALGLNGSELGGWKIL  540

Query  468  VDEAKPR  448
            V E KPR
Sbjct  541  VLEGKPR  547



>ref|XP_002990577.1| hypothetical protein SELMODRAFT_448081 [Selaginella moellendorffii]
 gb|EFJ08454.1| hypothetical protein SELMODRAFT_448081 [Selaginella moellendorffii]
Length=602

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 74/124 (60%), Gaps = 5/124 (4%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGEST--TVFVRGFDKNDTEDN  646
            +GQD+  R +    A  RG  TP SG   +       G  +++  TVFV+GFDK   ED+
Sbjct  404  SGQDMGGRRIYCDLANPRG--TPASGPKRDRPSPGFNGNRKTSGNTVFVKGFDKYQEEDS  461

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR +L  HF SCG I+  +IPTD E G IKG AYIEF+ + A +KA EL+ S L   +L 
Sbjct  462  IRESLTKHFKSCGTIERVKIPTDRETGNIKGFAYIEFSTDGAPAKAKELHGSDLDGCNLV  521

Query  468  VDEA  457
            VD+A
Sbjct  522  VDDA  525



>ref|XP_010487806.1| PREDICTED: nucleolin 2-like [Camelina sativa]
Length=639

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 75/131 (57%), Gaps = 5/131 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAY-TPNSG-AFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            +LNG+ LL R V    A ER  Y TP S  + DN      RGG     +FV+GFD +  E
Sbjct  497  QLNGKSLLGRIVYFDLACERVVYNTPRSSNSGDNYQSGGIRGGSRGQRIFVKGFDSSLDE  556

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
              IR AL  HF +CGE+    IPT+ E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  557  TEIRRALRTHFSTCGEVAWISIPTNRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  614

Query  474  LYVDEAKPRND  442
            + V EA+PR +
Sbjct  615  IVVQEARPRGE  625



>ref|XP_010507224.1| PREDICTED: nucleolin 2-like isoform X3 [Camelina sativa]
Length=656

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 75/131 (57%), Gaps = 5/131 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAY-TPN-SGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            +LNG+ LL R V L  A ER  Y TP  S A DN      RGG     +FV+GF  +  E
Sbjct  514  QLNGKSLLGRIVYLDLACERVVYNTPRRSNAGDNYQSGGIRGGIRGQRIFVKGFYSSLDE  573

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
              IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  574  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  631

Query  474  LYVDEAKPRND  442
            + V EA+PR +
Sbjct  632  IVVQEARPRGE  642



>ref|XP_010507230.1| PREDICTED: nucleolin 2-like isoform X4 [Camelina sativa]
Length=650

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 75/131 (57%), Gaps = 5/131 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAY-TPN-SGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            +LNG+ LL R V L  A ER  Y TP  S A DN      RGG     +FV+GF  +  E
Sbjct  508  QLNGKSLLGRIVYLDLACERVVYNTPRRSNAGDNYQSGGIRGGIRGQRIFVKGFYSSLDE  567

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
              IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  568  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  625

Query  474  LYVDEAKPRND  442
            + V EA+PR +
Sbjct  626  IVVQEARPRGE  636



>ref|XP_010507220.1| PREDICTED: nucleolin 2-like isoform X2 [Camelina sativa]
Length=657

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 75/131 (57%), Gaps = 5/131 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAY-TPN-SGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            +LNG+ LL R V L  A ER  Y TP  S A DN      RGG     +FV+GF  +  E
Sbjct  515  QLNGKSLLGRIVYLDLACERVVYNTPRRSNAGDNYQSGGIRGGIRGQRIFVKGFYSSLDE  574

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
              IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  575  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  632

Query  474  LYVDEAKPRND  442
            + V EA+PR +
Sbjct  633  IVVQEARPRGE  643



>ref|XP_001773240.1| predicted protein [Physcomitrella patens]
 gb|EDQ61930.1| predicted protein [Physcomitrella patens]
Length=799

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSG---AFDNssqrqsrggGESTTVFVRGFDKNDTED  649
            +GQ++  R++    A+ERGA TP  G   +   +   +    G   T +VRGFDK   E+
Sbjct  380  SGQNVEGREIWCDLARERGAATPGGGKDWSQTPNGGTRGGRSGGGQTAYVRGFDKFQDEE  439

Query  648  NIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSL  472
             IRS L   F  CG +   RIPTD E G IKG AY+EF   D ++KA EL+ S     SL
Sbjct  440  TIRSGLTKLFSDCGTVLNVRIPTDRESGQIKGFAYVEFGSKDEVNKAFELDGSDFNGRSL  499

Query  471  YVDEA  457
             V+EA
Sbjct  500  VVNEA  504



>ref|XP_002885266.1| hypothetical protein ARALYDRAFT_479366 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61525.1| hypothetical protein ARALYDRAFT_479366 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 11/128 (9%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A ERG    N G        +   G +S T+FVRGF+ +  ED 
Sbjct  371  ELNGKMLLGRDVRLDLANERGQRNSNPG--------RKGEGSQSRTIFVRGFNSSLGEDE  422

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            I+  L   F +CGE+    +PTD E G  +G+AYI+        +AL+L  S++G  +++
Sbjct  423  IKKELRSLFSNCGEVTRVHVPTDRETGACRGLAYIDL--TSGFDEALQLRGSEIGGWNIH  480

Query  468  VDEAKPRN  445
            V+E++PR+
Sbjct  481  VEESRPRD  488



>ref|XP_010507217.1| PREDICTED: nucleolin 2-like isoform X1 [Camelina sativa]
Length=680

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 75/131 (57%), Gaps = 5/131 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAY-TPN-SGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            +LNG+ LL R V L  A ER  Y TP  S A DN      RGG     +FV+GF  +  E
Sbjct  538  QLNGKSLLGRIVYLDLACERVVYNTPRRSNAGDNYQSGGIRGGIRGQRIFVKGFYSSLDE  597

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
              IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  598  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  655

Query  474  LYVDEAKPRND  442
            + V EA+PR +
Sbjct  656  IVVQEARPRGE  666



>ref|XP_010466013.1| PREDICTED: nucleolin 2-like isoform X12 [Camelina sativa]
Length=1010

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
            +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  868  QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  927

Query  651  DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
              IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  928  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  985

Query  474  LYVDEAKPRND  442
            + V EA+PR +
Sbjct  986  IVVQEARPRGE  996



>dbj|BAB02219.1| unnamed protein product [Arabidopsis thaliana]
Length=610

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NG+ LL RDV+L  A ERG  TP      NS+  +   G +S T++VRGF  +  ED 
Sbjct  416  EMNGKLLLGRDVRLDLANERG--TPR-----NSNPGRKGEGSQSRTIYVRGFSSSLGEDE  468

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            I+  L  HF  CGE+    +PTD E G  +G AYI+        +AL+L+ S++G  +++
Sbjct  469  IKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDL--TSGFDEALQLSGSEIGGGNIH  526

Query  468  VDEAKPRN  445
            V+E++PR+
Sbjct  527  VEESRPRD  534



>ref|NP_188491.1| protein NUCLEOLIN LIKE 2 [Arabidopsis thaliana]
 sp|Q1PEP5.1|NUCL2_ARATH RecName: Full=Nucleolin 2; AltName: Full=Protein NUCLEOLIN LIKE 
2; Short=AtNUC-L2; AltName: Full=Protein PARALLEL LIKE 1; 
Short=AtPARLL1 [Arabidopsis thaliana]
 gb|ABE65946.1| nucleolin [Arabidopsis thaliana]
 gb|AEE76122.1| nucleolin like 2 [Arabidopsis thaliana]
Length=636

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            E+NG+ LL RDV+L  A ERG  TP      NS+  +   G +S T++VRGF  +  ED 
Sbjct  442  EMNGKLLLGRDVRLDLANERG--TPR-----NSNPGRKGEGSQSRTIYVRGFSSSLGEDE  494

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            I+  L  HF  CGE+    +PTD E G  +G AYI+        +AL+L+ S++G  +++
Sbjct  495  IKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDL--TSGFDEALQLSGSEIGGGNIH  552

Query  468  VDEAKPRN  445
            V+E++PR+
Sbjct  553  VEESRPRD  560



>ref|XP_010466007.1| PREDICTED: nucleolin 2-like isoform X7 [Camelina sativa]
Length=1100

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  958   QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  1017

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  1018  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1075

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1076  IVVQEARPRGE  1086



>ref|XP_010466010.1| PREDICTED: nucleolin 2-like isoform X9 [Camelina sativa]
Length=1070

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  928   QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  987

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  988   TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1045

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1046  IVVQEARPRGE  1056



>ref|XP_010466011.1| PREDICTED: nucleolin 2-like isoform X10 [Camelina sativa]
Length=1045

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  903   QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  962

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  963   TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1020

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1021  IVVQEARPRGE  1031



>ref|XP_010466005.1| PREDICTED: nucleolin 2-like isoform X5 [Camelina sativa]
Length=1133

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  991   QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  1050

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  1051  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1108

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1109  IVVQEARPRGE  1119



>ref|XP_010466003.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Camelina 
sativa]
Length=1159

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  1017  QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  1076

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  1077  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1134

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1135  IVVQEARPRGE  1145



>ref|XP_010466000.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Camelina 
sativa]
 ref|XP_010466001.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Camelina 
sativa]
 ref|XP_010466002.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Camelina 
sativa]
Length=1160

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  1018  QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  1077

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  1078  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1135

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1136  IVVQEARPRGE  1146



>ref|XP_010466004.1| PREDICTED: dentin sialophosphoprotein-like isoform X4 [Camelina 
sativa]
Length=1153

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  1011  QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  1070

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  1071  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1128

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1129  IVVQEARPRGE  1139



>ref|XP_010466008.1| PREDICTED: nucleolin 2-like isoform X8 [Camelina sativa]
Length=1099

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  957   QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  1016

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  1017  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1074

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1075  IVVQEARPRGE  1085



>ref|XP_010466006.1| PREDICTED: nucleolin 2-like isoform X6 [Camelina sativa]
Length=1129

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = -2

Query  825   ELNGQDLLXRDVKLXXAKERGAY-TP-NSGAFDNssqrqsrggGESTTVFVRGFDKNDTE  652
             +LNG+ LL R V L  A ER  Y TP +S A DN      RGG     +FV+GFD +  E
Sbjct  987   QLNGKSLLGRIVHLDLASERVVYNTPRSSNAGDNYQSGGIRGGSRGQRIFVKGFDYSLDE  1046

Query  651   DNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
               IR AL  HF +CGE+    IPTD E G IKG+A+I+    D  +KAL+LN S++    
Sbjct  1047  TEIRRALRTHFSTCGEVAWISIPTDRETGAIKGIAFIDL--KDGFTKALQLNGSEIRGWK  1104

Query  474   LYVDEAKPRND  442
             + V EA+PR +
Sbjct  1105  IVVQEARPRGE  1115



>emb|CDX99340.1| BnaC05g34550D [Brassica napus]
Length=625

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 72/126 (57%), Gaps = 2/126 (2%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            +NG+ LL R ++L  A  + A   +S A  N    +   G +  T+FV  FDK+  E ++
Sbjct  437  MNGKPLLGRTIRLSDANAKPAPR-SSNADGNFQSNRKGEGSQVKTIFVSKFDKSVAERDM  495

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
              AL  HF  CGEI    +P D E G  +GMAY++F + D  +KALELN S+LG  ++ V
Sbjct  496  ICALREHFSDCGEITRISLPCDQETGATRGMAYLDFINEDGFNKALELNGSELGGWNILV  555

Query  465  DEAKPR  448
             E KPR
Sbjct  556  LEGKPR  561



>ref|XP_009145876.1| PREDICTED: nucleolin 2-like [Brassica rapa]
Length=278

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 75/127 (59%), Gaps = 17/127 (13%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +LNG+ LL R++ L  A  + A  P +                  T+FV GF+K+ +ED 
Sbjct  139  KLNGEPLLGRNILLDFANTKPAPRPQNLV---------------KTIFVTGFNKSLSEDE  183

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +++AL  HF +CGEIK   +P   E G  KG+AY++F++ D  +KA+ELN S+LG  ++ 
Sbjct  184  MKTALRAHFSACGEIKRISLPYYQETGDSKGVAYLDFSE-DGFNKAMELNGSELGGRNIV  242

Query  468  VDEAKPR  448
            V EA+P+
Sbjct  243  VIEARPK  249



>ref|XP_010507033.1| PREDICTED: nucleolin 2-like isoform X3 [Camelina sativa]
Length=633

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 9/128 (7%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A E G  TP S             G +   ++VRGFD +  ED 
Sbjct  448  ELNGKPLLGRDVRLDLANEIGNRTPRSNPV------SYGVGSQFRKLYVRGFDTSLGEDE  501

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++ A   HF +CGE+    +PTD E G ++GMAY++        +AL+L+ S++G   L 
Sbjct  502  LKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYVDM--KSGFDEALQLSGSEMGGGFLT  559

Query  468  VDEAKPRN  445
            V+EA+PR+
Sbjct  560  VEEARPRD  567



>ref|XP_010507028.1| PREDICTED: nucleolin 2-like isoform X1 [Camelina sativa]
Length=686

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 9/128 (7%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A E G  TP S             G +   ++VRGFD +  ED 
Sbjct  501  ELNGKPLLGRDVRLDLANEIGNRTPRSNPV------SYGVGSQFRKLYVRGFDTSLGEDE  554

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++ A   HF +CGE+    +PTD E G ++GMAY++        +AL+L+ S++G   L 
Sbjct  555  LKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYVDM--KSGFDEALQLSGSEMGGGFLT  612

Query  468  VDEAKPRN  445
            V+EA+PR+
Sbjct  613  VEEARPRD  620



>ref|XP_010465970.1| PREDICTED: nucleolin 2-like [Camelina sativa]
Length=642

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 75/128 (59%), Gaps = 8/128 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A E G  TP S     S+      G +   ++VRGFD +  ED 
Sbjct  451  ELNGKPLLGRDVRLDLANEMGNRTPRS-----SNPVSYGVGSQFRKLYVRGFDTSLGEDE  505

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++ A   HF +CGE+    +PTD E G ++GMAY++        +AL+L+ S++G   L 
Sbjct  506  LKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYVDM--KSGFDEALQLSGSEMGGGFLT  563

Query  468  VDEAKPRN  445
            V+EA+PR+
Sbjct  564  VEEARPRD  571



>ref|XP_010507032.1| PREDICTED: nucleolin 2-like isoform X2 [Camelina sativa]
Length=685

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 9/128 (7%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A E G  TP S             G +   ++VRGFD +  ED 
Sbjct  500  ELNGKPLLGRDVRLDLANEIGNRTPRSNPV------SYGVGSQFRKLYVRGFDTSLGEDE  553

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++ A   HF +CGE+    +PTD E G ++GMAY++        +AL+L+ S++G   L 
Sbjct  554  LKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYVDM--KSGFDEALQLSGSEMGGGFLT  611

Query  468  VDEAKPRN  445
            V+EA+PR+
Sbjct  612  VEEARPRD  619



>ref|XP_010489916.1| PREDICTED: nucleolin 2-like [Camelina sativa]
Length=780

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 73/128 (57%), Gaps = 8/128 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG  LL RDV+L  A E G  TP S      +      G +   ++VRGFD +  ED 
Sbjct  589  ELNGNPLLGRDVRLDLANEMGHRTPRSS-----NPVSYGVGSQFRKLYVRGFDTSLGEDE  643

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++ A   HF +CGE+    +PTD E G ++GMAYI+        +AL+L+ S++G   L 
Sbjct  644  LKDAFRNHFSTCGEVGRISLPTDRESGVMRGMAYIDM--KSGFDEALQLSGSEMGGGFLT  701

Query  468  VDEAKPRN  445
            V+EA+PR+
Sbjct  702  VEEARPRD  709



>gb|KHM99054.1| Protein gar2 [Glycine soja]
Length=736

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  699  ESTTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDA  523
            +S TVFV GFD +   + ++++LE HFGSCGEI+   IPT P+ G +KG A++ F D  +
Sbjct  537  QSPTVFVTGFDSSLPAEKLKASLEEHFGSCGEIQRISIPTFPDSGAVKGFAHLGFKDVVS  596

Query  522  MSKALELNNSQLGHSSLYVDEAKPRND  442
            + KAL L+ ++LG   L V++AKPR D
Sbjct  597  VRKALHLDQNELGGFPLRVEKAKPRRD  623



>emb|CDX92253.1| BnaA05g21540D [Brassica napus]
Length=282

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 74/127 (58%), Gaps = 17/127 (13%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +LNG+ LL R++ L  A  + A  P +                  T+FV GF+K+ +ED 
Sbjct  143  KLNGEPLLGRNILLDFANAKPAPRPRNLV---------------KTIFVTGFNKSLSEDE  187

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +++AL  HF +CGEIK   +P   E G  KG+AY++F + D  +KA+ELN S++G  ++ 
Sbjct  188  MKTALRAHFSACGEIKRISLPYYQETGDSKGVAYLDFGE-DGFNKAMELNGSEVGGRNIV  246

Query  468  VDEAKPR  448
            V EA+P+
Sbjct  247  VIEARPK  253



>emb|CDX99339.1| BnaC05g34540D [Brassica napus]
Length=586

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 17/127 (13%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +LNG+ LL R++ L  A  + A  P +                  T+FV GF+K+ +ED 
Sbjct  454  KLNGKPLLGRNILLDFANAKPAPRPRNLV---------------KTIFVTGFNKSLSEDE  498

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +++AL  HF  CGEIK   +P   E G  KG+AY++F++ D  +KA+ELN S+LG  ++ 
Sbjct  499  MKTALRAHFSDCGEIKRISLPYYQETGDSKGVAYLDFSE-DGFNKAMELNGSELGGRNIV  557

Query  468  VDEAKPR  448
            V EA+P+
Sbjct  558  VIEARPK  564


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 70/127 (55%), Gaps = 5/127 (4%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            +LNG+ LL R +KL    +  A  P S   D + QR      +  T+ V+   K   ED 
Sbjct  159  KLNGKPLLGRKIKLDDFNKNPA--PRSSNADGNFQRGEGS--QVKTILVKKNGKYVGEDE  214

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            +++AL  HF +CGEI    IP D + G  KGMA++ F + D  +KALELN S+LG  ++ 
Sbjct  215  MKTALRDHFSACGEITRFAIPCDQDTGATKGMAFLGFINEDGFNKALELNGSELGGRNIV  274

Query  468  VDEAKPR  448
            V EA  R
Sbjct  275  VTEASTR  281



>gb|EAY95603.1| hypothetical protein OsI_17455 [Oryza sativa Indica Group]
Length=667

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 67/129 (52%), Gaps = 30/129 (23%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL G DL+ R V+L  A+ERGAYTP SG  DNSS ++        T+F++GFD +     
Sbjct  494  ELAGHDLMGRPVRLDLARERGAYTPGSGR-DNSSFKKPAQSS-GNTIFIKGFDTSLDIHQ  551

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            IR++LE HFGSCGEI    IP D E G  KG                           LY
Sbjct  552  IRNSLEEHFGSCGEITRVSIPKDYETGASKG---------------------------LY  584

Query  468  VDEAKPRND  442
            VDEA+PR D
Sbjct  585  VDEARPRPD  593



>ref|XP_004513591.1| PREDICTED: RNA-binding protein 28-like isoform X3 [Cicer arietinum]
Length=618

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 75/130 (58%), Gaps = 10/130 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGEST---TVFVRGFDKNDT  655
            EL+ ++L+ R +K+  A + G        F N S   S   GE+    TVFV GFD +  
Sbjct  445  ELDHRELMNRPIKVGTASKEGE------CFHNRSLSISFQKGENLHPLTVFVIGFDTSIA  498

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E+ I+++L+ HF  CGEI    +P  P+ G +KG A+++F D D   KAL+L+ + +G  
Sbjct  499  EEKIKASLKRHFSPCGEITRISLPRFPDSGTVKGFAHLDFKDVDGYKKALQLDQTAIGDY  558

Query  477  SLYVDEAKPR  448
             L V++AKPR
Sbjct  559  WLSVEKAKPR  568


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 4/85 (5%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  517
            S T++VR    +      R+ +E  F  CGE+   R  TD EG  +G  +IEF   +A  
Sbjct  138  SKTIYVRNLSYSVE----RADMENLFKDCGELVAVRFNTDREGRFRGFGHIEFGTEEAAQ  193

Query  516  KALELNNSQLGHSSLYVDEAKPRND  442
            KALEL+N++L    + V  A  +N+
Sbjct  194  KALELDNTELLRRRIKVGIALEKNE  218


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 64/152 (42%), Gaps = 34/152 (22%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R +K+  A E+  Y P   +F            +S TV  +GFD +  E+ 
Sbjct  197  ELDNTELLRRRIKVGIALEKNEYAPYGSSFPKGGNL------QSHTV--KGFDTSLVENK  248

Query  645  IRSA--------------------------LEGHFGSCGEIKGTRIPTDPEGYIKGMAYI  544
             +S                           +E  F  CGEI   R+ +D EG  KG  ++
Sbjct  249  PKSPATPNESLAASKTIYVRNLSYIVERTDMENLFKGCGEIVDIRLHSDREGRFKGFGHV  308

Query  543  EFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
            +FA  +A  KAL L+N +    ++ V  A  R
Sbjct  309  QFATAEAAQKALALDNVEFFKRNIIVGIASER  340



>ref|XP_004513590.1| PREDICTED: RNA-binding protein 28-like isoform X2 [Cicer arietinum]
Length=628

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 75/130 (58%), Gaps = 10/130 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGEST---TVFVRGFDKNDT  655
            EL+ ++L+ R +K+  A + G        F N S   S   GE+    TVFV GFD +  
Sbjct  455  ELDHRELMNRPIKVGTASKEGE------CFHNRSLSISFQKGENLHPLTVFVIGFDTSIA  508

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E+ I+++L+ HF  CGEI    +P  P+ G +KG A+++F D D   KAL+L+ + +G  
Sbjct  509  EEKIKASLKRHFSPCGEITRISLPRFPDSGTVKGFAHLDFKDVDGYKKALQLDQTAIGDY  568

Query  477  SLYVDEAKPR  448
             L V++AKPR
Sbjct  569  WLSVEKAKPR  578


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 4/85 (5%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  517
            S T++VR    +      R+ +E  F  CGE+   R  TD EG  +G  +IEF   +A  
Sbjct  135  SKTIYVRNLSYSVE----RADMENLFKDCGELVAVRFNTDREGRFRGFGHIEFGTEEAAQ  190

Query  516  KALELNNSQLGHSSLYVDEAKPRND  442
            KALEL+N++L    + V  A  +N+
Sbjct  191  KALELDNTELLRRRIKVGIALEKNE  215


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 64/152 (42%), Gaps = 34/152 (22%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R +K+  A E+  Y P   +F            +S TV  +GFD +  E+ 
Sbjct  194  ELDNTELLRRRIKVGIALEKNEYAPYGSSFPKGGNL------QSHTV--KGFDTSLVENK  245

Query  645  IRSA--------------------------LEGHFGSCGEIKGTRIPTDPEGYIKGMAYI  544
             +S                           +E  F  CGEI   R+ +D EG  KG  ++
Sbjct  246  PKSPATPNESLAASKTIYVRNLSYIVERTDMENLFKGCGEIVDIRLHSDREGRFKGFGHV  305

Query  543  EFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
            +FA  +A  KAL L+N +    ++ V  A  R
Sbjct  306  QFATAEAAQKALALDNVEFFKRNIIVGIASER  337



>ref|XP_004513589.1| PREDICTED: RNA-binding protein 28-like isoform X1 [Cicer arietinum]
Length=631

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 75/130 (58%), Gaps = 10/130 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGEST---TVFVRGFDKNDT  655
            EL+ ++L+ R +K+  A + G        F N S   S   GE+    TVFV GFD +  
Sbjct  458  ELDHRELMNRPIKVGTASKEGE------CFHNRSLSISFQKGENLHPLTVFVIGFDTSIA  511

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHS  478
            E+ I+++L+ HF  CGEI    +P  P+ G +KG A+++F D D   KAL+L+ + +G  
Sbjct  512  EEKIKASLKRHFSPCGEITRISLPRFPDSGTVKGFAHLDFKDVDGYKKALQLDQTAIGDY  571

Query  477  SLYVDEAKPR  448
             L V++AKPR
Sbjct  572  WLSVEKAKPR  581


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 4/85 (5%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  517
            S T++VR    N +    R+ +E  F  CGE+   R  TD EG  +G  +IEF   +A  
Sbjct  138  SKTIYVR----NLSYSVERADMENLFKDCGELVAVRFNTDREGRFRGFGHIEFGTEEAAQ  193

Query  516  KALELNNSQLGHSSLYVDEAKPRND  442
            KALEL+N++L    + V  A  +N+
Sbjct  194  KALELDNTELLRRRIKVGIALEKNE  218


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 64/152 (42%), Gaps = 34/152 (22%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            EL+  +LL R +K+  A E+  Y P   +F            +S TV  +GFD +  E+ 
Sbjct  197  ELDNTELLRRRIKVGIALEKNEYAPYGSSFPKGGNL------QSHTV--KGFDTSLVENK  248

Query  645  IRSA--------------------------LEGHFGSCGEIKGTRIPTDPEGYIKGMAYI  544
             +S                           +E  F  CGEI   R+ +D EG  KG  ++
Sbjct  249  PKSPATPNESLAASKTIYVRNLSYIVERTDMENLFKGCGEIVDIRLHSDREGRFKGFGHV  308

Query  543  EFADNDAMSKALELNNSQLGHSSLYVDEAKPR  448
            +FA  +A  KAL L+N +    ++ V  A  R
Sbjct  309  QFATAEAAQKALALDNVEFFKRNIIVGIASER  340



>ref|XP_007156397.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
 gb|ESW28391.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
Length=664

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            L+  +L  R +++  A+E+ +Y+ +   + NS         +S  V+V+GFD +  E+ I
Sbjct  505  LDHTELFGRPIRVELAREK-SYSYSKSHWSNSF--------QSLAVYVKGFDCSLMEEEI  555

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            ++ LE HFGSCGEI    IP   + G  KG A ++F D D++ +ALEL+ +++G  +L V
Sbjct  556  KANLEEHFGSCGEITRISIPKFYDSGAFKGFAVLDFKDLDSVKRALELDQTEIGGYTLLV  615

Query  465  DEAKPRND  442
            ++A+ R D
Sbjct  616  EKARARRD  623


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  642  RSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  463
            R+ LE  F  CGEI   R+ TD EG  +G  ++EFA  +A+ KAL+LNN++L    + + 
Sbjct  175  RADLEILFKDCGEIVDVRLHTDYEGRFRGFGHVEFATEEAVLKALKLNNTELLRCRIRIG  234

Query  462  EAKPR  448
             A  R
Sbjct  235  VAPAR  239



>ref|XP_007156398.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
 gb|ESW28392.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
Length=800

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            L+  +L  R +++  A+E+ +Y+ +   + NS         +S  V+V+GFD +  E+ I
Sbjct  641  LDHTELFGRPIRVELAREK-SYSYSKSHWSNSF--------QSLAVYVKGFDCSLMEEEI  691

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            ++ LE HFGSCGEI    IP   + G  KG A ++F D D++ +ALEL+ +++G  +L V
Sbjct  692  KANLEEHFGSCGEITRISIPKFYDSGAFKGFAVLDFKDLDSVKRALELDQTEIGGYTLLV  751

Query  465  DEAKPRND  442
            ++A+ R D
Sbjct  752  EKARARRD  759


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -2

Query  672  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNS  493
            + KN +    R+ LE  F  CGEI   R+ TD EG  +G  ++EFA  +A+ KAL+LNN+
Sbjct  165  YTKNLSYSVERADLEILFKDCGEIVDVRLHTDYEGRFRGFGHVEFATEEAVLKALKLNNT  224

Query  492  QLGHSSLYVDEAKPR  448
            +L    + +  A  R
Sbjct  225  ELLRCRIRIGVAPAR  239


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 4/81 (5%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  517
            S T++V+       + ++    E  F  CGEI   R+  D EG +KG  +IEFA  +A  
Sbjct  445  SKTIYVKNLSYRVEQADV----EFFFKECGEIIDVRLHRDNEGRLKGFGHIEFATAEAAL  500

Query  516  KALELNNSQLGHSSLYVDEAK  454
            KALEL+N++L    + V+ A+
Sbjct  501  KALELDNTELLRRCIGVEIAR  521



>ref|XP_007156396.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
 gb|ESW28390.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
Length=676

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            L+  +L  R +++  A+E+ +Y+ +   + NS         +S  V+V+GFD +  E+ I
Sbjct  505  LDHTELFGRPIRVELAREK-SYSYSKSHWSNSF--------QSLAVYVKGFDCSLMEEEI  555

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            ++ LE HFGSCGEI    IP   + G  KG A ++F D D++ +ALEL+ +++G  +L V
Sbjct  556  KANLEEHFGSCGEITRISIPKFYDSGAFKGFAVLDFKDLDSVKRALELDQTEIGGYTLLV  615

Query  465  DEAKPRND  442
            ++A+ R D
Sbjct  616  EKARARRD  623


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -2

Query  672  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNS  493
            + KN +    R+ LE  F  CGEI   R+ TD EG  +G  ++EFA  +A+ KAL+LNN+
Sbjct  165  YTKNLSYSVERADLEILFKDCGEIVDVRLHTDYEGRFRGFGHVEFATEEAVLKALKLNNT  224

Query  492  QLGHSSLYVDEAKPR  448
            +L    + +  A  R
Sbjct  225  ELLRCRIRIGVAPAR  239



>ref|XP_006297116.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
 gb|EOA30014.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
Length=596

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A E    TP S     S+  +   G +S  +FV GF+ +  ED 
Sbjct  411  ELNGRSLLGRDVRLDLANESARNTPRS-----SNPGRIAEGSQSRKLFVNGFNSSLGEDE  465

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++SA    F +CGE+    IP D E G I+GMA+I+       ++AL+L  S +G  ++ 
Sbjct  466  LKSAFRTLFSTCGEVARISIPVDRETGAIRGMAFIDM--KSGFNEALQLGGSDIGGRNIT  523

Query  468  VDEAKPR  448
            V+EA+PR
Sbjct  524  VEEARPR  530



>ref|XP_007156395.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
 gb|ESW28389.1| hypothetical protein PHAVU_003G282900g [Phaseolus vulgaris]
Length=812

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            L+  +L  R +++  A+E+ +Y+ +   + NS         +S  V+V+GFD +  E+ I
Sbjct  641  LDHTELFGRPIRVELAREK-SYSYSKSHWSNSF--------QSLAVYVKGFDCSLMEEEI  691

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            ++ LE HFGSCGEI    IP   + G  KG A ++F D D++ +ALEL+ +++G  +L V
Sbjct  692  KANLEEHFGSCGEITRISIPKFYDSGAFKGFAVLDFKDLDSVKRALELDQTEIGGYTLLV  751

Query  465  DEAKPRND  442
            ++A+ R D
Sbjct  752  EKARARRD  759


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -2

Query  672  FDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNS  493
            + KN +    R+ LE  F  CGEI   R+ TD EG  +G  ++EFA  +A+ KAL+LNN+
Sbjct  165  YTKNLSYSVERADLEILFKDCGEIVDVRLHTDYEGRFRGFGHVEFATEEAVLKALKLNNT  224

Query  492  QLGHSSLYVDEAKPR  448
            +L    + +  A  R
Sbjct  225  ELLRCRIRIGVAPAR  239


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 4/81 (5%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  517
            S T++V+       + ++    E  F  CGEI   R+  D EG +KG  +IEFA  +A  
Sbjct  445  SKTIYVKNLSYRVEQADV----EFFFKECGEIIDVRLHRDNEGRLKGFGHIEFATAEAAL  500

Query  516  KALELNNSQLGHSSLYVDEAK  454
            KALEL+N++L    + V+ A+
Sbjct  501  KALELDNTELLRRCIGVEIAR  521



>ref|XP_006297117.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
 gb|EOA30015.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
Length=634

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 72/127 (57%), Gaps = 8/127 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A E    TP S      +  +   G +S  +FV GF+ +  ED 
Sbjct  449  ELNGRSLLGRDVRLDLANESARNTPRSS-----NPGRIAEGSQSRKLFVNGFNSSLGEDE  503

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++SA    F +CGE+    IP D E G I+GMA+I+       ++AL+L  S +G  ++ 
Sbjct  504  LKSAFRTLFSTCGEVARISIPVDRETGAIRGMAFIDM--KSGFNEALQLGGSDIGGRNIT  561

Query  468  VDEAKPR  448
            V+EA+PR
Sbjct  562  VEEARPR  568



>ref|XP_011396887.1| Protein gar2 [Auxenochlorella protothecoides]
 gb|KFM24009.1| Protein gar2 [Auxenochlorella protothecoides]
Length=283

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 66/112 (59%), Gaps = 10/112 (9%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            L+GQ+L  R+V +    ER   TP    F            E  T+FV+GFD +  ED++
Sbjct  159  LSGQELAGREVYIESTTEREQRTPGQDRF---------AASEGQTLFVKGFDSSLGEDDV  209

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQ  490
            R+AL   FG+ GE+   R+PTD E G ++G+ ++EF+ ++A + A+EL+ ++
Sbjct  210  RAALTEAFGAYGEVTNVRLPTDRETGSMRGIGFVEFSTSEAKNAAIELDGAE  261



>ref|XP_006297118.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
 gb|EOA30016.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
Length=660

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 72/127 (57%), Gaps = 8/127 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A E    TP S      +  +   G +S  +FV GF+ +  ED 
Sbjct  475  ELNGRSLLGRDVRLDLANESARNTPRSS-----NPGRIAEGSQSRKLFVNGFNSSLGEDE  529

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++SA    F +CGE+    IP D E G I+GMA+I+       ++AL+L  S +G  ++ 
Sbjct  530  LKSAFRTLFSTCGEVARISIPVDRETGAIRGMAFIDM--KSGFNEALQLGGSDIGGRNIT  587

Query  468  VDEAKPR  448
            V+EA+PR
Sbjct  588  VEEARPR  594



>ref|XP_006297119.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
 gb|EOA30017.1| hypothetical protein CARUB_v10013117mg [Capsella rubella]
Length=686

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 72/127 (57%), Gaps = 8/127 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDN  646
            ELNG+ LL RDV+L  A E    TP S      +  +   G +S  +FV GF+ +  ED 
Sbjct  501  ELNGRSLLGRDVRLDLANESARNTPRSS-----NPGRIAEGSQSRKLFVNGFNSSLGEDE  555

Query  645  IRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLY  469
            ++SA    F +CGE+    IP D E G I+GMA+I+       ++AL+L  S +G  ++ 
Sbjct  556  LKSAFRTLFSTCGEVARISIPVDRETGAIRGMAFIDM--KSGFNEALQLGGSDIGGRNIT  613

Query  468  VDEAKPR  448
            V+EA+PR
Sbjct  614  VEEARPR  620



>ref|XP_005849687.1| hypothetical protein CHLNCDRAFT_143267 [Chlorella variabilis]
 gb|EFN57585.1| hypothetical protein CHLNCDRAFT_143267 [Chlorella variabilis]
Length=521

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 10/121 (8%)
 Frame = -2

Query  822  LNGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNI  643
            L+G+ L+ R++ +    ER   TP    F            + TT+FV+G+D +  ED +
Sbjct  319  LSGESLMDRELYIESTTERQQRTPGENRF---------ATSDGTTIFVKGYDSSLGEDEV  369

Query  642  RSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYV  466
            R  L   FG  G +   R+PTD + G +KG+ +IEF   DA  KA+EL+ S++    + V
Sbjct  370  RRQLTEAFGEVGAVVSVRLPTDRDTGELKGIGFIEFESTDAKHKAVELDGSEVAGGWIKV  429

Query  465  D  463
            D
Sbjct  430  D  430



>gb|AAF69708.1|AC016041_13 F27J15.29 [Arabidopsis thaliana]
Length=193

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -2

Query  687  VFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKA  511
            +FV+GFD + +ED+I++ L  HF SCGEIK   +P D + G  KG+AY+EF+  +   KA
Sbjct  47   IFVKGFDASLSEDDIKNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFS--EGKEKA  104

Query  510  LELNNSQLGHS-SLYVDEAKP  451
            LELN S +G    L VDE +P
Sbjct  105  LELNGSDMGGGFYLVVDEPRP  125



>ref|XP_001757595.1| predicted protein [Physcomitrella patens]
 gb|EDQ77652.1| predicted protein [Physcomitrella patens]
Length=455

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 74/147 (50%), Gaps = 27/147 (18%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSGA-----FDNssqrqsrggGES-TTVFVRGFDKND  658
            +GQ+L  RD+    A+E+G+ TP   A      D S+   + G   S  T +VRGFDK  
Sbjct  232  SGQNLEGRDIFCDLAREKGS-TPGGAASLISMLDFSANGATPGRAGSDKTAYVRGFDKYQ  290

Query  657  TEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKG-------------------MAYIEF  538
             ED+IRS L   F  CGE+   RIPTD E G IKG                    AY+EF
Sbjct  291  DEDSIRSGLTEFFSDCGEVLNVRIPTDRESGEIKGYVTVPCAASSGFDGLESTRFAYVEF  350

Query  537  ADNDAMSKALELNNSQLGHSSLYVDEA  457
            +  D +SKA E++ S     SL V+EA
Sbjct  351  SSKDQLSKATEMDGSDYNGRSLVVNEA  377



>gb|KEH40855.1| RNA recognition motif [Medicago truncatula]
Length=668

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPT-DPEGYIKGMAYIEFADNDAMSK  514
            TVFV GFD +  E+ I+++L+ HF  CGEI    +P     G IKG A+++F D D   K
Sbjct  541  TVFVIGFDTSVAEEKIKASLKAHFSPCGEITRISLPRYHDSGNIKGFAHLDFKDIDGYKK  600

Query  513  ALELNNSQLGHSSLYVDEAKPRND  442
            AL+L+ + +G   L V +AKPR D
Sbjct  601  ALQLDQTAIGDYWLSVVKAKPRRD  624


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMS  517
            S T++VR           RS +E  F  CGEI   R+ TD EG  KG A+++FA  DA  
Sbjct  292  SKTIYVRNLSYTVE----RSDMENIFKDCGEIVDIRLHTDREGKFKGHAHVQFATADAAQ  347

Query  516  KALELNNSQLGHSSLYV  466
            KAL  N     +  ++V
Sbjct  348  KALVFNKKVFYNRLMFV  364



>emb|CAA39224.1| glycine-rich protein [Solanum lycopersicum]
Length=129

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = -2

Query  582  TDPEGYIKGMAYIEFA--DNDAMSKALELNNSQLGHSSLYVDEAKPRND  442
            TDPEGYIKGMAYIEFA  D DA++KALEL+ S++G  SL V EAKPR D
Sbjct  1    TDPEGYIKGMAYIEFANGDADALNKALELDGSEVGGFSLNVQEAKPRGD  49



>ref|XP_001769822.1| predicted protein [Physcomitrella patens]
 gb|EDQ65384.1| predicted protein [Physcomitrella patens]
Length=505

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 60/122 (49%), Gaps = 21/122 (17%)
 Frame = -2

Query  819  NGQDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIR  640
            +GQ +  R++    A+ERGA TP  G              + +  +   F       +IR
Sbjct  324  SGQTVEGREIWCDLARERGAATPGGG-------------KDWSQTYAFYF-------SIR  363

Query  639  SALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVD  463
            S L   FG CG +   RIPTD E G IKG AY+EF   D M+KA EL+ S     SL V+
Sbjct  364  SNLTEFFGECGNVVNVRIPTDRETGQIKGFAYVEFGSKDEMTKAFELDGSDFNGRSLVVN  423

Query  462  EA  457
            EA
Sbjct  424  EA  425



>gb|KFK23930.1| hypothetical protein AALP_AAs47265U000100 [Arabis alpina]
Length=234

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 13/107 (12%)
 Frame = -2

Query  771  ERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGT  592
            +R   TP SG   N          +  T+ V+GFD +  ED+I+ AL  +F SCGEI   
Sbjct  103  KRATSTPQSGIGGN----------DDQTIIVKGFDSSLPEDDIKMALSKYFSSCGEITSV  152

Query  591  RIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAK  454
             +PT+ E G + G AYIE    + + KAL+LN + L   +L V++A+
Sbjct  153  VVPTNSETGAVIGCAYIEL--KEGIEKALKLNGNYLRGWNLLVEKAR  197



>gb|KFK41492.1| hypothetical protein AALP_AA2G137300 [Arabis alpina]
Length=317

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T+  + FD    ED+I+ AL  HF SCGEI    +PTDP+ G  KG AYI+    + + K
Sbjct  237  TIIAKEFDYWLPEDDIKKALSKHFTSCGEITSVVVPTDPKTGATKGYAYIQI--KEGVEK  294

Query  513  ALELNNSQLGHSSLYVD  463
            AL+LN S++G  +L V+
Sbjct  295  ALKLNGSEMGGCNLVVE  311



>gb|KFK41567.1| hypothetical protein AALP_AA2G146000 [Arabis alpina]
Length=259

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 13/106 (12%)
 Frame = -2

Query  771  ERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGT  592
            +R AYTP SG   N          +  T+ V+GFD +  E +I+S L  +F  CGEI   
Sbjct  117  KRTAYTPQSGIGGN----------DDQTIIVKGFDSSLHEGDIKSELNKYFSLCGEITSV  166

Query  591  RIPTDPE-GYIKGMAYIEFADNDAMSKALELNNSQLGHSSLYVDEA  457
             +PTD E G + G AYIE    + + KAL+LN S L    L V++ 
Sbjct  167  VVPTDTETGAVIGCAYIEL--KEGVEKALKLNGSYLKGWKLVVEKV  210



>emb|CDX91450.1| BnaC04g07000D [Brassica napus]
Length=208

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T+FV GFD + + D IRSAL  HF SCGE+    +  + E G  +G A+I   +   +  
Sbjct  57   TIFVTGFDNSGSRDEIRSALAKHFSSCGELTRVFVHIECETGVSRGYAFINLKNRVGIEA  116

Query  513  ALELNNSQLGHSSLYVDEAKPRND  442
            AL LN S LG   L V  A+ R++
Sbjct  117  ALTLNGSDLGGRKLLVTMARLRDE  140



>ref|XP_010443562.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=229

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T+FV+GFD + + D+I+SALE HFGSCGEI    +P + + G   G A+I+   NDA  K
Sbjct  86   TIFVKGFDCSLSRDDIKSALEKHFGSCGEISRIFVPFECQTGSPLGYAFIDLR-NDA-KK  143

Query  513  ALELNNSQLGHSSLYVDEAKPRND  442
            AL L+ S LG   L V  A  R +
Sbjct  144  ALTLDGSYLGSMKLEVVMANSRTE  167



>emb|CDY16474.1| BnaA08g02930D [Brassica napus]
Length=484

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 56/97 (58%), Gaps = 8/97 (8%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AY-TPNSGAFDNssqrqsrggGESTTVFVRGFDKND  658
            ELNG+ LL RD++L  A ERG   AY TP SG  +  S      G +   +FV+GFD + 
Sbjct  278  ELNGRALLGRDIRLDMAAERGDRPAYNTPQSGGGNFRSGGGGGEGQK---IFVKGFDSSL  334

Query  657  TEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMA  550
             E++IR AL  HF SCGEI    IP D E G  +G A
Sbjct  335  PEEDIRQALTQHFASCGEITRVSIPMDRETGASRGKA  371



>ref|XP_009143396.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
Length=225

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T+FV GFD + + D IRSAL  HF SCGE+    +  + E G  +G A+I       +  
Sbjct  74   TIFVTGFDNSGSRDEIRSALAKHFSSCGELTRVFVHIECETGVSRGYAFINLKKRVGIEA  133

Query  513  ALELNNSQLGHSSLYVDEAKPRND  442
            AL LN S LG   L V  A+ R++
Sbjct  134  ALSLNGSDLGGHKLLVTMARLRDE  157



>ref|XP_010477184.1| PREDICTED: nucleolin 2-like [Camelina sativa]
Length=194

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T+FV+GFD + + D+I+S+LE HFGSCGEI    +P + + G   G A+I+  D+    K
Sbjct  47   TIFVKGFDCSLSRDDIKSSLEKHFGSCGEISRVFVPFECQTGSPLGYAFIDLRDD--TKK  104

Query  513  ALELNNSQLGHSSLYVDEAKPRND  442
            AL L+ S LG   L V  A  R +
Sbjct  105  ALTLDGSYLGSLKLEVVMANSRTE  128



>emb|CDX91454.1| BnaC04g06960D [Brassica napus]
Length=225

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T+FV GFD + + D IRSAL  HF SCGE+    +  + E G  +G A+I       +  
Sbjct  74   TLFVTGFDNSGSRDEIRSALAKHFSSCGELARVFVHIECETGVSRGYAFINLKKRVGIEA  133

Query  513  ALELNNSQLGHSSLYVDEAKPRND  442
            AL LN S LG   L V  A+ R++
Sbjct  134  ALSLNGSDLGGHKLLVTMARLRDE  157



>emb|CAA88179.1| gar2 [Schizosaccharomyces pombe]
Length=500

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 5/84 (6%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAM  520
            S TVFV     N TED++ +A    FG CG+I+  R+PTDP+ G +KG  Y+ F+D D+ 
Sbjct  365  SDTVFVGNLSFNATEDDLSTA----FGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSA  420

Query  519  SKALELNNSQLGHSSLYVDEAKPR  448
             K +E+N   +      +D + PR
Sbjct  421  KKCVEMNGHFIAGRPCRLDFSTPR  444



>ref|NP_593531.1| nucleolar protein required for rRNA processing [Schizosaccharomyces 
pombe 972h-]
 sp|P41891.2|GAR2_SCHPO RecName: Full=Protein gar2 [Schizosaccharomyces pombe 972h-]
 emb|CAB86413.1| nucleolar protein required for rRNA processing [Schizosaccharomyces 
pombe]
Length=500

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 5/84 (6%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAM  520
            S TVFV     N TED++ +A    FG CG+I+  R+PTDP+ G +KG  Y+ F+D D+ 
Sbjct  365  SDTVFVGNLSFNATEDDLSTA----FGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSA  420

Query  519  SKALELNNSQLGHSSLYVDEAKPR  448
             K +E+N   +      +D + PR
Sbjct  421  KKCVEMNGHFIAGRPCRLDFSTPR  444



>gb|KFK41695.1| hypothetical protein AALP_AA2G161100 [Arabis alpina]
Length=256

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 13/108 (12%)
 Frame = -2

Query  771  ERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGT  592
            +R AYT   G   N          +  T+ V+GFD +  ED+I+ AL  +F SCGEI   
Sbjct  123  KRAAYTSQIGIGGN----------DDQTIIVKGFDSSLPEDDIKRALSTYFSSCGEIISV  172

Query  591  RIPTDPEGYIK-GMAYIEFADNDAMSKALELNNSQLGHSSLYVDEAKP  451
             +  DP      G AYIE    + + KAL+L+ S LG  +L V +A P
Sbjct  173  IVAKDPATRTHIGCAYIEL--KEGIEKALKLSGSNLGGWNLLVKKATP  218



>gb|KFK41489.1| hypothetical protein AALP_AA2G137000 [Arabis alpina]
Length=322

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPEGY-IKGMAYIEFADNDAMSK  514
            T+ V+GF++   ED+++SAL  HF SCGEI    +PTD      KG AYI+    + + K
Sbjct  212  TIIVKGFNRFLREDDVKSALSKHFSSCGEITSIVVPTDQVTRGTKGCAYIQL--KEGVEK  269

Query  513  ALELNNSQLGHSSLYVDEAKP  451
            AL+LN S +   +L V++  P
Sbjct  270  ALKLNGSDMEGLNLVVEKVVP  290



>gb|EPX72616.1| gar2 [Schizosaccharomyces octosporus yFS286]
Length=481

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = -2

Query  696  STTVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAM  520
            S TVFV     N TED++ SA    F +CGEI+  R+PTDP+ G +KG  Y+ F+D D+ 
Sbjct  355  SDTVFVGNLSFNVTEDDVGSA----FATCGEIQSVRLPTDPQSGRLKGFGYVTFSDIDSA  410

Query  519  SKALELNNSQLGHSSLYVDEAKPRN  445
             + +E+N   +      +D + PR 
Sbjct  411  KRCVEMNGHFITGRPCRLDFSTPRT  435



>ref|XP_010469654.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=316

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T++V GF  +  E++I++AL  HF +CGEI    +PT+ E G+ KG AYI+    DA +K
Sbjct  186  TIYVEGFGSSLPENDIKTALSKHFSACGEITRVFVPTNFETGFFKGFAYIDL-KGDA-TK  243

Query  513  ALELNNSQLGHSSLYVDEA  457
            ALELN S +    L V  A
Sbjct  244  ALELNGSHMIGKELVVKTA  262



>ref|XP_010485217.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=190

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T+FV+GFD + + D+I+S+LE HFGSCGEI    +P + + G   G A+I+   NDA  K
Sbjct  47   TIFVKGFDCSLSRDDIKSSLEKHFGSCGEISRVFVPFECKTGSPLGYAFIDLR-NDA-KK  104

Query  513  ALELNNSQLGHSSLYVDEAKPRND  442
            AL L+ S +G   L V  A  R +
Sbjct  105  ALTLDGSYMGSLKLEVVMANSRTE  128



>tpg|DAA38878.1| TPA: putative nucleolin-like family protein [Zea mays]
Length=431

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = -2

Query  813  QDLLXRDVKLXXAKERGAYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDTEDNIRSA  634
            ++L  R+V+   AK R    P +G   N    Q    G   ++F+RGFDKN +ED I+S+
Sbjct  348  KELHGREVRHDFAKGRSTQNPRNG---NDGSFQKAARGNKNSIFIRGFDKNLSEDEIQSS  404

Query  633  LEGHFGSCGEIKGTRIPTDPE-GYIKG  556
            LE HF  CGE+    IPTD E G IKG
Sbjct  405  LEQHFSDCGEMTRVSIPTDHESGAIKG  431



>ref|XP_010491460.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=278

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 61/123 (50%), Gaps = 7/123 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG D+   +V +     +G   A+ P + AF    + QS+   +STT FV GFD +  
Sbjct  41   ELNGSDVGGWNVVVDALPNQGPDSAFCPKAAAF----RAQSKRKNQSTTFFVSGFDTSLP  96

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            E  I S+L   F SCGEI G  +     G +K  A+I      A  KAL+LN S  G   
Sbjct  97   EAYIESSLSKCFSSCGEITGISLCRGVGGVLKSSAFIYILGEGASEKALKLNGSDAGGWK  156

Query  474  LYV  466
            + V
Sbjct  157  VSV  159



>ref|XP_010453613.1| PREDICTED: uncharacterized protein LOC104735498 [Camelina sativa]
Length=211

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTDPE-GYIKGMAYIEFADNDAMSK  514
            T+FV+GFD + + D+I+S+LE HFGSCGEI    +P + + G   G A+I+   NDA  K
Sbjct  72   TIFVKGFDCSVSRDDIKSSLEKHFGSCGEIFRVFVPFECQTGSPLGYAFIDLK-NDA--K  128

Query  513  ALELNNSQLGHSSLYVDEAKPRND  442
            AL L+ S LG   L V     R +
Sbjct  129  ALTLDGSYLGSLKLEVAMTSSRKE  152



>ref|XP_010423112.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=139

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 59/123 (48%), Gaps = 7/123 (6%)
 Frame = -2

Query  825  ELNGQDLLXRDVKLXXAKERG---AYTPNSGAFDNssqrqsrggGESTTVFVRGFDKNDT  655
            ELNG D+   +V +     +G   A+ P + AF    + QS+   +STT  V GFD +  
Sbjct  15   ELNGSDVGGWNVVVHALPNQGPDSAFCPKAAAF----RAQSKRKNQSTTFLVSGFDTSLP  70

Query  654  EDNIRSALEGHFGSCGEIKGTRIPTDPEGYIKGMAYIEFADNDAMSKALELNNSQLGHSS  475
            E  I  +L   F SCGEI G  +     G +K  A+I      A  KAL+LN S  G   
Sbjct  71   EAYIERSLSKCFSSCGEITGISLTRGVGGVLKSYAFISILGEGASEKALKLNGSDAGGWK  130

Query  474  LYV  466
            + V
Sbjct  131  VSV  133



>ref|XP_010436361.1| PREDICTED: nucleolin 1-like [Camelina sativa]
Length=337

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -2

Query  690  TVFVRGFDKNDTEDNIRSALEGHFGSCGEIKGTRIPTD-PEGYIKGMAYIEFADNDAMSK  514
            T++V GF  +  ED+I++AL  HF +CGEI    +PT    G +KG AYI+  ++    K
Sbjct  215  TIYVEGFGSSLPEDDIKTALSEHFSTCGEITRVFVPTSFLTGSVKGFAYIDLKED--AKK  272

Query  513  ALELNNSQLGHSSLYVDEA  457
            ALELN S +    L V +A
Sbjct  273  ALELNGSVMIGKELVVKKA  291



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1699796147840