BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002D10

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790112.1|  PREDICTED: aldehyde dehydrogenase                  371   3e-123   Nicotiana sylvestris
ref|XP_009593287.1|  PREDICTED: aldehyde dehydrogenase                  367   1e-121   Nicotiana tomentosiformis
ref|XP_004242034.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    357   8e-118   
ref|XP_002520352.1|  Aldehyde dehydrogenase, putative                   346   4e-113   
gb|KDO80590.1|  hypothetical protein CISIN_1g011107mg                   335   1e-111   Citrus sinensis [apfelsine]
gb|KDO80588.1|  hypothetical protein CISIN_1g011107mg                   336   2e-111   Citrus sinensis [apfelsine]
gb|KDO80586.1|  hypothetical protein CISIN_1g011107mg                   337   7e-111   Citrus sinensis [apfelsine]
gb|KDO80587.1|  hypothetical protein CISIN_1g011107mg                   337   8e-111   Citrus sinensis [apfelsine]
ref|XP_006363887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    338   2e-110   Solanum tuberosum [potatoes]
gb|KDO80584.1|  hypothetical protein CISIN_1g011107mg                   338   4e-110   Citrus sinensis [apfelsine]
ref|XP_006472804.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    338   4e-110   Citrus sinensis [apfelsine]
ref|XP_004498346.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    338   5e-110   Cicer arietinum [garbanzo]
ref|XP_006434229.1|  hypothetical protein CICLE_v10000949mg             337   7e-110   Citrus clementina [clementine]
ref|XP_004498347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    338   2e-109   
gb|AFK46379.1|  unknown                                                 328   3e-109   Medicago truncatula
gb|KEH40518.1|  NAD-dependent aldehyde dehydrogenase family protein     335   3e-109   Medicago truncatula
ref|XP_002306641.1|  the aldehyde dehydrogenase cp-ADH from C.pla...    335   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010999403.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    335   5e-109   Populus euphratica
gb|KJB59283.1|  hypothetical protein B456_009G247000                    327   1e-108   Gossypium raimondii
gb|KEH40517.1|  NAD-dependent aldehyde dehydrogenase family protein     334   1e-108   Medicago truncatula
gb|KGN54555.1|  hypothetical protein Csa_4G361890                       331   1e-108   Cucumis sativus [cucumbers]
ref|XP_002302229.2|  the aldehyde dehydrogenase cp-ADH from C.pla...    334   2e-108   
gb|ACJ85852.1|  unknown                                                 333   2e-108   Medicago truncatula
ref|XP_004290887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    333   3e-108   Fragaria vesca subsp. vesca
ref|XP_004290886.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    333   3e-108   Fragaria vesca subsp. vesca
ref|XP_007161479.1|  hypothetical protein PHAVU_001G072600g             333   3e-108   Phaseolus vulgaris [French bean]
gb|KHN21716.1|  Aldehyde dehydrogenase family 3 member H1               330   3e-108   Glycine soja [wild soybean]
ref|XP_003526638.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    332   6e-108   
gb|KJB59281.1|  hypothetical protein B456_009G247000                    329   6e-108   Gossypium raimondii
ref|XP_004142628.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    332   7e-108   Cucumis sativus [cucumbers]
ref|XP_010243505.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    334   1e-107   
gb|KHG28299.1|  Aldehyde dehydrogenase family 3 member H1               332   1e-107   Gossypium arboreum [tree cotton]
ref|XP_010243504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    333   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_011003449.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    331   2e-107   Populus euphratica
ref|XP_006575169.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    331   3e-107   Glycine max [soybeans]
ref|XP_010268979.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    330   3e-107   Nelumbo nucifera [Indian lotus]
ref|XP_006596209.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    328   5e-107   Glycine max [soybeans]
gb|KJB59280.1|  hypothetical protein B456_009G247000                    330   5e-107   Gossypium raimondii
ref|XP_003544699.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    329   1e-106   Glycine max [soybeans]
gb|AGC65583.1|  fatty aldehyde dehydrogenase                            329   1e-106   Simmondsia chinensis [goatnut]
ref|XP_003544698.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    329   2e-106   Glycine max [soybeans]
ref|XP_003523436.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    328   3e-106   
gb|EYU23873.1|  hypothetical protein MIMGU_mgv1a005640mg                325   3e-106   Erythranthe guttata [common monkey flower]
gb|KHN47009.1|  Aldehyde dehydrogenase family 3 member H1               328   3e-106   Glycine soja [wild soybean]
gb|KHG30796.1|  Aldehyde dehydrogenase family 3 member H1               328   4e-106   Gossypium arboreum [tree cotton]
ref|XP_010930724.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    328   4e-106   Elaeis guineensis
gb|KDP32847.1|  hypothetical protein JCGZ_12139                         327   7e-106   Jatropha curcas
gb|KHN20611.1|  Aldehyde dehydrogenase family 3 member H1               330   1e-105   Glycine soja [wild soybean]
gb|EYU23872.1|  hypothetical protein MIMGU_mgv1a005640mg                326   1e-105   Erythranthe guttata [common monkey flower]
ref|XP_008444179.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    326   2e-105   Cucumis melo [Oriental melon]
ref|XP_007019116.1|  Aldehyde dehydrogenase 3H1 isoform 1               326   2e-105   
ref|XP_007137428.1|  hypothetical protein PHAVU_009G126400g             325   3e-105   Phaseolus vulgaris [French bean]
ref|XP_007019117.1|  Aldehyde dehydrogenase 3H1 isoform 2               326   5e-105   
ref|XP_008781593.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    325   5e-105   Phoenix dactylifera
ref|XP_004142629.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    323   9e-105   
ref|XP_009420563.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    324   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010095408.1|  Aldehyde dehydrogenase family 3 member H1          324   1e-104   
ref|XP_004161166.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    323   2e-104   
gb|KGN54554.1|  hypothetical protein Csa_4G361880                       323   2e-104   Cucumis sativus [cucumbers]
ref|XP_010063405.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    323   2e-104   Eucalyptus grandis [rose gum]
ref|XP_011069490.1|  PREDICTED: aldehyde dehydrogenase-like             323   3e-104   Sesamum indicum [beniseed]
gb|AES72293.2|  NAD-dependent aldehyde dehydrogenase family protein     322   6e-104   Medicago truncatula
ref|XP_008219617.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    320   6e-104   
ref|XP_009383529.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    322   7e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003602042.1|  Aldehyde dehydrogenase family 3 member H1          322   9e-104   
ref|XP_007222253.1|  hypothetical protein PRUPE_ppa004751mg             322   1e-103   Prunus persica
ref|XP_008219616.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    320   3e-103   Prunus mume [ume]
gb|EYU31773.1|  hypothetical protein MIMGU_mgv1a018415mg                317   3e-103   Erythranthe guttata [common monkey flower]
ref|XP_011027504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    320   5e-103   Populus euphratica
ref|XP_009414877.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    320   5e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011074837.1|  PREDICTED: aldehyde dehydrogenase                  318   9e-103   Sesamum indicum [beniseed]
ref|XP_006847205.1|  hypothetical protein AMTR_s00017p00253390          317   1e-102   
ref|XP_008444183.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    319   1e-102   Cucumis melo [Oriental melon]
gb|KHG30273.1|  Aldehyde dehydrogenase family 3 member H1               319   1e-102   Gossypium arboreum [tree cotton]
ref|XP_008444182.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    318   1e-102   Cucumis melo [Oriental melon]
ref|XP_010530214.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    318   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_008338656.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    318   3e-102   
ref|XP_009379029.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    317   4e-102   Pyrus x bretschneideri [bai li]
gb|KJB29203.1|  hypothetical protein B456_005G089100                    316   5e-102   Gossypium raimondii
ref|NP_001077676.1|  aldehyde dehydrogenase 3H1                         315   5e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KJB29202.1|  hypothetical protein B456_005G089100                    317   6e-102   Gossypium raimondii
ref|XP_009379028.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    317   6e-102   Pyrus x bretschneideri [bai li]
ref|XP_010674968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    317   6e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008378442.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    316   1e-101   
ref|XP_008365201.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    316   1e-101   Malus domestica [apple tree]
ref|XP_010664200.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    315   2e-101   Vitis vinifera
ref|XP_008227590.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    317   3e-101   Prunus mume [ume]
gb|EYU22982.1|  hypothetical protein MIMGU_mgv1a005625mg                315   3e-101   Erythranthe guttata [common monkey flower]
ref|XP_007213817.1|  hypothetical protein PRUPE_ppa005609mg             314   3e-101   
gb|AAM61211.1|  aldehyde dehydrogenase, putative                        315   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175081.1|  aldehyde dehydrogenase 3H1                            315   4e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CBI19000.3|  unnamed protein product                                315   2e-100   Vitis vinifera
ref|XP_008387507.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    313   6e-100   
ref|XP_008367720.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    313   8e-100   
gb|KDO52216.1|  hypothetical protein CISIN_1g009109mg                   312   9e-100   Citrus sinensis [apfelsine]
ref|XP_009355863.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    313   1e-99    Pyrus x bretschneideri [bai li]
gb|KDO52215.1|  hypothetical protein CISIN_1g009109mg                   312   2e-99    Citrus sinensis [apfelsine]
ref|XP_006432086.1|  hypothetical protein CICLE_v10000776mg             311   3e-99    Citrus clementina [clementine]
ref|XP_006304446.1|  hypothetical protein CARUB_v10011079mg             310   4e-99    Capsella rubella
ref|XP_007159875.1|  hypothetical protein PHAVU_002G275200g             312   5e-99    Phaseolus vulgaris [French bean]
ref|XP_002888606.1|  ALDH3H1                                            309   7e-99    
emb|CBI21614.3|  unnamed protein product                                311   7e-99    Vitis vinifera
emb|CAN73659.1|  hypothetical protein VITISV_044129                     311   7e-99    Vitis vinifera
ref|XP_002273730.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    311   7e-99    Vitis vinifera
gb|KCW70623.1|  hypothetical protein EUGRSUZ_F03800                     310   7e-99    Eucalyptus grandis [rose gum]
gb|KCW70625.1|  hypothetical protein EUGRSUZ_F03800                     308   8e-99    Eucalyptus grandis [rose gum]
ref|NP_001065921.1|  Os11g0186200                                       308   1e-98    
gb|AAX96338.1|  aldehyde dehydrogenase, putative                        309   1e-98    Oryza sativa Japonica Group [Japonica rice]
gb|KJB64495.1|  hypothetical protein B456_010G051500                    306   3e-98    Gossypium raimondii
ref|XP_003577758.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    307   4e-98    Brachypodium distachyon [annual false brome]
ref|XP_004502483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    307   4e-98    
ref|XP_006662790.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    304   4e-98    
ref|XP_004502482.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    307   4e-98    Cicer arietinum [garbanzo]
emb|CAE51203.1|  putative aldehyde dehydrogenase                        306   5e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031097.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    309   6e-98    Populus euphratica
gb|KJB64493.1|  hypothetical protein B456_010G051500                    306   6e-98    Gossypium raimondii
ref|XP_010025727.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    308   1e-97    Eucalyptus grandis [rose gum]
ref|XP_010500136.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    306   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010025726.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    308   1e-97    Eucalyptus grandis [rose gum]
ref|XP_010461437.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    305   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_006662789.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    305   3e-97    Oryza brachyantha
sp|Q8VXQ2.1|ALDH_CRAPL  RecName: Full=Aldehyde dehydrogenase; Alt...    304   4e-97    Craterostigma plantagineum
ref|XP_010479042.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    305   4e-97    Camelina sativa [gold-of-pleasure]
ref|XP_003532071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    306   4e-97    
emb|CDY36336.1|  BnaC08g05150D                                          304   5e-97    Brassica napus [oilseed rape]
ref|XP_009107480.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    303   1e-96    Brassica rapa
ref|XP_002307060.1|  hypothetical protein POPTR_0005s07090g             303   2e-96    Populus trichocarpa [western balsam poplar]
emb|CDY36018.1|  BnaA08g04430D                                          303   2e-96    Brassica napus [oilseed rape]
ref|XP_009404859.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    302   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437649.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    296   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010444975.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    294   4e-96    
ref|XP_011468213.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    303   4e-96    Fragaria vesca subsp. vesca
ref|XP_010664198.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    303   4e-96    Vitis vinifera
ref|XP_009145048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    301   9e-96    Brassica rapa
ref|XP_010674357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    303   1e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    303   1e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|ABR16899.1|  unknown                                                 302   2e-95    Picea sitchensis
gb|AET04825.2|  NAD-dependent aldehyde dehydrogenase family protein     302   2e-95    Medicago truncatula
gb|EAY82454.1|  hypothetical protein OsI_37671                          299   2e-95    Oryza sativa Indica Group [Indian rice]
gb|EAZ19830.1|  hypothetical protein OsJ_35414                          299   3e-95    Oryza sativa Japonica Group [Japonica rice]
gb|ABA96616.1|  aldehyde dehydrogenase family protein, expressed        300   3e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009350139.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    298   3e-95    
ref|XP_004502485.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    300   3e-95    Cicer arietinum [garbanzo]
ref|XP_006393739.1|  hypothetical protein EUTSA_v10011438mg             298   1e-94    Eutrema salsugineum [saltwater cress]
gb|KFK24209.1|  hypothetical protein AALP_AAs42301U000200               298   1e-94    Arabis alpina [alpine rockcress]
ref|XP_011002476.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    305   2e-94    Populus euphratica
ref|XP_006663868.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    297   2e-94    
emb|CAC84903.1|  aldehyde dehydrogenase                                 299   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001168661.1|  hypothetical protein                               297   3e-94    Zea mays [maize]
emb|CAB36701.1|  putative aldehyde dehydrogenase                        298   5e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503900.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    298   6e-94    Cicer arietinum [garbanzo]
ref|NP_567962.1|  aldehyde dehydrogenase 3I1                            298   8e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503899.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    298   9e-94    Cicer arietinum [garbanzo]
ref|XP_010437650.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    298   9e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010447116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    298   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010432443.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    297   2e-93    Camelina sativa [gold-of-pleasure]
dbj|BAK01937.1|  predicted protein                                      295   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007048537.1|  Aldehyde dehydrogenase 3I1 isoform 3               294   4e-93    
ref|XP_002869163.1|  ALDH3I1                                            296   4e-93    Arabidopsis lyrata subsp. lyrata
gb|KHG17901.1|  Aldehyde dehydrogenase family 3 member I1, chloro...    290   7e-93    Gossypium arboreum [tree cotton]
ref|XP_010539000.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    293   8e-93    Tarenaya hassleriana [spider flower]
ref|XP_002449124.1|  hypothetical protein SORBIDRAFT_05g005470          293   8e-93    
ref|XP_003630349.1|  Aldehyde dehydrogenase family 3 member H1          295   2e-92    
gb|KJB75337.1|  hypothetical protein B456_012G037500                    291   2e-92    Gossypium raimondii
ref|XP_007048536.1|  Aldehyde dehydrogenase 3I1 isoform 2               294   2e-92    
ref|XP_007048535.1|  Aldehyde dehydrogenase 3I1 isoform 1               294   3e-92    
gb|KJB75341.1|  hypothetical protein B456_012G037500                    292   4e-92    Gossypium raimondii
emb|CDX69039.1|  BnaC01g04140D                                          293   7e-92    
ref|XP_006412252.1|  hypothetical protein EUTSA_v10024844mg             292   2e-91    Eutrema salsugineum [saltwater cress]
gb|AFW65463.1|  hypothetical protein ZEAMMB73_893012                    289   2e-91    
ref|XP_006283479.1|  hypothetical protein CARUB_v10004527mg             291   2e-91    Capsella rubella
gb|KJB75338.1|  hypothetical protein B456_012G037500                    291   3e-91    Gossypium raimondii
gb|KJB75340.1|  hypothetical protein B456_012G037500                    291   3e-91    Gossypium raimondii
gb|ACG29168.1|  aldehyde dehydrogenase, dimeric NADP-preferring         289   3e-91    Zea mays [maize]
gb|KFK30059.1|  hypothetical protein AALP_AA7G211500                    291   4e-91    Arabis alpina [alpine rockcress]
ref|XP_009115077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    291   5e-91    
gb|ACF85700.1|  unknown                                                 288   5e-91    Zea mays [maize]
ref|NP_001288985.1|  aldehyde dehydrogenase family 3 member I1, c...    291   5e-91    Brassica rapa
ref|XP_009115014.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    291   5e-91    
emb|CDX75414.1|  BnaA01g02880D                                          290   9e-91    
gb|AID60136.1|  aldehyde dehydrogenase 3                                290   9e-91    Brassica napus [oilseed rape]
gb|ABK24239.1|  unknown                                                 288   1e-90    Picea sitchensis
gb|EMS62407.1|  Aldehyde dehydrogenase family 3 member H1               286   2e-90    Triticum urartu
ref|NP_001148092.1|  aldehyde dehydrogenase, dimeric NADP-preferring    286   3e-90    
gb|EPS67421.1|  aldehyde dehydrogenase                                  277   2e-89    Genlisea aurea
gb|EMT24757.1|  Aldehyde dehydrogenase family 3 member H1               280   2e-89    
gb|EMS67813.1|  Aldehyde dehydrogenase family 3 member H1               278   1e-88    Triticum urartu
ref|XP_002893982.1|  ALDH3H1                                            283   1e-88    
gb|EMT33845.1|  Aldehyde dehydrogenase family 3 member H1               281   6e-88    
ref|XP_002441918.1|  hypothetical protein SORBIDRAFT_08g004840          281   7e-88    Sorghum bicolor [broomcorn]
gb|KJB75339.1|  hypothetical protein B456_012G037500                    280   4e-87    Gossypium raimondii
gb|AFW56225.1|  hypothetical protein ZEAMMB73_146423                    273   9e-86    
gb|ACL53721.1|  unknown                                                 273   6e-85    Zea mays [maize]
ref|NP_001152171.1|  aldehyde dehydrogenase, dimeric NADP-preferring    273   6e-85    Zea mays [maize]
ref|XP_010238657.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    272   9e-85    Brachypodium distachyon [annual false brome]
ref|XP_004977224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    265   7e-82    Setaria italica
ref|XP_010547359.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    263   9e-82    Tarenaya hassleriana [spider flower]
ref|XP_010093107.1|  Aldehyde dehydrogenase family 3 member I1          266   4e-81    
ref|XP_001780129.1|  variable substrate                                 263   6e-81    
ref|XP_010547357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    264   7e-81    Tarenaya hassleriana [spider flower]
ref|XP_002978104.1|  hypothetical protein SELMODRAFT_271300             258   2e-79    
ref|XP_002966639.1|  hypothetical protein SELMODRAFT_227647             258   2e-79    
ref|XP_002978037.1|  hypothetical protein SELMODRAFT_268146             254   7e-78    
ref|XP_002966702.1|  hypothetical protein SELMODRAFT_168397             254   1e-77    
ref|XP_001764841.1|  variable substrate                                 249   9e-76    
ref|XP_001757163.1|  variable substrate                                 246   1e-74    
ref|XP_004977223.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    247   2e-74    
gb|KHN21904.1|  Aldehyde dehydrogenase family 3 member F1               238   6e-72    Glycine soja [wild soybean]
gb|EPS67391.1|  aldehyde dehydrogenase                                  238   6e-72    Genlisea aurea
ref|XP_003539064.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    238   2e-71    Glycine max [soybeans]
gb|KDO80591.1|  hypothetical protein CISIN_1g011107mg                   233   8e-70    Citrus sinensis [apfelsine]
ref|XP_003539464.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    234   8e-70    
ref|XP_007132014.1|  hypothetical protein PHAVU_011G059400g             231   9e-69    Phaseolus vulgaris [French bean]
ref|XP_001767194.1|  variable substrate                                 228   1e-67    
gb|AFK41010.1|  unknown                                                 220   7e-67    Lotus japonicus
ref|XP_004507095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    223   1e-65    Cicer arietinum [garbanzo]
gb|KDO71077.1|  hypothetical protein CISIN_1g0386172mg                  219   2e-65    Citrus sinensis [apfelsine]
ref|XP_001770374.1|  variable substrate                                 222   2e-65    
ref|XP_002298405.2|  hypothetical protein POPTR_0001s26630g             222   2e-65    Populus trichocarpa [western balsam poplar]
gb|KJB29204.1|  hypothetical protein B456_005G089100                    220   2e-65    Gossypium raimondii
ref|XP_010045018.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    221   6e-65    Eucalyptus grandis [rose gum]
ref|XP_006425564.1|  hypothetical protein CICLE_v10025492mg             221   8e-65    Citrus clementina [clementine]
ref|XP_010031796.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    221   1e-64    Eucalyptus grandis [rose gum]
ref|XP_006466887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    219   3e-64    Citrus sinensis [apfelsine]
gb|KCW87154.1|  hypothetical protein EUGRSUZ_B03682                     218   4e-64    Eucalyptus grandis [rose gum]
ref|XP_009768441.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   9e-64    Nicotiana sylvestris
ref|XP_010673629.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   9e-64    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011006203.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   1e-63    Populus euphratica
ref|XP_011006204.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   1e-63    Populus euphratica
ref|XP_010045016.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    217   2e-63    Eucalyptus grandis [rose gum]
dbj|BAJ96457.1|  predicted protein                                      216   3e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009355864.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   4e-63    
ref|XP_006345274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   4e-63    
gb|KJE97385.1|  aldehyde dehydrogenase type III-PG                      216   6e-63    Capsaspora owczarzaki ATCC 30864
ref|XP_010034275.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   6e-63    
ref|XP_004486968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   6e-63    Cicer arietinum [garbanzo]
ref|XP_010045013.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   8e-63    
gb|KCW51189.1|  hypothetical protein EUGRSUZ_J00776                     215   8e-63    Eucalyptus grandis [rose gum]
ref|XP_010271510.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   1e-62    Nelumbo nucifera [Indian lotus]
gb|KCW87152.1|  hypothetical protein EUGRSUZ_B03680                     215   1e-62    Eucalyptus grandis [rose gum]
ref|XP_004343114.1|  aldehyde dehydrogenase type III-PG                 216   1e-62    Capsaspora owczarzaki ATCC 30864
gb|EAZ31491.1|  hypothetical protein OsJ_15627                          211   1e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004502484.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   2e-62    
ref|XP_010102335.1|  Aldehyde dehydrogenase family 3 member F1          214   3e-62    Morus notabilis
gb|KCW51186.1|  hypothetical protein EUGRSUZ_J00772                     214   4e-62    Eucalyptus grandis [rose gum]
ref|XP_008449722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   5e-62    Cucumis melo [Oriental melon]
ref|XP_010034106.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   5e-62    
gb|KFM72617.1|  Aldehyde dehydrogenase, dimeric NADP-preferring         214   6e-62    Stegodyphus mimosarum
ref|XP_007150367.1|  hypothetical protein PHAVU_005G147600g             213   6e-62    Phaseolus vulgaris [French bean]
ref|XP_010555061.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   1e-61    Tarenaya hassleriana [spider flower]
ref|XP_003629375.1|  Aldehyde dehydrogenase family 3 member F1          212   2e-61    Medicago truncatula
gb|KCW56679.1|  hypothetical protein EUGRSUZ_I02377                     207   2e-61    Eucalyptus grandis [rose gum]
ref|XP_003547154.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    212   3e-61    
ref|XP_008453718.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   3e-61    Cucumis melo [Oriental melon]
gb|KHN33348.1|  Aldehyde dehydrogenase family 3 member F1               211   3e-61    Glycine soja [wild soybean]
gb|KJB55349.1|  hypothetical protein B456_009G072900                    211   3e-61    Gossypium raimondii
ref|XP_006652592.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   3e-61    Oryza brachyantha
ref|XP_003547955.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   3e-61    
gb|AFK48458.1|  unknown                                                 211   4e-61    Medicago truncatula
ref|XP_003543533.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   4e-61    Glycine max [soybeans]
ref|NP_001053442.1|  Os04g0540600                                       211   4e-61    
gb|KHN41688.1|  Aldehyde dehydrogenase family 3 member F1               211   5e-61    Glycine soja [wild soybean]
ref|XP_006829153.1|  hypothetical protein AMTR_s00001p00269720          211   5e-61    Amborella trichopoda
ref|XP_002273358.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   6e-61    Vitis vinifera
emb|CBI17422.3|  unnamed protein product                                211   6e-61    Vitis vinifera
gb|KEH30216.1|  NAD-dependent aldehyde dehydrogenase family protein     211   6e-61    Medicago truncatula
gb|KHG24071.1|  Aldehyde dehydrogenase family 3 member F1               210   8e-61    Gossypium arboreum [tree cotton]
ref|XP_010029722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   1e-60    Eucalyptus grandis [rose gum]
ref|XP_010536078.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   1e-60    Tarenaya hassleriana [spider flower]
ref|WP_012163534.1|  aldehyde dehydrogenase                             209   1e-60    Acaryochloris marina
gb|KHN30135.1|  Aldehyde dehydrogenase family 3 member F1               210   2e-60    Glycine soja [wild soybean]
ref|XP_004228361.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   2e-60    
ref|XP_008227591.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    209   2e-60    Prunus mume [ume]
ref|XP_007015039.1|  Aldehyde dehydrogenase family 3 member F1          214   3e-60    
gb|EYU31156.1|  hypothetical protein MIMGU_mgv1a0038971mg               206   4e-60    Erythranthe guttata [common monkey flower]
gb|KJB55351.1|  hypothetical protein B456_009G072900                    208   4e-60    Gossypium raimondii
emb|CAE48163.1|  putative aldehyde dehydrogenase                        208   5e-60    Arabidopsis thaliana [mouse-ear cress]
ref|WP_018397546.1|  hypothetical protein                               207   5e-60    filamentous cyanobacterium ESFC-1
ref|NP_195348.2|  aldehyde dehydrogenase 3F1                            208   6e-60    Arabidopsis thaliana [mouse-ear cress]
gb|EPS59682.1|  aldehyde dehydrogenase                                  207   9e-60    
ref|XP_002448250.1|  hypothetical protein SORBIDRAFT_06g023975          203   9e-60    
ref|WP_006527043.1|  NAD-dependent aldehyde dehydrogenase               207   1e-59    
ref|XP_005811793.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   1e-59    
ref|XP_003520274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   1e-59    
gb|KGN54173.1|  hypothetical protein Csa_4G291370                       207   1e-59    
gb|KHN00502.1|  Aldehyde dehydrogenase family 3 member F1               207   1e-59    
emb|CDX75566.1|  BnaA01g01360D                                          206   2e-59    
ref|XP_004142118.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    206   2e-59    
ref|XP_009346294.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    206   3e-59    
ref|WP_010474036.1|  aldehyde dehydrogenase                             206   3e-59    
ref|XP_006283636.1|  hypothetical protein CARUB_v10004694mg             206   3e-59    
ref|XP_009781320.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   3e-59    
emb|CDP01945.1|  unnamed protein product                                206   4e-59    
gb|AFW59012.1|  hypothetical protein ZEAMMB73_052021                    201   4e-59    
ref|XP_009590099.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   4e-59    
ref|XP_009145598.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    206   5e-59    
emb|CDX77447.1|  BnaA07g05850D                                          206   5e-59    
ref|XP_002869039.1|  ALDH3F1                                            206   5e-59    
ref|XP_010432186.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   5e-59    
ref|XP_003569983.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   6e-59    
gb|EMT10079.1|  Aldehyde dehydrogenase family 3 member F1               201   6e-59    
ref|XP_010113456.1|  Aldehyde dehydrogenase family 3 member F1          205   8e-59    
ref|NP_001047575.1|  Os02g0646500                                       205   8e-59    
dbj|BAJ86301.1|  predicted protein                                      205   1e-58    
ref|XP_006412015.1|  hypothetical protein EUTSA_v10025045mg             204   1e-58    
ref|XP_010446811.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   1e-58    
ref|XP_007575678.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   1e-58    
ref|XP_008668343.1|  PREDICTED: hypothetical protein isoform X1         205   2e-58    
gb|AAD35089.1|AF148877_1  putative aldehyde dehydrogenase OS-ALDH       204   2e-58    
ref|XP_010437648.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   2e-58    
ref|XP_003580245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   2e-58    
ref|XP_009781319.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   3e-58    
ref|XP_010437362.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   3e-58    
ref|XP_009378224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   3e-58    
emb|CDX69216.1|  BnaC01g02370D                                          203   3e-58    
ref|XP_004976400.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   3e-58    
ref|XP_008844512.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   3e-58    
ref|XP_010317521.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   4e-58    
ref|XP_002285466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   4e-58    
ref|XP_002310836.1|  mRNA for putative aldehyde dehydrogenase fam...    202   6e-58    
gb|AFW59014.1|  hypothetical protein ZEAMMB73_052021                    202   6e-58    
ref|XP_010679827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   6e-58    
gb|KFK30260.1|  hypothetical protein AALP_AA7G238000                    202   7e-58    
ref|XP_010316396.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   7e-58    
gb|AFZ51141.1|  NAD-dependent aldehyde dehydrogenase                    202   8e-58    
gb|EFA71109.1|  Aldehyde dehydrogenase                                  202   8e-58    
ref|WP_041235482.1|  aldehyde dehydrogenase                             202   8e-58    
ref|WP_040008058.1|  aldehyde dehydrogenase                             202   9e-58    
gb|ABN13589.1|  aldehyde dehydrogenase                                  195   1e-57    
gb|KFO94567.1|  Fatty aldehyde dehydrogenase                            201   1e-57    
ref|XP_010142170.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    201   1e-57    
gb|KDP32663.1|  hypothetical protein JCGZ_13661                         202   1e-57    
gb|AGI96739.1|  aldehyde dehydrogenase 3-1 variant B                    202   1e-57    
ref|XP_001362651.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   1e-57    
ref|XP_001688503.1|  AGAP005124-PA                                      202   1e-57    
gb|KFM06810.1|  Fatty aldehyde dehydrogenase                            202   2e-57    
ref|XP_011285423.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   2e-57    
ref|XP_003597427.1|  Aldehyde dehydrogenase family 3 member F1          202   2e-57    
ref|XP_006340688.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   2e-57    
ref|XP_009276469.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    202   2e-57    
ref|XP_008338017.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    202   2e-57    
ref|XP_004953284.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   2e-57    
ref|XP_010919366.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   2e-57    
ref|XP_011025893.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   2e-57    
emb|CDY35463.1|  BnaC03g61970D                                          201   3e-57    
gb|ACR38486.1|  unknown                                                 201   3e-57    
ref|XP_008413291.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   3e-57    
ref|NP_001151141.1|  aldehyde dehydrogenase 3B1                         201   3e-57    
ref|WP_009326028.1|  aldehyde dehydrogenase                             200   3e-57    
ref|WP_035405643.1|  aldehyde dehydrogenase                             200   3e-57    
ref|NP_001147083.1|  LOC100280692                                       201   3e-57    
gb|AAR21278.1|  fatty aldehyde dehydrogenase 1                          201   3e-57    
ref|XP_008337865.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   3e-57    
ref|WP_016878575.1|  aldehyde dehydrogenase                             200   3e-57    
ref|XP_009276470.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    201   4e-57    
ref|XP_008241772.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   4e-57    
ref|XP_002452841.1|  hypothetical protein SORBIDRAFT_04g033420          200   4e-57    
ref|WP_007619784.1|  aldehyde dehydrogenase                             200   5e-57    
ref|WP_017292666.1|  hypothetical protein                               200   5e-57    
gb|KDP22085.1|  hypothetical protein JCGZ_25916                         200   5e-57    
ref|XP_004598282.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   6e-57    
ref|XP_004713785.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   7e-57    
ref|XP_009138416.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   7e-57    
emb|CDY59717.1|  BnaA03g59170D                                          200   7e-57    
gb|ERL90558.1|  hypothetical protein D910_07906                         194   8e-57    
ref|XP_009138415.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   8e-57    
ref|WP_039727975.1|  MULTISPECIES: aldehyde dehydrogenase               199   9e-57    
ref|XP_010778363.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   1e-56    
ref|XP_005056938.1|  PREDICTED: fatty aldehyde dehydrogenase-like       197   1e-56    
ref|WP_023072260.1|  aldehyde dehydrogenase                             199   1e-56    
gb|KIE11140.1|  aldehyde dehydrogenase                                  196   1e-56    
ref|XP_010919365.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   1e-56    
ref|XP_004598281.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   1e-56    
ref|WP_036006670.1|  aldehyde dehydrogenase                             198   1e-56    
ref|WP_017306063.1|  hypothetical protein                               198   1e-56    
ref|XP_010548304.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    199   2e-56    
ref|XP_010263855.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   2e-56    
ref|XP_008803615.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   2e-56    
ref|XP_006033466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   2e-56    
ref|XP_004627191.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   2e-56    
emb|CDY24790.1|  BnaA08g15200D                                          199   2e-56    
gb|KFW86502.1|  Fatty aldehyde dehydrogenase                            199   2e-56    
ref|WP_015186936.1|  Aldehyde Dehydrogenase                             198   2e-56    
ref|XP_010819373.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    193   2e-56    
ref|XP_001653928.1|  AAEL009664-PA                                      198   2e-56    
ref|XP_003468358.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   2e-56    
ref|XP_005333387.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   2e-56    
ref|XP_010835976.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    192   2e-56    
ref|XP_008928730.1|  PREDICTED: fatty aldehyde dehydrogenase-like       199   2e-56    
ref|XP_010597294.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   2e-56    
gb|KFQ29190.1|  Fatty aldehyde dehydrogenase                            199   2e-56    
gb|KFO74386.1|  Fatty aldehyde dehydrogenase                            199   3e-56    
ref|XP_010709095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   3e-56    
gb|KJB17711.1|  hypothetical protein B456_003G011600                    193   3e-56    
ref|XP_003419438.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   3e-56    
ref|NP_001276988.1|  aldehyde dehydrogenase family 3 member B1 is...    192   3e-56    
ref|XP_009556787.1|  PREDICTED: fatty aldehyde dehydrogenase            199   3e-56    
ref|XP_007202020.1|  hypothetical protein PRUPE_ppa004971mg             198   3e-56    
ref|WP_017316439.1|  aldehyde dehydrogenase                             197   3e-56    
ref|WP_015160249.1|  NAD-dependent aldehyde dehydrogenase               197   4e-56    
ref|XP_010192700.1|  PREDICTED: fatty aldehyde dehydrogenase            199   4e-56    
ref|XP_004522592.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    198   4e-56    
ref|XP_006033465.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   4e-56    
ref|XP_004627190.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   4e-56    
ref|WP_015203433.1|  aldehyde dehydrogenase                             197   4e-56    
ref|XP_005333386.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   4e-56    
ref|XP_007156099.1|  hypothetical protein PHAVU_003G258500g             198   4e-56    
gb|AGI96742.1|  aldehyde dehydrogenase 3-2                              198   5e-56    
ref|XP_001655925.1|  AAEL012162-PA                                      197   5e-56    
ref|XP_005384347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   6e-56    
ref|XP_010709092.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    198   6e-56    
ref|XP_010634077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   6e-56    
gb|KFP52086.1|  Fatty aldehyde dehydrogenase                            196   6e-56    
emb|CDX72584.1|  BnaC07g46060D                                          197   6e-56    
ref|XP_004522591.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    199   7e-56    
ref|XP_006173634.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   7e-56    
ref|WP_006519525.1|  NAD-dependent aldehyde dehydrogenase               197   7e-56    
ref|XP_010634073.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   8e-56    
gb|AFK40162.1|  unknown                                                 187   8e-56    
ref|XP_009081631.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    190   9e-56    
ref|WP_017654159.1|  aldehyde dehydrogenase                             196   9e-56    
ref|XP_009857901.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    196   9e-56    
ref|XP_004522588.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    198   9e-56    
ref|WP_044480861.1|  aldehyde dehydrogenase                             196   1e-55    
ref|XP_011285421.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   1e-55    
gb|KEH39462.1|  NAD-dependent aldehyde dehydrogenase family protein     196   1e-55    
ref|XP_004656828.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   1e-55    
ref|XP_004900048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   1e-55    
ref|XP_004852263.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   1e-55    
dbj|BAD25530.1|  putative aldehyde dehydrogenase                        196   1e-55    
ref|XP_006173633.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   1e-55    
ref|XP_004656827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   2e-55    
ref|XP_010634072.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   2e-55    
ref|XP_011285420.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   2e-55    
ref|XP_010634071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   2e-55    
gb|KFP68902.1|  Fatty aldehyde dehydrogenase                            196   2e-55    
ref|XP_002115478.1|  hypothetical protein TRIADDRAFT_59449              197   2e-55    
ref|NP_001047578.1|  Os02g0647900                                       196   2e-55    
ref|XP_005864401.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   2e-55    
ref|WP_017321468.1|  hypothetical protein                               195   2e-55    
ref|XP_009706334.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    196   2e-55    
ref|XP_004618543.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   2e-55    
gb|KGL91398.1|  Fatty aldehyde dehydrogenase                            195   2e-55    
ref|XP_006033158.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    196   2e-55    
ref|XP_010364620.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   2e-55    
gb|EYU46263.1|  hypothetical protein MIMGU_mgv1a0057251mg               192   2e-55    
ref|XP_010350240.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   2e-55    
ref|XP_010364618.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   3e-55    
ref|XP_011285418.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   3e-55    
ref|XP_008145077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   3e-55    
ref|WP_015220115.1|  aldehyde dehydrogenase                             195   3e-55    
ref|XP_004071943.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   3e-55    
ref|XP_006278584.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   3e-55    
ref|XP_009977281.1|  PREDICTED: fatty aldehyde dehydrogenase            194   3e-55    
gb|KJB17710.1|  hypothetical protein B456_003G011600                    192   4e-55    
ref|XP_006033155.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    196   4e-55    
ref|XP_007046778.1|  Aldehyde dehydrogenase 3F1 isoform 1               195   4e-55    
ref|XP_006470601.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   4e-55    
ref|XP_001688504.1|  AGAP005124-PB                                      195   4e-55    
gb|AEE62197.1|  unknown                                                 195   4e-55    
gb|EEC73696.1|  hypothetical protein OsI_08280                          195   5e-55    
ref|XP_004383705.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   5e-55    
ref|XP_004618542.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   5e-55    
ref|XP_005945730.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   5e-55    
gb|AGI96741.1|  aldehyde dehydrogenase 3-1 varian D                     195   5e-55    
ref|XP_011080288.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    195   5e-55    
ref|XP_009881041.1|  PREDICTED: fatty aldehyde dehydrogenase-like       195   5e-55    
ref|XP_006102547.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   6e-55    
gb|KFR05497.1|  Fatty aldehyde dehydrogenase                            195   6e-55    
ref|XP_004437781.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    193   6e-55    
ref|XP_008200006.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    189   6e-55    
ref|XP_004437780.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   7e-55    
ref|XP_001843954.1|  conserved hypothetical protein                     195   7e-55    
ref|XP_002587582.1|  hypothetical protein BRAFLDRAFT_230530             194   7e-55    
ref|XP_003569985.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   7e-55    
ref|XP_008580123.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   7e-55    
ref|WP_010301979.1|  aldehyde dehydrogenase                             194   7e-55    
ref|XP_004383704.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   7e-55    
ref|XP_003941230.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   7e-55    
ref|XP_011285412.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    196   8e-55    
ref|XP_005747342.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    193   8e-55    
ref|WP_006456928.1|  aldehyde dehydrogenase                             194   8e-55    
gb|KFV10145.1|  Fatty aldehyde dehydrogenase                            194   8e-55    
gb|ELK13254.1|  Aldehyde dehydrogenase family 3 member B1               191   8e-55    
ref|XP_010572041.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    193   9e-55    
ref|WP_012407600.1|  aldehyde dehydrogenase                             194   9e-55    
ref|WP_026376419.1|  aldehyde dehydrogenase                             194   9e-55    
gb|KGL85122.1|  Fatty aldehyde dehydrogenase                            189   9e-55    
ref|XP_004568665.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   1e-54    
ref|XP_004437782.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   1e-54    
ref|XP_005598406.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   1e-54    
ref|XP_009944126.1|  PREDICTED: fatty aldehyde dehydrogenase            194   1e-54    
ref|XP_011190641.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    194   1e-54    
ref|XP_006911364.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    191   1e-54    
ref|XP_010216864.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    189   1e-54    
ref|XP_314005.4|  AGAP005124-PC                                         194   1e-54    
ref|XP_005945729.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    194   1e-54    
ref|WP_038287602.1|  aldehyde dehydrogenase                             193   1e-54    
ref|XP_011190639.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    194   1e-54    
gb|KFP11933.1|  Fatty aldehyde dehydrogenase                            194   1e-54    



>ref|XP_009790112.1| PREDICTED: aldehyde dehydrogenase [Nicotiana sylvestris]
Length=477

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKEN  +LLDAMK+EL+KFYG DPL S D+SRIVN+NHF RL+KLLDD+KV  K+V
Sbjct  252  YIITTKENVPKLLDAMKLELEKFYGNDPLKSGDISRIVNANHFHRLSKLLDDNKVVDKVV  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDE  LKIAPTIL+DVPED+LIMKEEIFGPLLPILTVNKVED I+ INAR+KPLAA
Sbjct  312  HGGQRDENNLKIAPTILLDVPEDSLIMKEEIFGPLLPILTVNKVEDSIEFINAREKPLAA  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKLE+EFV N+SAGGLLINDT LH+A  TLPF GVGESG GSYHG+FSFEAFSH
Sbjct  372  YLFTGNKKLEEEFVRNISAGGLLINDTTLHLATSTLPFGGVGESGMGSYHGRFSFEAFSH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL+RSFGGD+ ARYPPYTP+K R L+AL++GN++ +IRALLG 
Sbjct  432  KKAVLRRSFGGDVPARYPPYTPEKVRFLKALLNGNILGLIRALLGW  477



>ref|XP_009593287.1| PREDICTED: aldehyde dehydrogenase [Nicotiana tomentosiformis]
Length=477

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKENA +LLDAMK+EL+KFYGKDPL S DLSRIVN+NHF RL+KLLDD+KV  K+V
Sbjct  252  YIITTKENAPKLLDAMKLELEKFYGKDPLKSGDLSRIVNANHFHRLSKLLDDNKVVDKVV  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDE  LKIAPTIL+DVPED+LIMKEEIFGPLL ILTVNKVE+ I+ INAR+KPLAA
Sbjct  312  HGGQRDENNLKIAPTILLDVPEDSLIMKEEIFGPLLLILTVNKVEESIQFINAREKPLAA  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKLE+EFV N+SAGGLLINDT LH+A  TLPF GVGESG GSYHG+FSFEAFSH
Sbjct  372  YLFTGDKKLEEEFVRNISAGGLLINDTTLHIATSTLPFGGVGESGMGSYHGRFSFEAFSH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL+RSFGGD+ ARYPPYTP+K R L+AL++G+++ +IRALLG 
Sbjct  432  KKAVLRRSFGGDVPARYPPYTPEKVRFLKALLNGDILGLIRALLGW  477



>ref|XP_004242034.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Solanum 
lycopersicum]
Length=474

 Score =   357 bits (916),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE+  +LLDAMK EL+KFYGKDPL S DLSRIVN+NHF RL+KLLDD+KV  K+V
Sbjct  249  YIITTKESVPKLLDAMKQELEKFYGKDPLKSGDLSRIVNANHFQRLSKLLDDNKVVDKVV  308

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDE  LKI+PTIL+DVPED+LIMKEEIFGPLLPI+TVNKVED I+ I AR+KPLAA
Sbjct  309  HGGQRDENNLKISPTILLDVPEDSLIMKEEIFGPLLPIITVNKVEDSIQFIKAREKPLAA  368

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFTSNKKLE+EFV N+SAGGLLINDT L VA+ TLPF GVGESG GS HGKFSF+ FSH
Sbjct  369  YLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPFGGVGESGMGSCHGKFSFDTFSH  428

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL+RSF GD+ ARYPPYT  KAR L+AL++G++I +IRAL+G 
Sbjct  429  KKAVLRRSFAGDVPARYPPYTAGKARFLKALLNGDIIGLIRALIGW  474



>ref|XP_002520352.1| Aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF42138.1| Aldehyde dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL++FYG++PL SKDLSRIVNSNHFSRL KLLD+DKVSGKIV
Sbjct  267  YIITTKDYAPKLVDALKQELERFYGENPLVSKDLSRIVNSNHFSRLIKLLDEDKVSGKIV  326

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERDE  LKIAPTILMDVP+D+LIM EEIFGPLLPI+ VNK+E+   +IN+R KPLAA
Sbjct  327  HGGERDEANLKIAPTILMDVPQDSLIMNEEIFGPLLPIVMVNKIEESFDLINSRTKPLAA  386

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL+Q+FVT +SAGGL++NDT +H+AVHTLPF GVGESGTG+YHGKFSF+AFSH
Sbjct  387  YLFTNKKKLKQQFVTCVSAGGLVVNDTTVHLAVHTLPFGGVGESGTGAYHGKFSFDAFSH  446

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RL++AL+ G +  II AL G 
Sbjct  447  KKAVLYRSFTGDAAIRYPPYTKGKLRLMKALIGGGIWSIISALFGW  492



>gb|KDO80590.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=282

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKVSGKIV
Sbjct  54   HIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIV  113

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  KPLAA
Sbjct  114  HGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAA  173

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF GV ESG G+YHGKFSF+ FSH
Sbjct  174  YLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSH  233

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG
Sbjct  234  KKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLG  278



>gb|KDO80588.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
 gb|KDO80589.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=321

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKVSGKIV
Sbjct  93   HIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIV  152

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  KPLAA
Sbjct  153  HGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAA  212

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF GV ESG G+YHGKFSF+ FSH
Sbjct  213  YLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSH  272

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  273  KKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  318



>gb|KDO80586.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=397

 Score =   337 bits (863),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKVSGKIV
Sbjct  169  HIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIV  228

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  KPLAA
Sbjct  229  HGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAA  288

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF GV ESG G+YHGKFSF+ FSH
Sbjct  289  YLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSH  348

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  349  KKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  394



>gb|KDO80587.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=398

 Score =   337 bits (863),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKVSGKIV
Sbjct  170  HIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIV  229

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  KPLAA
Sbjct  230  HGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAA  289

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF GV ESG G+YHGKFSF+ FSH
Sbjct  290  YLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSH  349

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG
Sbjct  350  KKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLG  394



>ref|XP_006363887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Solanum 
tuberosum]
Length=474

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKEN  +LLDAMK EL+KFYGKDPL S DLSRIVN+NHF RL+KLLDD KV  K+V
Sbjct  249  YIITTKENVPKLLDAMKQELEKFYGKDPLKSGDLSRIVNANHFQRLSKLLDDKKVVDKVV  308

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDE  LKI+PTIL+DVPED+LIMKEEIFGPLLPI+TVNKVED I+ INAR+KPLAA
Sbjct  309  HGGQRDEDNLKISPTILLDVPEDSLIMKEEIFGPLLPIITVNKVEDSIQFINAREKPLAA  368

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFTSNKKLE+EFV N+SAGGLLINDT L VA+ TLPF GVGESG GS HGKFSF++FSH
Sbjct  369  YLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPFGGVGESGMGSCHGKFSFDSFSH  428

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL+RSF GD+ ARYPPYT  KAR L+AL++G+++ +IRAL+G 
Sbjct  429  KKAVLRRSFAGDVPARYPPYTTGKARFLKALLNGDILGLIRALIGW  474



>gb|KDO80584.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=487

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKVSGKIV
Sbjct  259  HIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIV  318

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  KPLAA
Sbjct  319  HGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAA  378

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF GV ESG G+YHGKFSF+ FSH
Sbjct  379  YLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSH  438

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  439  KKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  484



>ref|XP_006472804.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Citrus 
sinensis]
 gb|KDO80585.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=493

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKVSGKIV
Sbjct  265  HIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  KPLAA
Sbjct  325  HGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF GV ESG G+YHGKFSF+ FSH
Sbjct  385  YLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  445  KKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  490



>ref|XP_004498346.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+DA+K EL+ FYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKVSGKIV
Sbjct  262  YIITTKNYAPKLVDALKTELEAFYGKNPLESKDLSRIVNSNHFARLTKLLDDDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+E+   +IN+  KPLAA
Sbjct  322  YGGEKDESKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLEESFDVINSGSKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NK L+++FV N+SAGG++INDT +H+AVHTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  382  YIFTNNKNLKEKFVMNVSAGGVVINDTTMHLAVHTLPFGGVGESGLGAYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ I+RA+LG+
Sbjct  442  KKAVLYRSFFGDAPIRYPPYTATKMRLLKALVGGGILNIVRAILGM  487



>ref|XP_006434229.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47469.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=493

 Score =   337 bits (865),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKVSGKIV
Sbjct  265  HIITTKDFAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  KPLAA
Sbjct  325  HGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF GV ESG G+YHGKFSF+ FSH
Sbjct  385  YLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  445  KKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  490



>ref|XP_004498347.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=526

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+DA+K EL+ FYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKVSGKIV
Sbjct  300  YIITTKNYAPKLVDALKTELEAFYGKNPLESKDLSRIVNSNHFARLTKLLDDDKVSGKIV  359

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+E+   +IN+  KPLAA
Sbjct  360  YGGEKDESKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLEESFDVINSGSKPLAA  419

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NK L+++FV N+SAGG++INDT +H+AVHTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  420  YIFTNNKNLKEKFVMNVSAGGVVINDTTMHLAVHTLPFGGVGESGLGAYHGKFSFDAFSH  479

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ I+RA+LG+
Sbjct  480  KKAVLYRSFFGDAPIRYPPYTATKMRLLKALVGGGILNIVRAILGM  525



>gb|AFK46379.1| unknown [Medicago truncatula]
Length=280

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF RL +LLDDDKVSGKIV
Sbjct  54   YIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHFDRLIRLLDDDKVSGKIV  113

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+++   +IN+  KPLAA
Sbjct  114  HGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAPKPLAA  173

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+N KL+++FV  +SAGGL+I+DT +H+AVHTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  174  YIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSH  233

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL G
Sbjct  234  KKAVLYRSFFGDAFIRYPPYTSTKTRLMKALMGGGFLAIIRALFG  278



>gb|KEH40518.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF RL +LLDDDKVSGKIV
Sbjct  262  YIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHFDRLIRLLDDDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+++   +IN+  KPLAA
Sbjct  322  HGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAPKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+N KL+++FV  +SAGGL+INDT +H+AVHTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  382  YIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL G
Sbjct  442  KKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRALFG  486



>ref|XP_002306641.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE93637.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHFSRLTKLLD+DKVSGKIV
Sbjct  262  YIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSNHFSRLTKLLDEDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K+ED   II +  KPLAA
Sbjct  322  YGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSKIEDSFDIIKSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PF GVGESG GSYHGKFSF+AF+H
Sbjct  382  YLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSFDAFTH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ RSF GD   RYPPYT  K RL++AL++GN+  I+R LLG+
Sbjct  442  KKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNVWTILRTLLGM  487



>ref|XP_010999403.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHF+RLTKLLD+DKVSGKIV
Sbjct  262  YIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSNHFARLTKLLDEDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K+ED   II +  KPLAA
Sbjct  322  YGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSKIEDSFDIIKSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PF GVGESG GSYHGKFSF+AF+H
Sbjct  382  YLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSFDAFTH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ RSF GD   RYPPYT  K RL++AL++GNL  I+R LLG+
Sbjct  442  KKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNLWTILRTLLGM  487



>gb|KJB59283.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=283

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF RL+KL+D++KVS KIV
Sbjct  54   YIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHFDRLSKLMDEEKVSSKIV  113

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD-KPLA  399
            HGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+KVE    +I++   KPLA
Sbjct  114  HGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDKVEQSFDLIHSSGGKPLA  173

Query  398  AYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFS  219
            AYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPF GVGESG GSYHGKFSF+AFS
Sbjct  174  AYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFSFDAFS  233

Query  218  HKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            HKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRALLG 
Sbjct  234  HKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRALLGW  280



>gb|KEH40517.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF RL +LLDDDKVSGKIV
Sbjct  262  YIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHFDRLIRLLDDDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+++   +IN+  KPLAA
Sbjct  322  HGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAPKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+N KL+++FV  +SAGGL+INDT +H+AVHTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  382  YIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL G
Sbjct  442  KKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRALFG  486



>gb|KGN54555.1| hypothetical protein Csa_4G361890 [Cucumis sativus]
Length=395

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTKE A +L++ MK EL+KFYGK+PL +KDLSRIVN+NHF RLT+LLDDDK+SGKIV
Sbjct  169  YVITTKEFAPKLVECMKQELEKFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKISGKIV  228

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+KVED   I+N+  KPLAA
Sbjct  229  HGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGTKPLAA  288

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPF GVGESG G+YHGKFSF+AFSH
Sbjct  289  YLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSH  348

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRALLG 
Sbjct  349  KKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILALIRALLGW  394



>ref|XP_002302229.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE81502.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HFSRLTKLLD+DKVS KIV
Sbjct  262  YIITTKDCADKLVDSLKKELETFYGKNPLESKDLSRIVNSKHFSRLTKLLDEDKVSRKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERDE  LKI+PTIL+DVP D+LIMKEEIFGPLLPIL V+K+ED   +IN+  KPLAA
Sbjct  322  YGGERDEANLKISPTILVDVPCDSLIMKEEIFGPLLPILIVSKIEDSFDMINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+++FV ++SAGG++IND A+H+A+HTLPF GVGESGTGSYHGKFSF+AFSH
Sbjct  382  YLFTNNKKLKEQFVMSVSAGGVVINDIAMHLAIHTLPFGGVGESGTGSYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL RSF GD   RYPPYT  K RL++A M+ N   I+RAL G
Sbjct  442  KKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWTILRALFG  486



>gb|ACJ85852.1| unknown [Medicago truncatula]
Length=488

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF RL +LLDDDKVSGKIV
Sbjct  262  YIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHFDRLIRLLDDDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+++   +IN+  KPLAA
Sbjct  322  HGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAPKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+N KL+++FV  +SAGGL+I+DT +H+AVHTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  382  YIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL G
Sbjct  442  KKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRALFG  486



>ref|XP_004290887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=486

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 191/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTKE A +L+DA+K ELD FYGK+PL SKDLSRIVNSNH+ RLTKLLD+DK+SGK++
Sbjct  258  HIITTKEFATKLVDALKSELDNFYGKNPLQSKDLSRIVNSNHYDRLTKLLDEDKISGKVI  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+  L+IAPTIL+DVP+D+LIM+EEIFGPLLPI+TV+K+ED   +I +  KPLAA
Sbjct  318  HGGERDKNNLRIAPTILLDVPQDSLIMQEEIFGPLLPIITVDKIEDSFDLITSGTKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+KL+  FV N+SAGGLLINDT LH+AV TLPF GVGESG G+YHGKFSFEAFSH
Sbjct  378  YLFTNNQKLKDHFVGNVSAGGLLINDTTLHLAVPTLPFGGVGESGMGAYHGKFSFEAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K  L++AL+ G+L+ IIRAL G 
Sbjct  438  KKAVVYRGFFGDAAVRYPPYTKGKLTLMKALVGGSLLGIIRALFGW  483



>ref|XP_004290886.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=489

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 191/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTKE A +L+DA+K ELD FYGK+PL SKDLSRIVNSNH+ RLTKLLD+DK+SGK++
Sbjct  261  HIITTKEFATKLVDALKSELDNFYGKNPLQSKDLSRIVNSNHYDRLTKLLDEDKISGKVI  320

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+  L+IAPTIL+DVP+D+LIM+EEIFGPLLPI+TV+K+ED   +I +  KPLAA
Sbjct  321  HGGERDKNNLRIAPTILLDVPQDSLIMQEEIFGPLLPIITVDKIEDSFDLITSGTKPLAA  380

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+KL+  FV N+SAGGLLINDT LH+AV TLPF GVGESG G+YHGKFSFEAFSH
Sbjct  381  YLFTNNQKLKDHFVGNVSAGGLLINDTTLHLAVPTLPFGGVGESGMGAYHGKFSFEAFSH  440

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K  L++AL+ G+L+ IIRAL G 
Sbjct  441  KKAVVYRGFFGDAAVRYPPYTKGKLTLMKALVGGSLLGIIRALFGW  486



>ref|XP_007161479.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
 gb|ESW33473.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
Length=493

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTKE A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF+RL KLLDDDKVSGKIV
Sbjct  267  YVITTKEYAAKLVDALKTELEKFYGKNPLESKDLSRIVNSNHFNRLKKLLDDDKVSGKIV  326

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+  ++IN+  KPLAA
Sbjct  327  YGGEKDESKLKISPTVLLDVPRDSLIMSEEIFGPLLPILTVDKLEESFQVINSGPKPLAA  386

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NKKL++ FV N+SAGGL++NDT LH+AVHTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  387  YIFTNNKKLKELFVMNISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSFDAFSH  446

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  447  KKAVLYRSFIGDASVRYPPYTTTKQRLLKALIGGGILGIIRALFGW  492



>gb|KHN21716.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=411

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 193/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+K YGK+PL S+DLSRIV SNHF+RL+KLLDDDKV+GKIV
Sbjct  185  YVITTKDCAPELVDALKTELEKCYGKNPLESEDLSRIVTSNHFARLSKLLDDDKVAGKIV  244

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DEK+L+IAPT+L+DVP D+LIM +EIFGPLLPI+TVNKVE+ I +IN+  KPLAA
Sbjct  245  YGGEKDEKKLRIAPTLLLDVPRDSLIMGDEIFGPLLPIITVNKVEESIDLINSGTKPLAA  304

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NKKL+++FV N+ AGGLL+NDT LH+ V TLPF GVGESG G+YHGKFSF+AF+H
Sbjct  305  YIFTTNKKLKEQFVMNVPAGGLLVNDTVLHLVVDTLPFGGVGESGMGAYHGKFSFDAFTH  364

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RL++AL+ G  + IIRAL G 
Sbjct  365  KKAVLYRSFAGDSSLRYPPYTDTKLRLMKALIGGRFLGIIRALFGW  410



>ref|XP_003526638.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=491

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 193/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+K YGK+PL S+DLSRIV SNHF+RL+KLLDDDKV+GKIV
Sbjct  265  YVITTKDCAPKLVDALKTELEKCYGKNPLESEDLSRIVTSNHFARLSKLLDDDKVAGKIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DEK+L+IAPT+L+DVP D+LIM EEIFGPLLPI+TVNKVE+ I +IN+  KPLAA
Sbjct  325  YGGEKDEKKLRIAPTLLLDVPRDSLIMGEEIFGPLLPIITVNKVEESIDLINSGTKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NKKL+++FV N+ AGGLL+NDT LH+ V TLPF GVGESG G+YHGKFSF+AF+H
Sbjct  385  YIFTTNKKLKEQFVMNVPAGGLLVNDTVLHLVVDTLPFGGVGESGMGAYHGKFSFDAFTH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RL++AL+ G  + IIRAL G 
Sbjct  445  KKAVLYRSFAGDSSLRYPPYTDTKLRLMKALIGGRFLGIIRALFGW  490



>gb|KJB59281.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
 gb|KJB59282.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=402

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF RL+KL+D++KVS KIV
Sbjct  173  YIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHFDRLSKLMDEEKVSSKIV  232

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD-KPLA  399
            HGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+KVE    +I++   KPLA
Sbjct  233  HGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDKVEQSFDLIHSSGGKPLA  292

Query  398  AYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFS  219
            AYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPF GVGESG GSYHGKFSF+AFS
Sbjct  293  AYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFSFDAFS  352

Query  218  HKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            HKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRALLG 
Sbjct  353  HKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRALLGW  399



>ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
 ref|XP_004161167.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTKE A +L++ MK EL+KFYGK+PL +KDLSRIVN+NHF RLT+LLDDDK+SGKIV
Sbjct  258  YVITTKEFAPKLVECMKQELEKFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKISGKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+KVED   I+N+  KPLAA
Sbjct  318  HGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGTKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRALLG 
Sbjct  438  KKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILALIRALLGW  483



>ref|XP_010243505.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Nelumbo nucifera]
Length=567

 Score =   334 bits (857),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A  L+D +K  L++F+GKDPL SKDLSRIVNSNHFSRL KLLD+DKVSGKIV
Sbjct  336  YIITTKAYAPTLIDGLKNILEEFFGKDPLESKDLSRIVNSNHFSRLAKLLDEDKVSGKIV  395

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDE RL IAPTIL+DVPED+LIM EEIFGPLLPI+TV+KVED   II +R KPLAA
Sbjct  396  HGGQRDETRLMIAPTILLDVPEDSLIMNEEIFGPLLPIITVDKVEDSFDIIKSRSKPLAA  455

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFTS+KKLE+EFV N+SAGG+LINDT +H+   +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  456  YLFTSSKKLEKEFVENISAGGMLINDTVVHLTNPSLPFGGVGESGIGSYHGKFSFDAFSH  515

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPYTP K R+LRA++ G++I  I AL+G 
Sbjct  516  KKAVLYRSLYGDAPVRYPPYTPGKLRILRAILDGSIIGAILALIGF  561



>gb|KHG28299.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=493

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 196/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF RL+KL+D++KVS KIV
Sbjct  264  YIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHFDRLSKLMDEEKVSSKIV  323

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD-KPLA  399
            HGG+R+EK L+IAPTIL+DVP ++LIMKEEIFGPLLPI+TV+KVE    +I++   KPLA
Sbjct  324  HGGQRNEKNLQIAPTILLDVPVNSLIMKEEIFGPLLPIITVDKVEQSFDLIHSSGGKPLA  383

Query  398  AYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFS  219
            AYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPF GVGESG GSYHGKFSF+AFS
Sbjct  384  AYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFSFDAFS  443

Query  218  HKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            HKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRALLG 
Sbjct  444  HKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRALLGW  490



>ref|XP_010243504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Nelumbo nucifera]
Length=568

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A  L+D +K  L++F+GKDPL SKDLSRIVNSNHFSRL KLLD+DKVSGKIV
Sbjct  337  YIITTKAYAPTLIDGLKNILEEFFGKDPLESKDLSRIVNSNHFSRLAKLLDEDKVSGKIV  396

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDE RL IAPTIL+DVPED+LIM EEIFGPLLPI+TV+KVED   II +R KPLAA
Sbjct  397  HGGQRDETRLMIAPTILLDVPEDSLIMNEEIFGPLLPIITVDKVEDSFDIIKSRSKPLAA  456

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFTS+KKLE+EFV N+SAGG+LINDT +H+   +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  457  YLFTSSKKLEKEFVENISAGGMLINDTVVHLTNPSLPFGGVGESGIGSYHGKFSFDAFSH  516

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPYTP K R+LRA++ G++I  I AL+G 
Sbjct  517  KKAVLYRSLYGDAPVRYPPYTPGKLRILRAILDGSIIGAILALIGF  562



>ref|XP_011003449.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HFSRLTKLLD+DKVS KIV
Sbjct  262  YIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSKHFSRLTKLLDEDKVSRKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K+ED   II +  KPLAA
Sbjct  322  YGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSKIEDSFDIIKSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PF GVGESG GSYHGKFSF+AF+H
Sbjct  382  YLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSFDAFTH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ RSF GD   RYPPYT  K RL++AL++GNL  I+R LLG+
Sbjct  442  KKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNLWTILRTLLGM  487



>ref|XP_006575169.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=496

 Score =   331 bits (848),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSR+VNSNHF+RLTKLLDDDKVSGKIV
Sbjct  271  YIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRVVNSNHFNRLTKLLDDDKVSGKIV  330

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG++DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  KPLAA
Sbjct  331  YGGQKDENKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDVINSGPKPLAA  390

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NKKL+++FV  +SAGGL++NDT LH+AVHTLPF GVGESG G+YHGKFSFEAFSH
Sbjct  391  YIFTNNKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSFEAFSH  450

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD   RYPPYT  K RLL+A++ G +  I+RAL G 
Sbjct  451  KKAVLYRKFIGDAPVRYPPYTNTKMRLLKAIIGGGIHGIVRALFGW  496



>ref|XP_010268979.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Nelumbo 
nucifera]
Length=489

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 194/226 (86%), Gaps = 1/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+DA+K  L++F+GKDPL SKDLSRIVNS+HFSRLTKLLD+DKVSGKIV
Sbjct  261  YIITTKTFATKLIDALKHVLEEFFGKDPLQSKDLSRIVNSSHFSRLTKLLDEDKVSGKIV  320

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+RDE +LKIAPTIL+DVPED+LIM EEIFGPLLPI+TV+KVED + IIN+R KPLAA
Sbjct  321  YGGQRDETQLKIAPTILLDVPEDSLIMNEEIFGPLLPIITVDKVEDSLNIINSRSKPLAA  380

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFTS+KKLE+EFV  +SAGG+LINDT LH+   +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  381  YLFTSSKKLEKEFVEKISAGGMLINDTVLHLTNPSLPFGGVGESGFGSYHGKFSFDAFSH  440

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKA+L R F GD+  RYPPYTP+K RLL AL+  +   +I AL+GL
Sbjct  441  KKAILYRPFIGDVTVRYPPYTPRKIRLLDALLHHS-TGVIPALIGL  485



>ref|XP_006596209.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Glycine max]
Length=422

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKVSGKIV
Sbjct  197  YIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHFNRLTKLLDDDKVSGKIV  256

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  KPLAA
Sbjct  257  YGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKIEESFDVINSGSKPLAA  316

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPF GVGESG G+YHGKF+FEAFSH
Sbjct  317  YIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTFEAFSH  376

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  377  KKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRALFGW  422



>gb|KJB59280.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=493

 Score =   330 bits (846),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF RL+KL+D++KVS KIV
Sbjct  264  YIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHFDRLSKLMDEEKVSSKIV  323

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD-KPLA  399
            HGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+KVE    +I++   KPLA
Sbjct  324  HGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDKVEQSFDLIHSSGGKPLA  383

Query  398  AYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFS  219
            AYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPF GVGESG GSYHGKFSF+AFS
Sbjct  384  AYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFSFDAFS  443

Query  218  HKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            HKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRALLG 
Sbjct  444  HKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRALLGW  490



>ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX2 
[Glycine max]
Length=487

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKVSGKIV
Sbjct  262  YIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHFNRLTKLLDDDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  KPLAA
Sbjct  322  YGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKIEESFDVINSGSKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPF GVGESG G+YHGKF+FEAFSH
Sbjct  382  YIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTFEAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  442  KKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRALFGW  487



>gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis]
Length=492

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 193/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D +K EL++ YG +PL SKDLSRIVNSNHF RLT+LLD+DKVSG+IV
Sbjct  257  YIITTKDFAPKLIDTLKRELERCYGTEPLESKDLSRIVNSNHFDRLTRLLDEDKVSGRIV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RD  +L+IAPT+L  VP+D+LIM EEIFGPLLP++TV+++E+   +IN+R KPLAA
Sbjct  317  CGGQRDRDKLRIAPTVLQGVPQDSLIMSEEIFGPLLPVITVDRLEESFDLINSRTKPLAA  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL+ EFV+N+SAGGL+IND+ALH+AVHTLPF GV ESG GSYHGKFSF+ FSH
Sbjct  377  YLFTNRKKLKHEFVSNVSAGGLVINDSALHLAVHTLPFGGVAESGMGSYHGKFSFDVFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD  ARYPPYT  K RLL+AL+SG+++ II+AL+G 
Sbjct  437  KKAVLYRSFMGDAAARYPPYTQGKLRLLKALLSGSILGIIKALMGW  482



>ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX1 
[Glycine max]
 gb|KHN20143.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=496

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKVSGKIV
Sbjct  271  YIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHFNRLTKLLDDDKVSGKIV  330

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  KPLAA
Sbjct  331  YGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKIEESFDVINSGSKPLAA  390

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPF GVGESG G+YHGKF+FEAFSH
Sbjct  391  YIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTFEAFSH  450

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  451  KKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRALFGW  496



>ref|XP_003523436.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Glycine max]
 ref|XP_006578967.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Glycine max]
 ref|XP_006578968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X3 [Glycine max]
Length=488

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+D +K EL+ FYG++PL S+DLSRIV+SNHF+RL+KLL+DDKVSGKIV
Sbjct  262  YVITTKDYAPKLVDTLKTELESFYGRNPLESEDLSRIVSSNHFARLSKLLNDDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DEK+L+IAPTIL+DVP+D+ IM EEIFGPLLPI+TVNK+E+ I +IN+  KPLAA
Sbjct  322  YGGEKDEKKLRIAPTILLDVPQDSSIMGEEIFGPLLPIITVNKLEESIDVINSGAKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT++ K +++FV N+SAGGLL+NDTALH+ V TLPF GVGESG G+YHGKFSF+AF+H
Sbjct  382  YVFTTDNKFKEQFVKNVSAGGLLVNDTALHLVVDTLPFGGVGESGMGAYHGKFSFDAFTH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RL++AL+ G ++ IIRAL G 
Sbjct  442  KKAVLYRSFAGDSAIRYPPYTDTKLRLMKALVGGRILGIIRALFGW  487



>gb|EYU23873.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=394

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +++DA+  EL+KFYGKDPL S DLSRIVN +HF RL KL+DD+KVSGKIV
Sbjct  169  YILTTKEYAPKVVDALAAELEKFYGKDPLGSNDLSRIVNIHHFDRLEKLMDDEKVSGKIV  228

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RD+  LKIAPTIL+DV ED+LIM EEIFGPLLPI+TVNK+ED    INA+ KPLAA
Sbjct  229  HGGQRDKTNLKIAPTILLDVEEDSLIMNEEIFGPLLPIVTVNKIEDSFGAINAKGKPLAA  288

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++K L++EFV ++SAG + IN+TALH     LPF GVGESG GSYHGKFSF+AFSH
Sbjct  289  YLFTNDKTLKEEFVRSVSAGAIAINETALHFMEVGLPFGGVGESGMGSYHGKFSFDAFSH  348

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL+R FGG++ ARYPPY P K +LL+AL+ GN+I I+RALLG 
Sbjct  349  KKAVLRRGFGGEVSARYPPYAPWKLQLLKALVKGNIIEILRALLGW  394



>gb|KHN47009.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=491

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+D +K EL+ FYG++PL S+DLSRIV+SNHF+RL+KLL+DDKVSGKIV
Sbjct  265  YVITTKDYAPKLVDTLKTELESFYGRNPLESEDLSRIVSSNHFARLSKLLNDDKVSGKIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DEK+L+IAPTIL+DVP+D+ IM EEIFGPLLPI+TVNK+E+ I +IN+  KPLAA
Sbjct  325  YGGEKDEKKLRIAPTILLDVPQDSSIMGEEIFGPLLPIITVNKLEESIDVINSGAKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT++ K +++FV N+SAGGLL+NDTALH+ V TLPF GVGESG G+YHGKFSF+AF+H
Sbjct  385  YVFTTDNKFKEQFVKNVSAGGLLVNDTALHLVVDTLPFGGVGESGMGAYHGKFSFDAFTH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RL++AL+ G ++ IIRAL G 
Sbjct  445  KKAVLYRSFAGDSAIRYPPYTDTKLRLMKALVGGRILGIIRALFGW  490



>gb|KHG30796.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 193/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A++L+D+ K EL++FYGK+PL SKDLSR+VNSNHF+RL KLLD+DKVS KIV
Sbjct  262  YIITTKDYAVELVDSFKCELERFYGKNPLESKDLSRVVNSNHFARLLKLLDEDKVSSKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++KVED   +IN+  KPLAA
Sbjct  322  YGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDKVEDSFDLINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPF GVG+SG G+YHGKFSF+ FSH
Sbjct  382  YMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDTFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K RLL+AL+ G+++ IIRAL+G 
Sbjct  442  KKAVLYRSFAGDAPLRYPPYTNGKLRLLKALLGGSILGIIRALMGW  487



>ref|XP_010930724.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Elaeis 
guineensis]
Length=495

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 190/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A  L+D++K  L+KFYGKD   SKDLSRIVN+NHF RLT LLDD+KVSGKIV
Sbjct  266  YIITTKSFAPILVDSLKRTLEKFYGKDASESKDLSRIVNANHFKRLTSLLDDEKVSGKIV  325

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDEKRL IAPT+L+DVP D+LIMKEEIFGPLLPI+TV+KVED   +IN++ KPLAA
Sbjct  326  HGGQRDEKRLYIAPTLLLDVPHDSLIMKEEIFGPLLPIITVDKVEDSFDLINSKTKPLAA  385

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKLE++FV  +SAGG+LIND ALH+A H LPF GVGESG GSYHGKFSF+AFSH
Sbjct  386  YLFTKDKKLEEKFVNTVSAGGMLINDIALHLANHYLPFGGVGESGFGSYHGKFSFDAFSH  445

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F G+  ARYPPYTP+K +L+R L++G++I +  ALLG 
Sbjct  446  KKAVLSRGFFGEARARYPPYTPRKQKLVRQLLNGSIIAMFFALLGW  491



>gb|KDP32847.1| hypothetical protein JCGZ_12139 [Jatropha curcas]
Length=493

 Score =   327 bits (839),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+++ K EL++FYGK+PL SKDLSRIVN NHFSRLTKLLD+DKVSGKIV
Sbjct  265  YMITTKDYATKLVESFKKELERFYGKNPLESKDLSRIVNFNHFSRLTKLLDEDKVSGKIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERDE  LKIAPT+L+DVP+++LIMKEEIFGPLLPI+ V+K+E+   +IN+  KPLAA
Sbjct  325  HGGERDEVNLKIAPTLLLDVPQNSLIMKEEIFGPLLPIVMVDKIEESFDLINSGTKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+Q+FV ++SAGG+++NDTA+H+AV TLPF GVGESGTG+YHGKFSF+ FSH
Sbjct  385  YLFTNNKKLKQQFVISVSAGGVVVNDTAVHLAVPTLPFGGVGESGTGAYHGKFSFDTFSH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD   RYPPY+  K RLL+ L+ G +  IIRAL G 
Sbjct  445  KKAVLYRGFAGDAPVRYPPYSSGKIRLLKVLLGGGIWDIIRALFGW  490



>gb|KHN20611.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=614

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSR+VNSNHF+RLTKLLDDDKVSGKIV
Sbjct  389  YIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRVVNSNHFNRLTKLLDDDKVSGKIV  448

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG++DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  KPLAA
Sbjct  449  YGGQKDENKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDVINSGPKPLAA  508

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NKKL+++FV  +SAGGL++NDT LH+AVHTLPF GVGESG G+YHGKFSFEAFSH
Sbjct  509  YIFTNNKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSFEAFSH  568

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD   RYPPYT  K RLL+A++ G +  I+RAL G 
Sbjct  569  KKAVLYRKFIGDAPVRYPPYTNTKMRLLKAIIGGGIHGIVRALFGW  614



>gb|EYU23872.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=476

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +++DA+  EL+KFYGKDPL S DLSRIVN +HF RL KL+DD+KVSGKIV
Sbjct  251  YILTTKEYAPKVVDALAAELEKFYGKDPLGSNDLSRIVNIHHFDRLEKLMDDEKVSGKIV  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RD+  LKIAPTIL+DV ED+LIM EEIFGPLLPI+TVNK+ED    INA+ KPLAA
Sbjct  311  HGGQRDKTNLKIAPTILLDVEEDSLIMNEEIFGPLLPIVTVNKIEDSFGAINAKGKPLAA  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++K L++EFV ++SAG + IN+TALH     LPF GVGESG GSYHGKFSF+AFSH
Sbjct  371  YLFTNDKTLKEEFVRSVSAGAIAINETALHFMEVGLPFGGVGESGMGSYHGKFSFDAFSH  430

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL+R FGG++ ARYPPY P K +LL+AL+ GN+I I+RALLG 
Sbjct  431  KKAVLRRGFGGEVSARYPPYAPWKLQLLKALVKGNIIEILRALLGW  476



>ref|XP_008444179.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
 ref|XP_008444180.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
Length=484

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L++++K EL++FYGK+PL SKD+SRIVN+NHF+R+TKLLDDD+VS KIV
Sbjct  258  YIITTKEFAPKLVESLKQELERFYGKNPLESKDISRIVNANHFNRVTKLLDDDEVSSKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG++D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K+ED  +I+N+  KPLAA
Sbjct  318  HGGQKDKTKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDKLEDSFEIVNSGTKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF++NKKL+++FV  +SAGG++INDT +H+AV TLPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRALLG 
Sbjct  438  KKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRALLGW  483



>ref|XP_007019116.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
 gb|EOY16341.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
Length=489

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +LLD+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKVSGKIV
Sbjct  262  YIITTKDYAPKLLDSFKRELEQFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKVSGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-DKPLA  399
            HGGERD+  LKIAPTIL+DVP D+LIM EEIFGPLLPI+ V+KVED   +IN+   KPLA
Sbjct  322  HGGERDKNNLKIAPTILLDVPLDSLIMNEEIFGPLLPIIMVDKVEDSFDVINSSGTKPLA  381

Query  398  AYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFS  219
            AYLFT+ +KL+++FV  +SAGGL++NDT +H+A HTLPF GVG+SG G+YHGKFSF+AFS
Sbjct  382  AYLFTNKEKLKEKFVATVSAGGLVVNDTTVHLAEHTLPFGGVGDSGMGAYHGKFSFDAFS  441

Query  218  HKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            HKKAVL R F  D   RYPPYT +K RLL+AL+ G+L+ IIRALLG 
Sbjct  442  HKKAVLYRGFACDAFVRYPPYTRRKLRLLQALLGGSLLSIIRALLGW  488



>ref|XP_007137428.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
 gb|ESW09422.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
Length=490

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A  L+D +K EL + YGK+PL S+DLSRIV+SNHF+RL+KLL+DDKVSGKIV
Sbjct  264  YVITTKDYAPTLVDTLKTELQECYGKNPLESEDLSRIVSSNHFARLSKLLNDDKVSGKIV  323

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK+E+ + +IN+ +KPLAA
Sbjct  324  YGGEKDENKLRIAPTILLDVPRDSLIMGEEIFGPLLPIITVNKLEESLDVINSGEKPLAA  383

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+++K ++ FV N+SAGGLL+NDT LH+ V TLPF GVGESG G+YHGKFSF+AF+H
Sbjct  384  YVFTTDEKFKELFVRNVSAGGLLVNDTTLHLLVDTLPFGGVGESGMGAYHGKFSFDAFTH  443

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD  ARYPPYT  K RL++AL++G ++ IIRALLG 
Sbjct  444  KKAVLYRSFAGDSSARYPPYTDTKQRLMKALVAGTVLGIIRALLGW  489



>ref|XP_007019117.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
 gb|EOY16342.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
Length=515

 Score =   326 bits (835),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 192/226 (85%), Gaps = 1/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +LLD+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKVSGKIV
Sbjct  288  YIITTKDYAPKLLDSFKRELEQFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKVSGKIV  347

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-DKPLA  399
            HGGERD+  LKIAPTIL+DVP D+LIM EEIFGPLLPI+ V+KVED   +IN+   KPLA
Sbjct  348  HGGERDKNNLKIAPTILLDVPLDSLIMNEEIFGPLLPIIMVDKVEDSFDVINSSGTKPLA  407

Query  398  AYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFS  219
            AYLFT+ +KL+++FV  +SAGGL++NDT +H+A HTLPF GVG+SG G+YHGKFSF+AFS
Sbjct  408  AYLFTNKEKLKEKFVATVSAGGLVVNDTTVHLAEHTLPFGGVGDSGMGAYHGKFSFDAFS  467

Query  218  HKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            HKKAVL R F  D   RYPPYT +K RLL+AL+ G+L+ IIRALLG
Sbjct  468  HKKAVLYRGFACDAFVRYPPYTRRKLRLLQALLGGSLLSIIRALLG  513



>ref|XP_008781593.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Phoenix 
dactylifera]
Length=495

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A  L+D+++  L+KFYG+D   SKDLSRIVN+NHF RLT LLDD+KVSGKIV
Sbjct  266  YIITTKSFAPILVDSLRRTLEKFYGEDASESKDLSRIVNANHFKRLTSLLDDEKVSGKIV  325

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDEK L IAPT+L+DVP D+LIMKEEIFGPLLPI+TV+KVED   +IN++ KPLAA
Sbjct  326  HGGQRDEKHLYIAPTLLLDVPHDSLIMKEEIFGPLLPIITVDKVEDSFDVINSKSKPLAA  385

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKLE++FV  +SAGG+LINDT LH+A   LPF GVGESG GSYHGKFSFEAFSH
Sbjct  386  YLFTKDKKLEEKFVKIVSAGGMLINDTVLHLANPYLPFGGVGESGFGSYHGKFSFEAFSH  445

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYTP+K +LLR L++G++I +  AL+G 
Sbjct  446  KKAVLSRGFGGETSARYPPYTPQKQKLLRQLLNGSIIALFLALIGW  491



>ref|XP_004142629.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member H1-like [Cucumis sativus]
Length=462

 Score =   323 bits (828),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L++++K EL++FYG +PL SKD+SRIVN+NHF+R++KLLDDD+VS KIV
Sbjct  236  YIITTKEFAPKLVESLKQELERFYGTNPLESKDISRIVNANHFNRVSKLLDDDEVSSKIV  295

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K+ED  +I+N+  KPLAA
Sbjct  296  HGGEKDKSKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDKLEDSFEIVNSGTKPLAA  355

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF++NKKL+++FV  +SAGG++INDT +H+AV TLPF GVGESG G+YHGKFSF+AFSH
Sbjct  356  YLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSFDAFSH  415

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRA+LG 
Sbjct  416  KKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRAILGW  461



>ref|XP_009420563.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=484

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+DA+K+ L+KFYGKDPL S DLSRIVNSNHF RL  LLDD+KVSG IV
Sbjct  256  YIITTKSFAPKLVDALKITLEKFYGKDPLESADLSRIVNSNHFKRLMNLLDDEKVSGTIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+R+EKRL+IAPTIL+DVP D+LIMKEE+FGPLLPI+TV+++ +G  +IN++ KPLAA
Sbjct  316  HGGQRNEKRLRIAPTILLDVPSDSLIMKEEVFGPLLPIVTVDELREGFGLINSKGKPLAA  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT ++KLE++FV ++SAGG++INDT L V    LPF GVGESG GSYHGKFSF+AFSH
Sbjct  376  YLFTKDRKLEEKFVKSVSAGGMVINDTILQVTNPRLPFGGVGESGMGSYHGKFSFDAFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGGD+  RYPPYT  K ++LR L++GN+I +  AL+G 
Sbjct  436  KKAVLSRGFGGDVSMRYPPYTAHKQKILRGLITGNIIAVFLALIGW  481



>ref|XP_010095408.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
 gb|EXB60100.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
Length=497

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 190/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D++K  L+KFYGK+PL SKDLSRIVNSNHF+RL KLLD++KVSGK+V
Sbjct  271  YIITTKDFAPKLVDSLKEVLEKFYGKNPLESKDLSRIVNSNHFARLMKLLDEEKVSGKVV  330

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGER+E  LKIAPTIL+DVP D+LIM EEIFGPLLPI+TV KVE+   IIN+  KPLAA
Sbjct  331  HGGERNETDLKIAPTILLDVPRDSLIMTEEIFGPLLPIITVEKVEESYDIINSGPKPLAA  390

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFTSN+KL+++FV  +SAGG+++NDT +H+AV TLPF GVGESG G+YHGKFSFEAFSH
Sbjct  391  YLFTSNEKLKKQFVMTISAGGVVVNDTTIHLAVVTLPFGGVGESGMGAYHGKFSFEAFSH  450

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ RSF  D   RYPPYT  K  LL+AL+ G+++ IIRAL G 
Sbjct  451  KKAVVYRSFVADAAVRYPPYTKGKLSLLKALVGGSILGIIRALFGW  496



>ref|XP_004161166.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L++++K EL++FYG +PL SKD+SRIVN+NHF+R++KLLDDD+VS KIV
Sbjct  258  YIITTKEFAPKLVESLKQELERFYGTNPLESKDISRIVNANHFNRVSKLLDDDEVSSKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K+ED  +I+N+  KPLAA
Sbjct  318  HGGEKDKSKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDKLEDSFEIVNSGTKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF++NKKL+++FV  +SAGG++INDT +H+AV TLPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRA+LG 
Sbjct  438  KKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRAILGW  483



>gb|KGN54554.1| hypothetical protein Csa_4G361880 [Cucumis sativus]
Length=484

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L++++K EL++FYG +PL SKD+SRIVN+NHF+R++KLLDDD+VS KIV
Sbjct  258  YIITTKEFAPKLVESLKQELERFYGTNPLESKDISRIVNANHFNRVSKLLDDDEVSSKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K+ED  +I+N+  KPLAA
Sbjct  318  HGGEKDKSKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDKLEDSFEIVNSGTKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF++NKKL+++FV  +SAGG++INDT +H+AV TLPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRA+LG 
Sbjct  438  KKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRAILGW  483



>ref|XP_010063405.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Eucalyptus 
grandis]
 gb|KCW70624.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=488

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D +K EL+ FYGK+PL SKDLSRIVNS+HF+RLTKLLD+DKVS K+V
Sbjct  262  YIITTKDLAPKLVDVLKNELETFYGKNPLESKDLSRIVNSDHFTRLTKLLDEDKVSKKVV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERD  +L+IAPTIL+DVP D+LIM EEIFGPLLPILTV+K+E+   IIN+  KPLAA
Sbjct  322  YGGERDPTKLQIAPTILLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDIINSGAKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT++KKL++ FV N+SAGGL++NDT +H+AVH LPF GVGESG G+YHGKFSF+AFSH
Sbjct  382  YIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ I+RAL G
Sbjct  442  KKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILGILRALFG  486



>ref|XP_011069490.1| PREDICTED: aldehyde dehydrogenase-like [Sesamum indicum]
Length=476

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y ITTKE A  L+DA+  EL+KFYGKDP+ S DLS I+NS HF RLTKLLDD+KVSGKIV
Sbjct  251  YAITTKEYASTLVDALSSELEKFYGKDPVKSNDLSSIINSYHFDRLTKLLDDEKVSGKIV  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RD+  LKIAPTI++D PED+LI+ EEIFGPLLPI+TVNK+ED I +I A++KPLAA
Sbjct  311  LGGQRDKANLKIAPTIVLDAPEDSLILNEEIFGPLLPIVTVNKIEDSITLIKAKEKPLAA  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++KKL++EF+ ++SAGG+ IN+ ALH    TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  371  YLFTNDKKLKEEFIRSVSAGGIAINEIALHALEPTLPFGGVGESGMGSYHGKFSFDAFSH  430

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK+VL+R F GD  ARYPPYTP K + L+A++SG++I I+RAL+G 
Sbjct  431  KKSVLQRGFSGDPAARYPPYTPGKLKFLQAMLSGSIIRILRALIGW  476



>gb|AES72293.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score =   322 bits (825),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 191/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+ F+GK+P+ S DLSRIV+SNHF+RL K+LDDDKVSGKIV
Sbjct  264  YVITTKDFAPKLVDALKKELESFFGKNPIESNDLSRIVSSNHFARLIKMLDDDKVSGKIV  323

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +L+IAPTI++D P+D+LIM EEIFGPLLPI+TVNK+E+   +INA  KPLAA
Sbjct  324  YGGEKDESKLRIAPTIVLDAPQDSLIMSEEIFGPLLPIITVNKLEESFDVINAGTKPLAA  383

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++ K +++FV N+SAGGLLINDT LH+ VHTLPF GVG+SG G+YHGKFSF+AF+H
Sbjct  384  YLFTNDNKFKEQFVKNVSAGGLLINDTVLHLVVHTLPFGGVGDSGMGAYHGKFSFDAFTH  443

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL R F GD   RYPPYT  K +L++AL++G++  ++RAL G 
Sbjct  444  RKAVLYRGFTGDASIRYPPYTDTKQKLMKALVAGDVTGVVRALFGW  489



>ref|XP_008219617.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Prunus mume]
Length=413

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L+D++K EL+ FYG +PL SKDLSRIVNSNHF+RLTKLLD+DKVSGKIV
Sbjct  185  YIVTTKDFAPKLVDSLKRELENFYGNNPLESKDLSRIVNSNHFARLTKLLDEDKVSGKIV  244

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++VE+   +IN+  KPLAA
Sbjct  245  LGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDRVEESFDLINSGTKPLAA  304

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPF GVGESG G+YHGKFSF+AFSH
Sbjct  305  YLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSFDAFSH  364

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  365  KKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRALFGW  410



>ref|XP_009383529.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK  A  L+DAMK  L+KFYGKDPL S DLSRIVN+ HF RLT LLDD+KVSG IV
Sbjct  265  YILTTKSFAPTLVDAMKKTLEKFYGKDPLESPDLSRIVNAKHFRRLTSLLDDEKVSGTIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG++DEK LKIAPT+L+DVP D+LIMKEEIFGPLLPI+T N+VED +  IN++ KPLAA
Sbjct  325  YGGQQDEKHLKIAPTLLLDVPHDSLIMKEEIFGPLLPIITFNEVEDCLDFINSKAKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +K+LE+ FV  +SAGG+LINDTALH+A   LPF GVGESG G+YHGKFSF++FSH
Sbjct  385  YLFTKDKRLEERFVKTVSAGGMLINDTALHLANPHLPFGGVGESGIGAYHGKFSFDSFSH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYTP+K ++LR L++G++I ++ A+LG 
Sbjct  445  KKAVLSRGFGGEAPARYPPYTPQKQKILRGLINGSIIALLLAILGW  490



>ref|XP_003602042.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=495

 Score =   322 bits (825),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 191/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+ F+GK+P+ S DLSRIV+SNHF+RL K+LDDDKVSGKIV
Sbjct  269  YVITTKDFAPKLVDALKKELESFFGKNPIESNDLSRIVSSNHFARLIKMLDDDKVSGKIV  328

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+DE +L+IAPTI++D P+D+LIM EEIFGPLLPI+TVNK+E+   +INA  KPLAA
Sbjct  329  YGGEKDESKLRIAPTIVLDAPQDSLIMSEEIFGPLLPIITVNKLEESFDVINAGTKPLAA  388

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++ K +++FV N+SAGGLLINDT LH+ VHTLPF GVG+SG G+YHGKFSF+AF+H
Sbjct  389  YLFTNDNKFKEQFVKNVSAGGLLINDTVLHLVVHTLPFGGVGDSGMGAYHGKFSFDAFTH  448

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL R F GD   RYPPYT  K +L++AL++G++  ++RAL G 
Sbjct  449  RKAVLYRGFTGDASIRYPPYTDTKQKLMKALVAGDVTGVVRALFGW  494



>ref|XP_007222253.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
 gb|EMJ23452.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
Length=493

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHF+RL KLLD+DKVSGKIV
Sbjct  265  YIVTTKDFAPKLVDSLKCELENFYGKNPLESKDLSRIVNSNHFARLIKLLDEDKVSGKIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++VE+   +IN+  KPLAA
Sbjct  325  LGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDRVEESFDLINSGTKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPF GVGESG G+YHGKFSF+AFSH
Sbjct  385  YLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSFDAFSH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  445  KKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRALFGW  490



>ref|XP_008219616.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=491

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L+D++K EL+ FYG +PL SKDLSRIVNSNHF+RLTKLLD+DKVSGKIV
Sbjct  263  YIVTTKDFAPKLVDSLKRELENFYGNNPLESKDLSRIVNSNHFARLTKLLDEDKVSGKIV  322

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++VE+   +IN+  KPLAA
Sbjct  323  LGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDRVEESFDLINSGTKPLAA  382

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPF GVGESG G+YHGKFSF+AFSH
Sbjct  383  YLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSFDAFSH  442

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  443  KKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRALFGW  488



>gb|EYU31773.1| hypothetical protein MIMGU_mgv1a018415mg [Erythranthe guttata]
Length=386

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTKE A +L+DA+  E++ FYGKDPL S DLS IVNS HF RL  LLDD+ VSGKIV
Sbjct  161  YVITTKEYASKLVDALSCEIENFYGKDPLQSNDLSSIVNSRHFDRLINLLDDETVSGKIV  220

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RD+ +LKIAPT+++D P+D+ IM EEIFGPLLPI+TVNK+ED I++I++++KPLAA
Sbjct  221  LGGQRDKVKLKIAPTVVLDAPKDSPIMNEEIFGPLLPIITVNKIEDSIRLISSKEKPLAA  280

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+++KKL++EF+T++SAGG++INDT LH+    LPF GVGESGTGSYHG+FSF+AFSH
Sbjct  281  YLFSNDKKLKEEFITSVSAGGMVINDTNLHLVEPNLPFGGVGESGTGSYHGRFSFDAFSH  340

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL+R F GD+ ARYPPY   K   L++L SGNLI ++RAL G 
Sbjct  341  KKAVLQRGFTGDIAARYPPYANWKIDFLKSLFSGNLIGVLRALFGW  386



>ref|XP_011027504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Populus 
euphratica]
Length=488

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HFSRLTKLLD+DKVS KIV
Sbjct  262  YIITTKDCADKLVDSLKKELETFYGKNPLESKDLSRIVNSKHFSRLTKLLDEDKVSRKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERDE  LKI PTIL+DVP D+LIMKEEIFGPLLPIL V+K+ED   +IN+  KPLAA
Sbjct  322  YGGERDEANLKICPTILVDVPCDSLIMKEEIFGPLLPILIVSKIEDSFDMINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+++FV ++SAGG++IND A+H+A+HTLPF GVGESGTGSYHGKFSF+AFSH
Sbjct  382  YLFTNNKKLKEQFVVSVSAGGVVINDIAMHLAIHTLPFGGVGESGTGSYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL RSF GD   RYPPYT  K RL++A M+ N   I+RALLG
Sbjct  442  KKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWNILRALLG  486



>ref|XP_009414877.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414878.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK  A  L+DAMK  L+KFYGKDPL S DLSRIVNSNHF RL  LLDD+ VSG IV
Sbjct  265  YILTTKSFAPTLVDAMKRTLEKFYGKDPLESADLSRIVNSNHFKRLMSLLDDENVSGTIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+RDE+ LKIAPT+L+DVP D+ IMKEEIFGP LPI+T ++VED I  IN++ KPLAA
Sbjct  325  YGGQRDEQHLKIAPTLLLDVPHDSSIMKEEIFGPFLPIVTFDEVEDCIDFINSKSKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT ++K+E +FV N+SAGG+L+ND ALH+A   LPF GVGESG G+YHGKFSF+AFSH
Sbjct  385  YLFTKDRKIEDQFVKNVSAGGILVNDVALHLANPHLPFGGVGESGIGAYHGKFSFDAFSH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYTP+K R+LR L++G++I ++ A+LG 
Sbjct  445  KKAVLSRGFGGEAPARYPPYTPQKQRILRGLINGSIIALVLAILGF  490



>ref|XP_011074837.1| PREDICTED: aldehyde dehydrogenase [Sesamum indicum]
Length=476

 Score =   318 bits (816),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTKE A +L+D +  EL+ FYGKDPL SKDLS I+N++HF R+TKLLDD+KVSGKIV
Sbjct  251  YVITTKEYASKLVDVLSAELENFYGKDPLQSKDLSSIINAHHFDRVTKLLDDEKVSGKIV  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG++D+  LKIAPTI++DVP+D+LIM EEIFGPLLPI+TVNK+++   +INA+ KPLAA
Sbjct  311  FGGQQDKTNLKIAPTIILDVPDDSLIMNEEIFGPLLPIVTVNKIKESFDVINAKGKPLAA  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+++KL+ EF+ ++SAGG+ IND ALH A   LPF GVGESG G+YHGKFSF+ FSH
Sbjct  371  YLFTNDQKLKAEFIGSVSAGGITINDVALHFAEAGLPFGGVGESGMGAYHGKFSFDTFSH  430

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL+R FGGD+ ARYPPY P K + L+AL+ G+++ ++RALLG 
Sbjct  431  KKAVLQRGFGGDVAARYPPYAPWKLQFLKALLRGSILGVLRALLGW  476



>ref|XP_006847205.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
 gb|ERN08786.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
Length=416

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 191/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIIT K NA +++++ K  L+KFYGKDP  SKDLSRIVNSNHF+RL+ +LDD+KV  KIV
Sbjct  188  YIITEKSNAPKVVESFKSTLEKFYGKDPFESKDLSRIVNSNHFARLSNMLDDEKVCDKIV  247

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RDEK L IAPT++ D P D+L+M +EIFGPLLPI++V+K+++  ++IN+R KPLAA
Sbjct  248  HGGQRDEKHLMIAPTLIQDAPMDSLVMSDEIFGPLLPIISVDKIDESFELINSRAKPLAA  307

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFTS+KKLE++FV ++SAGGLL+NDT LH+ + +LPF GVG+SG G+YHGKFSF+ FSH
Sbjct  308  YLFTSDKKLEEKFVKSISAGGLLVNDTCLHLTISSLPFGGVGDSGIGAYHGKFSFDIFSH  367

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL+RSFGGDL ARYPPYTP+K + L++L++ +++ I+  L+G
Sbjct  368  KKAVLRRSFGGDLSARYPPYTPRKQQFLKSLLALDILGILLVLIG  412



>ref|XP_008444183.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Cucumis melo]
Length=484

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 191/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L++ M+ EL+ FYGK+PL +KDLSRIVN+NHF RLT+LLDDDK+SGKIV
Sbjct  258  YIITTKEFAPKLVECMRQELENFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKISGKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+KVED   I+N+  KPLAA
Sbjct  318  HGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGTKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRALLG 
Sbjct  438  KKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILGLIRALLGW  483



>gb|KHG30273.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIIT K+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF+RL+KLLD+DKVS KIV
Sbjct  262  YIITMKDYAQKLIDSFKCELERFYGKDPLESKDLSRIVNSNHFARLSKLLDEDKVSSKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+KVED   +IN+  KPLAA
Sbjct  322  HGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDKVEDSFDVINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPF GVG+SG G+YHGKFSF+AFSH
Sbjct  382  YLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRALLG 
Sbjct  442  KKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRALLGW  487



>ref|XP_008444182.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Cucumis melo]
Length=488

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 191/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L++ M+ EL+ FYGK+PL +KDLSRIVN+NHF RLT+LLDDDK+SGKIV
Sbjct  262  YIITTKEFAPKLVECMRQELENFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKISGKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+KVED   I+N+  KPLAA
Sbjct  322  HGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPF GVGESG G+YHGKFSF+AFSH
Sbjct  382  YLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRALLG 
Sbjct  442  KKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILGLIRALLGW  487



>ref|XP_010530214.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
 ref|XP_010530215.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
Length=482

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 193/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +++D +K EL+ FYGK+P+ SKDLSRIVNSNHF RL K+LD++KVSGKIV
Sbjct  256  YILTTKDYAPKVIDVLKHELEAFYGKNPIESKDLSRIVNSNHFDRLAKMLDEEKVSGKIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG++D   LKIAPTIL+DVP D+LIM EEIFGPLLPILT++K+E+  +++N+R KPLAA
Sbjct  316  YGGQKDRANLKIAPTILLDVPRDSLIMSEEIFGPLLPILTLDKLEECFEVVNSRSKPLAA  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++KKL++ F  N+SAGG+++ND A+H+A+HTLPF GVGESG GSYHGKFSF+AFSH
Sbjct  376  YLFTNDKKLKERFAMNVSAGGVVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSFDAFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPY+  K RLL+AL++ NL+ +++A+ GL
Sbjct  436  KKAVLYRSFLGDASMRYPPYSRGKLRLLKALVNSNLMDLLKAIFGL  481



>ref|XP_008338656.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=496

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D++K EL+ FYGK+ L SKDLSRIVN +HF+RLTKLLD+DKVSGKIV
Sbjct  268  YIITTKDFAPKLVDSLKQELENFYGKNQLESKDLSRIVNPHHFARLTKLLDEDKVSGKIV  327

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE D+  L+IAPTIL+DVP+D+LIM EEIFGPLLPILTV K+ED   +IN+  KPLAA
Sbjct  328  HGGETDKTNLRIAPTILLDVPQDSLIMSEEIFGPLLPILTVEKMEDSFDLINSGTKPLAA  387

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL++ FV  +SAGGL++NDT +H+AV +LPF GVGESG G+YHGKFSF+AFSH
Sbjct  388  YLFTNKKKLKEHFVNTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSFDAFSH  447

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K R+L+AL+SG +  IIRAL G 
Sbjct  448  KKAVVYRGFFGDASIRYPPYTKGKLRILKALISGGISSIIRALFGW  493



>ref|XP_009379029.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009379042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
Length=486

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF+RLTKLLD+DKVSGKIV
Sbjct  258  YIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHFARLTKLLDEDKVSGKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPI+TV+K+ED   +IN+  KPLAA
Sbjct  318  HGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPIVTVDKLEDSFDLINSGAKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL++ FV  +SAGGLLINDT +H+AV +LPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFTNKKKLKEHFVNTVSAGGLLINDTTVHLAVPSLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL G 
Sbjct  438  KKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRALFGW  483



>gb|KJB29203.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=457

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKVS KIV
Sbjct  229  YIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKVSSKIV  288

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+KVED   +IN+  KPLAA
Sbjct  289  HGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDKVEDSFDVINSGTKPLAA  348

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPF GVG+SG G+YHGKFSF+AFSH
Sbjct  349  YLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDAFSH  408

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRALLG
Sbjct  409  KKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRALLG  453



>ref|NP_001077676.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32027.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=421

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF RL+KLLD+ +VS KIV
Sbjct  195  YILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLSKLLDEKEVSDKIV  254

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  255  YGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAA  314

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  315  YLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSH  374

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + LLGL
Sbjct  375  KKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLGL  420



>gb|KJB29202.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=490

 Score =   317 bits (812),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKVS KIV
Sbjct  262  YIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKVSSKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+KVED   +IN+  KPLAA
Sbjct  322  HGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDKVEDSFDVINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPF GVG+SG G+YHGKFSF+AFSH
Sbjct  382  YLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRALLG 
Sbjct  442  KKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRALLGW  487



>ref|XP_009379028.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009379041.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   317 bits (812),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF+RLTKLLD+DKVSGKIV
Sbjct  263  YIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHFARLTKLLDEDKVSGKIV  322

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPI+TV+K+ED   +IN+  KPLAA
Sbjct  323  HGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPIVTVDKLEDSFDLINSGAKPLAA  382

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL++ FV  +SAGGLLINDT +H+AV +LPF GVGESG G+YHGKFSF+AFSH
Sbjct  383  YLFTNKKKLKEHFVNTVSAGGLLINDTTVHLAVPSLPFGGVGESGMGAYHGKFSFDAFSH  442

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL G 
Sbjct  443  KKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRALFGW  488



>ref|XP_010674968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   317 bits (812),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITT+E A +L+D +K EL++FYG +PL S DLSRIVNSNHF RL +LLD+DKV+GKIV
Sbjct  251  YIITTREFAPRLIDTLKRELERFYGSEPLQSNDLSRIVNSNHFDRLARLLDEDKVAGKIV  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG++D+ +LKIAPT+L DVP D+LIMKEEIFGPLLPI+TV K+E+   II +R KPLAA
Sbjct  311  YGGQKDKAQLKIAPTLLRDVPLDSLIMKEEIFGPLLPIITVEKLEESYDIITSRTKPLAA  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ K L+ +FV  +SAGGL+IND+A+H+AVHTLPF GV ESG G+YHGKFSFEAFSH
Sbjct  371  YLFTNRKNLKDQFVRTVSAGGLVINDSAIHLAVHTLPFGGVEESGMGAYHGKFSFEAFSH  430

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K +LL+AL+ G+++ I++AL+G 
Sbjct  431  KKAVLYRSFIGDASVRYPPYTHGKMKLLKALIGGSILGILQALVGW  476



>ref|XP_008378442.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
 ref|XP_008365200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Malus domestica]
Length=491

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF+RLTKLLD+DKVSGKIV
Sbjct  263  YIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHFARLTKLLDEDKVSGKIV  322

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPILTV+K+ED   +IN+  KPLAA
Sbjct  323  HGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPILTVDKLEDSFDLINSGAKPLAA  382

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL++ FV  +SAGGL+INDT +H+AV ++PF GVGESG G+YHGKFSF+AFSH
Sbjct  383  YLFTNKKKLKEHFVNTVSAGGLVINDTTVHLAVPSVPFGGVGESGMGAYHGKFSFDAFSH  442

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL G 
Sbjct  443  KKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRALFGW  488



>ref|XP_008365201.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Malus domestica]
Length=486

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF+RLTKLLD+DKVSGKIV
Sbjct  258  YIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHFARLTKLLDEDKVSGKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPILTV+K+ED   +IN+  KPLAA
Sbjct  318  HGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPILTVDKLEDSFDLINSGAKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+ KKL++ FV  +SAGGL+INDT +H+AV ++PF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFTNKKKLKEHFVNTVSAGGLVINDTTVHLAVPSVPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL G 
Sbjct  438  KKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRALFGW  483



>ref|XP_010664200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Vitis vinifera]
Length=488

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L+DA+K EL+ +YGKDPL SKDL+ IVNSNHF+RL KLLDDDKVSGKI+
Sbjct  262  YIVTTKDFAPKLIDALKHELEAWYGKDPLESKDLAHIVNSNHFARLAKLLDDDKVSGKII  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RD+  LK APTIL+DVPED+L+M EEIFGPLLPILTV+K+ED   +I +R KPLAA
Sbjct  322  HGGQRDKANLKFAPTILLDVPEDSLVMNEEIFGPLLPILTVDKLEDSFDMITSRGKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+++FV  +SAGGL+INDT LH A  TLPF GVGESG GSYHGKFS+EAFSH
Sbjct  382  YLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSYEAFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ +I AL+G 
Sbjct  442  RKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVGVILALIGW  487



>ref|XP_008227590.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=549

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 190/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L++A+K+EL++F+GKDP+ SKD+SRIV+S  F RL K+LD+DKVS KIV
Sbjct  322  YIITTKDFAPKLIEALKIELEQFFGKDPMNSKDISRIVSSTQFKRLAKMLDEDKVSDKIV  381

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE +LKIAPTIL+D+PE++ +M+EEIFGPL+PI+TV K+ED   +IN+R KPLA 
Sbjct  382  LGGQMDENQLKIAPTILLDIPEESQLMQEEIFGPLMPIVTVEKIEDSFDVINSRPKPLAV  441

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+N++L++ FV N+S+GG+LINDT LHV++  LPF GVGESG GSYHGKFSF+ FSH
Sbjct  442  YVFTNNEQLKKGFVENISSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSH  501

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP+K RLL+A++SG++  II AL+G 
Sbjct  502  KKAVLYRSFSGDSSLRYPPYTPEKQRLLKAVISGDIFSIILALIGW  547



>gb|EYU22982.1| hypothetical protein MIMGU_mgv1a005625mg [Erythranthe guttata]
Length=476

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTKE A +L+DA   E++ FYGKDPL S DLS +VNS HF RL  LLDD+KVSGKIV
Sbjct  251  YVITTKEYASKLVDAFACEMENFYGKDPLQSNDLSSVVNSRHFDRLINLLDDEKVSGKIV  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RD+ +LKIAP+I+++  ED+LIM EEIFGPLLPI+TV+K+ED I II +++KPLAA
Sbjct  311  LGGQRDKTKLKIAPSIILNPSEDSLIMNEEIFGPLLPIITVDKIEDCIGIITSKEKPLAA  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF++N+KL+ +F++N+S+GG++INDT LH+A  +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  371  YLFSNNEKLKNDFISNVSSGGMVINDTTLHLAEASLPFGGVGESGMGSYHGKFSFDAFSH  430

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVLKR F GD+  RYPPYT  K   ++A++SGN++ IIRAL G 
Sbjct  431  KKAVLKRGFNGDVSVRYPPYTNGKLNFVKAMLSGNILRIIRALFGW  476



>ref|XP_007213817.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
 gb|EMJ15016.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
Length=451

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L++A+K+EL++F+GKDP+ SKD+SR+V+S  F RL K+LD+DKVS KIV
Sbjct  224  YIITTKDFAPKLIEALKIELEQFFGKDPMNSKDISRVVSSTQFKRLAKMLDEDKVSDKIV  283

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE +LKIAPTIL+D+PE++ +M+EEIFGPL+PI+TV  +ED   +IN+R KPLA 
Sbjct  284  LGGQMDENQLKIAPTILLDIPEESQLMQEEIFGPLMPIVTVETIEDSFDVINSRPKPLAV  343

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+N++L++ FV N+S+GG+LINDT LHV++  LPF GVGESG GSYHGKFSF+ FSH
Sbjct  344  YVFTNNEQLKKGFVENISSGGMLINDTVLHVSITGLPFGGVGESGMGSYHGKFSFDGFSH  403

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP+K RLL+A++SG++  II AL+G 
Sbjct  404  KKAVLYRSFSGDSSLRYPPYTPEKQRLLKAVISGDIFSIILALIGW  449



>gb|AAM61211.1| aldehyde dehydrogenase, putative [Arabidopsis thaliana]
Length=484

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF RL+KLLD+ +VS KIV
Sbjct  258  YILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLSKLLDEKEVSDKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  318  YGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFTHNKKLKERFTATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + LLGL
Sbjct  438  KKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLGL  483



>ref|NP_175081.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 ref|NP_849770.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 sp|Q70DU8.2|AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member H1; Short=AtALDH4; 
Short=Ath-ALDH4 [Arabidopsis thaliana]
 gb|AAG50550.1|AC074228_5 aldehyde dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAL59944.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE32025.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32026.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=484

 Score =   315 bits (806),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF RL+KLLD+ +VS KIV
Sbjct  258  YILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLSKLLDEKEVSDKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  318  YGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + LLGL
Sbjct  438  KKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLGL  483



>emb|CBI19000.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L+DA+K EL+ +YGKDPL SKDL+ IVNSNHF+RL KLLDDDKVSGKI+
Sbjct  324  YIVTTKDFAPKLIDALKHELEAWYGKDPLESKDLAHIVNSNHFARLAKLLDDDKVSGKII  383

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+RD+  LK APTIL+DVPED+L+M EEIFGPLLPILTV+K+ED   +I +R KPLAA
Sbjct  384  HGGQRDKANLKFAPTILLDVPEDSLVMNEEIFGPLLPILTVDKLEDSFDMITSRGKPLAA  443

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NKKL+++FV  +SAGGL+INDT LH A  TLPF GVGESG GSYHGKFS+EAFSH
Sbjct  444  YLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSYEAFSH  503

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ +I AL+G 
Sbjct  504  RKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVGVILALIGW  549



>ref|XP_008387507.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Malus domestica]
Length=550

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLLD+DKVS KIV
Sbjct  323  YIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKLLDEDKVSNKIV  382

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K+ED   +IN++ KPLA 
Sbjct  383  LGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEKIEDSFSVINSKPKPLAV  442

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPF GVGESG GSYHGKFSF+ FSH
Sbjct  443  YAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSH  502

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD   RYPPYTP+K RL RA+++G++  II AL+G 
Sbjct  503  KKAVLYRGFAGDSDLRYPPYTPEKQRLFRAVINGDIFTIILALIGW  548



>ref|XP_008367720.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=560

 Score =   313 bits (803),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLLD+DKVS KIV
Sbjct  333  YIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKLLDEDKVSNKIV  392

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K+ED   +IN++ KPLA 
Sbjct  393  LGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEKIEDSFSVINSKPKPLAV  452

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPF GVGESG GSYHGKFSF+ FSH
Sbjct  453  YAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSH  512

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GD   RYPPYTP+K RL RA+++G++  II AL+G 
Sbjct  513  KKAVLYRGFAGDSDLRYPPYTPEKQRLFRAVINGDIFTIILALIGW  558



>gb|KDO52216.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=507

 Score =   312 bits (799),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF+RL  LLD+DKVS KIV
Sbjct  279  YIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHFARLASLLDEDKVSDKIV  338

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K+ED   +I ++ KPLAA
Sbjct  339  YGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEKIEDSFDVIKSKPKPLAA  398

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y F+ ++++++EFV N+SAGG++ NDT +H  V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  399  YFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSFDAFSH  458

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL+G 
Sbjct  459  KKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLALIGW  504



>ref|XP_009355863.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=560

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLLD+DKVS KIV
Sbjct  333  YIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKLLDEDKVSNKIV  392

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K+ED   +IN++ KPLA 
Sbjct  393  LGGQRDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEKIEDSFSVINSKPKPLAV  452

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPF GVGESG GSYHGKFSF+ FSH
Sbjct  453  YAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSH  512

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGGD   RYPPYTP+K RL +A+++ +++ II +L+G 
Sbjct  513  KKAVLYRGFGGDSDLRYPPYTPEKQRLFKAVINRDILTIILSLIGW  558



>gb|KDO52215.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=543

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF+RL  LLD+DKVS KIV
Sbjct  315  YIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHFARLASLLDEDKVSDKIV  374

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K+ED   +I ++ KPLAA
Sbjct  375  YGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEKIEDSFDVIKSKPKPLAA  434

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y F+ ++++++EFV N+SAGG++ NDT +H  V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  435  YFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSFDAFSH  494

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL+G 
Sbjct  495  KKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLALIGW  540



>ref|XP_006432086.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464930.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR45326.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=543

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF+RL  LLD+DKVS KIV
Sbjct  315  YIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHFARLASLLDEDKVSDKIV  374

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K+ED   +I ++ KPLAA
Sbjct  375  YGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEKIEDSFDVIKSKPKPLAA  434

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y F+ ++++++EFV N+SAGG++ NDT +H  V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  435  YFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSFDAFSH  494

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL+G 
Sbjct  495  KKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLALIGW  540



>ref|XP_006304446.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
 gb|EOA37344.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
Length=484

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +L+D MK EL+KFYGK+P+ SKD+SRI+NSNHF RL+KLL++  VS KIV
Sbjct  258  YILTTKEYAPKLIDTMKHELEKFYGKNPMESKDMSRIINSNHFDRLSKLLEEKDVSDKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+D ++LKI+PTIL+DVP D+LIM EEIFGP+LPI+TVN +E+   +I +R KPLAA
Sbjct  318  YGGEKDREKLKISPTILLDVPLDSLIMSEEIFGPILPIITVNNLEESFDVIRSRPKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL+++F   +SAGG+++ND A+H+A+HTLPF GVGESG GSYHGKFSF+AFSH
Sbjct  378  YLFTHNKKLKEKFAMTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  438  KKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFDIFKVLLGL  483



>ref|XP_007159875.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
 gb|ESW31869.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
Length=566

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIIT KE A +L+ A+K EL++F+GKDPL SKD+SRIV+ N F+RL KLLD+DKVSGKIV
Sbjct  340  YIITRKEFAPKLISALKEELEQFFGKDPLESKDMSRIVSPNQFARLVKLLDEDKVSGKIV  399

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDEK+LKI+PTI++DVPEDAL+M+EEIFGP++PI+TV+ +ED   II +R KPLAA
Sbjct  400  LGGQRDEKKLKISPTIILDVPEDALVMQEEIFGPIMPIITVDNIEDCYSIIKSRPKPLAA  459

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N++L++++V  +S+GG+LIND  +HVA   LPF GV ESG G YHGKFSF++FSH
Sbjct  460  YLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFSFDSFSH  519

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +K VL RSF GD   RYPPYTP+K +LL+A+++GN++ I  ALLG 
Sbjct  520  RKPVLYRSFDGDSSIRYPPYTPQKEKLLKAIITGNIVQIFLALLGW  565



>ref|XP_002888606.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64865.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   309 bits (791),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNS HF RL+K+LD+ +VS KIV
Sbjct  258  YILTTKEYAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHFDRLSKMLDEKEVSDKIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  318  YGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAA  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  378  YLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  438  KKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKVLLGL  483



>emb|CBI21614.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   311 bits (796),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF RLT+LLD+D+VS KI+
Sbjct  320  YIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHFKRLTRLLDEDEVSDKII  379

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  +E+   +IN++ KPLAA
Sbjct  380  IGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKSKPLAA  439

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  440  YLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFSH  499

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ ALLG 
Sbjct  500  KKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGF  545



>emb|CAN73659.1| hypothetical protein VITISV_044129 [Vitis vinifera]
Length=541

 Score =   311 bits (796),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF RLT+LLD+D+VS KI+
Sbjct  313  YIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHFKRLTRLLDEDEVSDKII  372

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  +E+   +IN++ KPLAA
Sbjct  373  IGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKSKPLAA  432

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  433  YLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFSH  492

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ ALLG 
Sbjct  493  KKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGF  538



>ref|XP_002273730.2| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Vitis 
vinifera]
Length=549

 Score =   311 bits (796),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF RLT+LLD+D+VS KI+
Sbjct  321  YIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHFKRLTRLLDEDEVSDKII  380

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  +E+   +IN++ KPLAA
Sbjct  381  IGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKSKPLAA  440

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  441  YLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFSH  500

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ ALLG 
Sbjct  501  KKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGF  546



>gb|KCW70623.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=514

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  719  LDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIVHGGERDEKRLKI  540
            +D +K EL+ FYGK+PL SKDLSRIVNS+HF+RLTKLLD+DKVS K+V+GGERD  +L+I
Sbjct  300  VDVLKNELETFYGKNPLESKDLSRIVNSDHFTRLTKLLDEDKVSKKVVYGGERDPTKLQI  359

Query  539  APTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQE  360
            APTIL+DVP D+LIM EEIFGPLLPILTV+K+E+   IIN+  KPLAAY+FT++KKL++ 
Sbjct  360  APTILLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDIINSGAKPLAAYIFTNDKKLKEH  419

Query  359  FVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGD  180
            FV N+SAGGL++NDT +H+AVH LPF GVGESG G+YHGKFSF+AFSHKKAV+ RSF GD
Sbjct  420  FVNNVSAGGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGD  479

Query  179  LGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
               RYPPYT  K RL++AL+ G+++ I+RAL G
Sbjct  480  AAIRYPPYTNGKLRLMKALLGGSILGILRALFG  512



>gb|KCW70625.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=479

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 187/225 (83%), Gaps = 9/225 (4%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+     L+    EL+ FYGK+PL SKDLSRIVNS+HF+RLTKLLD+DKVS K+V
Sbjct  262  YIITTKD-----LN----ELETFYGKNPLESKDLSRIVNSDHFTRLTKLLDEDKVSKKVV  312

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERD  +L+IAPTIL+DVP D+LIM EEIFGPLLPILTV+K+E+   IIN+  KPLAA
Sbjct  313  YGGERDPTKLQIAPTILLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDIINSGAKPLAA  372

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT++KKL++ FV N+SAGGL++NDT +H+AVH LPF GVGESG G+YHGKFSF+AFSH
Sbjct  373  YIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSFDAFSH  432

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ I+RAL G
Sbjct  433  KKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILGILRALFG  477



>ref|NP_001065921.1| Os11g0186200 [Oryza sativa Japonica Group]
 gb|AAY23278.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91775.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27766.1| Os11g0186200 [Oryza sativa Japonica Group]
 dbj|BAG96824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67818.1| hypothetical protein OsI_35395 [Oryza sativa Indica Group]
 gb|EEE51777.1| hypothetical protein OsJ_33226 [Oryza sativa Japonica Group]
Length=482

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RLT L++D KV+ KIV
Sbjct  252  YVITTKSFAPELVDSLKRVLKRFYGEDPLQSEDLSRIVNSNHFRRLTNLIEDKKVAQKIV  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+ED I+ IN+R KPLAA
Sbjct  312  YGGQTDEKQLKIAPTVLLDVPLDTTLMAEEIFGPLLPIVTVDKIEDSIQFINSRTKPLAA  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPF GVG+SG GSYHGKFSF+ F+H
Sbjct  372  YLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYT +K ++LR L++G+   +I ALLG 
Sbjct  432  KKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGF  477



>gb|AAX96338.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
Length=494

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RLT L++D KV+ KIV
Sbjct  264  YVITTKSFAPELVDSLKRVLKRFYGEDPLQSEDLSRIVNSNHFRRLTNLIEDKKVAQKIV  323

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+ED I+ IN+R KPLAA
Sbjct  324  YGGQTDEKQLKIAPTVLLDVPLDTTLMAEEIFGPLLPIVTVDKIEDSIQFINSRTKPLAA  383

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPF GVG+SG GSYHGKFSF+ F+H
Sbjct  384  YLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTH  443

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYT +K ++LR L++G+   +I ALLG 
Sbjct  444  KKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGF  489



>gb|KJB64495.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=442

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 190/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A++L+D+ K EL+ FYGK+PL SKDLSR+VNSNHF+RL KLLD+DKVS KIV
Sbjct  214  YIITTKDYAVELVDSFKCELELFYGKNPLESKDLSRVVNSNHFARLLKLLDEDKVSSKIV  273

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++KVED   +I +  KPLAA
Sbjct  274  YGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDKVEDSFDLITSGAKPLAA  333

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPF GVG+SG G+YHGKFSF+ FSH
Sbjct  334  YMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDTFSH  393

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K  LL+AL+ G+++ IIRAL+G 
Sbjct  394  KKAVLYRSFAGDAPLRYPPYTDGKLGLLKALLGGSILGIIRALMGW  439



>ref|XP_003577758.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=481

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 183/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK    +L+D++K  L++FYG+DPL S DLSRIVNS HF R+ KL++D KV+ KIV
Sbjct  251  YIITTKTFVTELVDSLKRVLERFYGEDPLQSADLSRIVNSKHFHRIAKLIEDKKVAEKIV  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+E+ I+ INA  KPLAA
Sbjct  311  LGGQTDEKQLKIAPTVLVDVPHDTALMTEEIFGPLLPIVTVDKIEESIEHINAGTKPLAA  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ NKKL+QEF+ N+S+GG+L+ND ALH+A   LPF GVG+SGTGSYHGKF+F+ FSH
Sbjct  371  YLFSRNKKLQQEFIANVSSGGMLVNDVALHLANPHLPFGGVGDSGTGSYHGKFTFDCFSH  430

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYTP+K R+LR L+ G+   +I ALLG 
Sbjct  431  KKAVLVRGFGGEANARYPPYTPEKQRILRGLIKGSFFALILALLGF  476



>ref|XP_004502483.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=493

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF+RL KL+D+DKVS KIV
Sbjct  267  YIITTKDFAPLLVDALKTELENFFGKNPLESNDLSRIVSSNHFNRLIKLMDEDKVSDKIV  326

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG +DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK+E+   +IN+  KPLAA
Sbjct  327  YGGAKDESKLRIAPTILLDVPRDSLIMSEEIFGPLLPIITVNKLEESFDVINSGTKPLAA  386

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++ K +++FV  +SAGGLLINDT LH+ V TLPF GVG+SG G+YHGKFSF+AF+H
Sbjct  387  YLFTNDNKFKEQFVKKVSAGGLLINDTVLHLVVCTLPFGGVGDSGMGAYHGKFSFDAFTH  446

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL R F GD   RYPPYT  K + ++AL++G++  I+RAL G 
Sbjct  447  RKAVLYRGFTGDSSLRYPPYTDTKQKCMKALVAGDVPGIVRALFGW  492



>ref|XP_006662790.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Oryza brachyantha]
Length=400

 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RLT L++D  VS KIV
Sbjct  169  YVITTKSFAPELVDSLKRALIRFYGEDPLQSEDLSRIVNSNHFCRLTNLIEDKTVSQKIV  228

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DEK+LKIAPT+L+DVP D+ +M  EIFGPLLPI+TV+K+ED I+ IN++ KPLAA
Sbjct  229  YGGQTDEKQLKIAPTVLVDVPLDSALMTSEIFGPLLPIVTVDKIEDSIEFINSKTKPLAA  288

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKL++ FV+N+ AGG+L+ND ALH+A   LPF GVG+SG GSYHGKFSF+ F+H
Sbjct  289  YLFTKDKKLQEAFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTH  348

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  349  KKAVLIRGFGGEAAARYPPYTTEKQKILRGLINGSFIALILALLGF  394



>ref|XP_004502482.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF+RL KL+D+DKVS KIV
Sbjct  262  YIITTKDFAPLLVDALKTELENFFGKNPLESNDLSRIVSSNHFNRLIKLMDEDKVSDKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG +DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK+E+   +IN+  KPLAA
Sbjct  322  YGGAKDESKLRIAPTILLDVPRDSLIMSEEIFGPLLPIITVNKLEESFDVINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++ K +++FV  +SAGGLLINDT LH+ V TLPF GVG+SG G+YHGKFSF+AF+H
Sbjct  382  YLFTNDNKFKEQFVKKVSAGGLLINDTVLHLVVCTLPFGGVGDSGMGAYHGKFSFDAFTH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL R F GD   RYPPYT  K + ++AL++G++  I+RAL G 
Sbjct  442  RKAVLYRGFTGDSSLRYPPYTDTKQKCMKALVAGDVPGIVRALFGW  487



>emb|CAE51203.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=480

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +L+D MK+EL+KFYGK+P+ SKD+SRIVNSNH  RL+KLLD+ +VS KIV
Sbjct  254  YILTTKEYAPKLIDDMKLELEKFYGKNPIESKDMSRIVNSNHLDRLSKLLDEKEVSDKIV  313

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  314  YGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAA  373

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+A SH
Sbjct  374  YLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDASSH  433

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + LLGL
Sbjct  434  KKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLGL  479



>ref|XP_011031097.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=553

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L+DA++  +++F+G DP+ SK +SRIV+SNHFSRL +LLD+DKV  KIV
Sbjct  325  YIITTKDFAPKLIDALRNGIEEFFGADPMESKYISRIVSSNHFSRLERLLDEDKVCNKIV  384

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R++K+LKIAPTI +DVPED+ +M+EEIFGPLLPI+TV   +D I +IN++ +PL A
Sbjct  385  VGGQRNQKKLKIAPTIFLDVPEDSQLMQEEIFGPLLPIITVENAKDSIDLINSKPEPLVA  444

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+KL  +FV N+S GG++INDT LHV V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  445  YLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSH  504

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP+  +L+RA+M+G ++ II AL+G 
Sbjct  505  KKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGILDIILALMGW  550



>gb|KJB64493.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=490

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 190/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A++L+D+ K EL+ FYGK+PL SKDLSR+VNSNHF+RL KLLD+DKVS KIV
Sbjct  262  YIITTKDYAVELVDSFKCELELFYGKNPLESKDLSRVVNSNHFARLLKLLDEDKVSSKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++KVED   +I +  KPLAA
Sbjct  322  YGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDKVEDSFDLITSGAKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPF GVG+SG G+YHGKFSF+ FSH
Sbjct  382  YMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDTFSH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYT  K  LL+AL+ G+++ IIRAL+G 
Sbjct  442  KKAVLYRSFAGDAPLRYPPYTDGKLGLLKALLGGSILGIIRALMGW  487



>ref|XP_010025727.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62440.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=545

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 184/224 (82%), Gaps = 0/224 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK  A +L+ A+++ L++F+GK+PL S+D+SRIVN  HF RL KLLD+D  S KIV
Sbjct  317  YIVTTKSFAPKLVAALQLTLEEFFGKNPLESQDMSRIVNLYHFKRLAKLLDEDGTSDKIV  376

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDE  L+IAPTIL+DVPED+LIM+EEIFGPLLPILTV+ +EDG  +IN++ KPLAA
Sbjct  377  LGGQRDENNLRIAPTILLDVPEDSLIMQEEIFGPLLPILTVDNIEDGFHMINSKPKPLAA  436

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ +  L+++FV N+SAGG+LIND  LH+ V TLPF GVG+SG G+YHGKFSF+AFSH
Sbjct  437  YLFSDDNGLQKQFVQNISAGGMLINDAVLHLTVPTLPFGGVGDSGMGAYHGKFSFDAFSH  496

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            KK +L RSF GD   RYPPYTP+K RLL+AL+S N+I II ALL
Sbjct  497  KKGILYRSFKGDASTRYPPYTPEKQRLLKALISFNIIGIILALL  540



>ref|XP_010500136.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Camelina 
sativa]
Length=486

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +LLDAMK EL+ FYGK P+ SKD+SRIVNSNHF RL+KLL++ +VS KIV
Sbjct  260  YILTTKEFAPKLLDAMKHELETFYGKKPMDSKDMSRIVNSNHFDRLSKLLEEKEVSDKIV  319

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N +E+   +I++R KPLAA
Sbjct  320  YGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNNLEESFDVIHSRPKPLAA  379

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  380  YLFTHNQKLKERFAMKVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSH  439

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  440  KKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVLLGL  485



>ref|XP_010025726.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW62439.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=550

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 184/224 (82%), Gaps = 0/224 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK  A +L+ A+++ L++F+GK+PL S+D+SRIVN  HF RL KLLD+D  S KIV
Sbjct  322  YIVTTKSFAPKLVAALQLTLEEFFGKNPLESQDMSRIVNLYHFKRLAKLLDEDGTSDKIV  381

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDE  L+IAPTIL+DVPED+LIM+EEIFGPLLPILTV+ +EDG  +IN++ KPLAA
Sbjct  382  LGGQRDENNLRIAPTILLDVPEDSLIMQEEIFGPLLPILTVDNIEDGFHMINSKPKPLAA  441

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ +  L+++FV N+SAGG+LIND  LH+ V TLPF GVG+SG G+YHGKFSF+AFSH
Sbjct  442  YLFSDDNGLQKQFVQNISAGGMLINDAVLHLTVPTLPFGGVGDSGMGAYHGKFSFDAFSH  501

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            KK +L RSF GD   RYPPYTP+K RLL+AL+S N+I II ALL
Sbjct  502  KKGILYRSFKGDASTRYPPYTPEKQRLLKALISFNIIGIILALL  545



>ref|XP_010461437.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +L+DAMK EL+ FYGK P+ SKD+SRIVNSNHF RL+KLL++ +VS KIV
Sbjct  259  YILTTKEFAPKLIDAMKHELETFYGKKPMDSKDMSRIVNSNHFDRLSKLLEEKEVSDKIV  318

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N +E+   +I++R KPLAA
Sbjct  319  YGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNNLEESFDVIHSRPKPLAA  378

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  379  YLFTHNQKLKERFAMTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSH  438

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  439  KKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVLLGL  484



>ref|XP_006662789.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Oryza brachyantha]
Length=482

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RLT L++D  VS KIV
Sbjct  251  YVITTKSFAPELVDSLKRALIRFYGEDPLQSEDLSRIVNSNHFCRLTNLIEDKTVSQKIV  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DEK+LKIAPT+L+DVP D+ +M  EIFGPLLPI+TV+K+ED I+ IN++ KPLAA
Sbjct  311  YGGQTDEKQLKIAPTVLVDVPLDSALMTSEIFGPLLPIVTVDKIEDSIEFINSKTKPLAA  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKL++ FV+N+ AGG+L+ND ALH+A   LPF GVG+SG GSYHGKFSF+ F+H
Sbjct  371  YLFTKDKKLQEAFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTH  430

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  431  KKAVLIRGFGGEAAARYPPYTTEKQKILRGLINGSFIALILALLGF  476



>sp|Q8VXQ2.1|ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase; AltName: Full=Cp-ALDH [Craterostigma 
plantagineum]
 emb|CAC84900.1| aldehyde dehydrogenase [Craterostigma plantagineum]
Length=479

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITT+ENA +L+DA+K EL+ FYGKDPL S+D+S I+N   F R+T LLDD KVS KIV
Sbjct  252  YIITTEENAPKLVDAIKCELESFYGKDPLKSQDMSSIINERQFERMTGLLDDKKVSDKIV  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ D+  LKIAPTIL+DV ED+ +M EEIFGPLLPI+TV K+E+  KII ++ KPLAA
Sbjct  312  YGGQSDKSNLKIAPTILLDVSEDSSVMSEEIFGPLLPIITVGKIEECYKIIASKPKPLAA  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++KK  +EFV+N+SAGG+ IND ALH     LPF GVGESG GSYHGKFSF+AFSH
Sbjct  372  YLFTNDKKRTEEFVSNVSAGGITINDIALHFLEPRLPFGGVGESGMGSYHGKFSFDAFSH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK+VLKRSFGG++ ARYPPY P K   + A++ G++  +++A LG 
Sbjct  432  KKSVLKRSFGGEVAARYPPYAPWKLHFMEAILQGDIFGLLKAWLGW  477



>ref|XP_010479042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +L+DAMK EL+ FYGK P+ SKD+SRIVNSNHF RL+KLL++  VS KIV
Sbjct  259  YILTTKEFAPKLIDAMKHELETFYGKKPMDSKDMSRIVNSNHFDRLSKLLEEKDVSDKIV  318

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N +E+   +I++R KPLAA
Sbjct  319  YGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNNLEESFDVIHSRPKPLAA  378

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  379  YLFTHNQKLKERFAMTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSH  438

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  439  KKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVLLGL  484



>ref|XP_003532071.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Glycine max]
 gb|KHN16935.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=541

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIIT KE A +L+DA+K EL++F+GKDP+ SKD+SRIV+ N F+RL  LLD+DKVS KIV
Sbjct  315  YIITRKEFAPKLVDALKEELEQFFGKDPMESKDMSRIVSPNQFARLVNLLDEDKVSDKIV  374

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDEK+LKIAPTI++ VPEDA+IM+EEIFGP++PI+TV+ +ED   II ++ KPLAA
Sbjct  375  LGGQRDEKKLKIAPTIILGVPEDAMIMQEEIFGPIMPIVTVDNIEDCYSIIKSKPKPLAA  434

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N++L++++V  +S+GG+LIND  +HVA   LPF GV ESG G YHGKFSF++FSH
Sbjct  435  YLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFSFDSFSH  494

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +K+VL RSF  D   RYPPYTP+K +LL+AL+SGN++ II +LLG 
Sbjct  495  RKSVLYRSFDADSTIRYPPYTPQKEKLLKALISGNIVQIILSLLGW  540



>emb|CDY36336.1| BnaC08g05150D [Brassica napus]
Length=482

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +VS KIV
Sbjct  256  YILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHFDRLSKILEEKEVSDKIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+++   LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  316  YGGQKNRDNLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEECFDVIRSRPKPLAA  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+++ TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  376  YLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSFDAFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + LLGL
Sbjct  436  KKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVLLGL  481



>ref|XP_009107480.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Brassica 
rapa]
Length=482

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +VS KIV
Sbjct  256  YILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHFDRLSKILEEKEVSDKIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+++   LKIAPTI +DVP D+LIM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  316  YGGQKNRDNLKIAPTIFLDVPLDSLIMSEEIFGPLLPILTLNNLEECFDVIRSRPKPLAA  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+++ TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  376  YLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSFDAFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + LLGL
Sbjct  436  KKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVLLGL  481



>ref|XP_002307060.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
 gb|EEE94056.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
Length=488

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YII TK+ A +L+DA++  +++F+G DP+ SK +SRIV+SNHFSRL +LLD+ KV  KIV
Sbjct  260  YIIATKDFAPKLIDALRNGIEEFFGADPMESKYISRIVSSNHFSRLERLLDEYKVFNKIV  319

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R++K+LKIAPTI +DVPED+ +M+EEIFGPLLPI+TV  V+D I +IN++ +PL A
Sbjct  320  VGGQRNQKKLKIAPTIFLDVPEDSQLMQEEIFGPLLPIITVENVKDSIDLINSKPEPLVA  379

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+KL  +FV N+S GG++INDT LHV V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  380  YLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSH  439

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP+  +L+RA+M+G +  II AL+G 
Sbjct  440  KKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGIFDIILALMGW  485



>emb|CDY36018.1| BnaA08g04430D [Brassica napus]
Length=482

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +VS KIV
Sbjct  256  YILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHFDRLSKILEEKEVSDKIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+++   LKIAPTI +DVP D+LIM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  316  YGGQKNRDNLKIAPTIFLDVPLDSLIMSEEIFGPLLPILTLNNLEECFDVIRSRPKPLAA  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+++ TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  376  YLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSFDAFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + LLGL
Sbjct  436  KKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVLLGL  481



>ref|XP_009404859.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 181/224 (81%), Gaps = 0/224 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+DA+K+ L+KFYGK+PL S DLSRIVNS+HF+RL  LLD++KVSG IV
Sbjct  256  YIITTKAFAPKLVDALKITLEKFYGKNPLGSTDLSRIVNSSHFTRLKNLLDEEKVSGTIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+ DEK LKIAPT+L+DVP DA IMKEEIFGPLLPI+TV+ +E    +IN++ KPLAA
Sbjct  316  HGGQEDEKHLKIAPTLLLDVPSDASIMKEEIFGPLLPIITVDDLEQSFDVINSKPKPLAA  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT + KLE++FV  +SAGG+LIND  L      LPF GVGESG GSYHG+FSF+AFSH
Sbjct  376  YLFTKDHKLEKKFVKTVSAGGMLINDAILQFTNPHLPFGGVGESGMGSYHGRFSFDAFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            KKAVL R F G++  RYPPYTP K ++LR L++GN++ ++ AL+
Sbjct  436  KKAVLSRGFYGEIPMRYPPYTPLKQKVLRGLIAGNILPLLHALV  479



>ref|XP_010437649.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=308

 Score =   296 bits (758),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF RL  +L ++ V+ KIV
Sbjct  78   YVITTKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHFKRLESMLKENGVANKIV  137

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K+EDG ++I ++ KPLAA
Sbjct  138  HGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEKIEDGFQVIRSKPKPLAA  197

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPF GVGESG G+YHGKFS+E FSH
Sbjct  198  YLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSH  257

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  258  KKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAFFGF  303



>ref|XP_010444975.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=256

 Score =   294 bits (753),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+IT K+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF RL  +L ++ V+ KIV
Sbjct  26   YVITKKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHFKRLESMLKENGVANKIV  85

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K+EDG ++I ++ KPLAA
Sbjct  86   HGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEKIEDGFQVIRSKPKPLAA  145

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPF GVGESG G+YHGKFS+E FSH
Sbjct  146  YLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSH  205

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  206  KKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAFFGF  251



>ref|XP_011468213.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   303 bits (777),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLL++D+VS KIV
Sbjct  320  YIITTKDFAPKLIEALKDGLEQFFGKDPMNSKDISRIVSSTQFARLVKLLEEDRVSDKIV  379

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DEK+LKIAPTIL+D+PED  IM EEIFGPL+PI+TV+K+E    +I +R KPLA 
Sbjct  380  LGGQTDEKQLKIAPTILLDIPEDTQIMNEEIFGPLMPIVTVDKIEGSFDVIKSRPKPLAV  439

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+N++L++ FV N+S+GG+LINDT LHVAV  LPF GVGESG GSYHGKFSF+ FSH
Sbjct  440  YVFTNNEQLKKSFVENISSGGMLINDTVLHVAVAGLPFGGVGESGMGSYHGKFSFDGFSH  499

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK+V+ RS  GD   RYPPYTP+K +L +A +SGN+  II AL+G 
Sbjct  500  KKSVMYRSLSGDSTLRYPPYTPEKEKLFKAALSGNIFRIILALIGW  545



>ref|XP_010664198.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
 ref|XP_010664199.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
Length=516

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  719  LDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIVHGGERDEKRLKI  540
            +DA+K EL+ +YGKDPL SKDL+ IVNSNHF+RL KLLDDDKVSGKI+HGG+RD+  LK 
Sbjct  302  IDALKHELEAWYGKDPLESKDLAHIVNSNHFARLAKLLDDDKVSGKIIHGGQRDKANLKF  361

Query  539  APTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQE  360
            APTIL+DVPED+L+M EEIFGPLLPILTV+K+ED   +I +R KPLAAYLFT+NKKL+++
Sbjct  362  APTILLDVPEDSLVMNEEIFGPLLPILTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEK  421

Query  359  FVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGD  180
            FV  +SAGGL+INDT LH A  TLPF GVGESG GSYHGKFS+EAFSH+K+VL R F GD
Sbjct  422  FVKTVSAGGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGD  481

Query  179  LGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
              ARYPPY+ +K +LL+AL+SG+++ +I AL+G 
Sbjct  482  ASARYPPYSDRKLKLLKALLSGSVVGVILALIGW  515



>ref|XP_009145048.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brassica 
rapa]
Length=482

 Score =   301 bits (770),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE + +++DA+K EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +VS KIV
Sbjct  256  YILTTKEFSPKVIDALKQELEAFYGKNPMESKDMSRIVNSNHFDRLSKMLEEKEVSDKIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+++  +LKIAPTIL+DVP D+ IM EEIFGPLLPI+T+N +E+   +I +R KPLAA
Sbjct  316  YGGQKNRDKLKIAPTILVDVPLDSQIMSEEIFGPLLPIITLNNLEECFDVIRSRPKPLAA  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+AV TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  376  YLFTQNQKLKERFALTVSAGGIVVNDIAVHLAVPTLPFGGVGESGMGSYHGKFSFDAFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL +SF GD   RYPPY+  K RLL+AL++ N++ I R +LGL
Sbjct  436  KKAVLYKSFIGDAAIRYPPYSTGKLRLLKALVNSNILEIFRVILGL  481



>ref|XP_010674357.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 181/220 (82%), Gaps = 0/220 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A QL+ A++ ELDKF+GKD + SKD+SR+VNS HF+RL KL+++D VS KIV
Sbjct  321  YVITTKDFAPQLIAALRSELDKFFGKDHMESKDMSRVVNSYHFTRLMKLMEEDGVSDKIV  380

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ +  +LKIAPT+L+D PED+L+M EEIFGPLLPI+TV K+ED  ++I ++ KPLAA
Sbjct  381  LGGKTNAMQLKIAPTVLLDAPEDSLLMTEEIFGPLLPIVTVEKIEDSFEVIKSKPKPLAA  440

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+KL+ EF+ ++SAGG+LINDT LH+ V TLPF GVGESG G YHGKFSFEAFSH
Sbjct  441  YLFTNNEKLKTEFIKDISAGGMLINDTILHLTVSTLPFGGVGESGMGYYHGKFSFEAFSH  500

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  96
            KKAV+ RSF GD   RYPPYT KK  LL+ALMSG++  II
Sbjct  501  KKAVMYRSFEGDSSIRYPPYTSKKLNLLKALMSGSIFRII  540



>ref|XP_010674356.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=550

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 181/220 (82%), Gaps = 0/220 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A QL+ A++ ELDKF+GKD + SKD+SR+VNS HF+RL KL+++D VS KIV
Sbjct  322  YVITTKDFAPQLIAALRSELDKFFGKDHMESKDMSRVVNSYHFTRLMKLMEEDGVSDKIV  381

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ +  +LKIAPT+L+D PED+L+M EEIFGPLLPI+TV K+ED  ++I ++ KPLAA
Sbjct  382  LGGKTNAMQLKIAPTVLLDAPEDSLLMTEEIFGPLLPIVTVEKIEDSFEVIKSKPKPLAA  441

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+KL+ EF+ ++SAGG+LINDT LH+ V TLPF GVGESG G YHGKFSFEAFSH
Sbjct  442  YLFTNNEKLKTEFIKDISAGGMLINDTILHLTVSTLPFGGVGESGMGYYHGKFSFEAFSH  501

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  96
            KKAV+ RSF GD   RYPPYT KK  LL+ALMSG++  II
Sbjct  502  KKAVMYRSFEGDSSIRYPPYTSKKLNLLKALMSGSIFRII  541



>gb|ABR16899.1| unknown [Picea sitchensis]
Length=556

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+IT +  A +L+DA+KV L+KF+GKDP  S DLSRIVN +HF+RLT+LLDD KVS K++
Sbjct  329  YVITLESFAPKLIDALKVTLEKFFGKDPFQSADLSRIVNFSHFARLTRLLDDPKVSDKVI  388

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+RDEKRL IAPT+L+D P D+LIM EEIFGPLLPI+TV K+E+ ++++++  KPLAA
Sbjct  389  YGGQRDEKRLIIAPTLLLDAPMDSLIMTEEIFGPLLPIITVQKMEEALEVVSSLPKPLAA  448

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK  E++ V ++SAGG+++NDTALH+  H LPF GVGESG G+YHGKFSFE FSH
Sbjct  449  YLFTKNKMFERQVVASISAGGMVVNDTALHLVNHHLPFGGVGESGMGAYHGKFSFENFSH  508

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +KAVL R F GDL ARYPPYT +K +++R L++G+ + ++ AL+G
Sbjct  509  RKAVLYRGFMGDLMARYPPYTRRKQKIVRCLLNGDFLGLLYALIG  553



>gb|AET04825.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=543

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A  L+DA+K EL++F+GKD + SKD+SRIV+   ++RL KLLD+DKVS KIV
Sbjct  315  YIITTKDFAPTLVDALKEELEQFFGKDLIESKDMSRIVSPTQYARLVKLLDEDKVSDKIV  374

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDEK+LKIAPTIL+DVP++A++M+EEIFGP+LPI+TV+ +ED   II +R KPLAA
Sbjct  375  LGGQRDEKKLKIAPTILLDVPQEAMVMQEEIFGPILPIITVDSIEDSFSIIQSRPKPLAA  434

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N++L++++V  +S+GG+LIND  +HVA   LPF GVGESG G YHGKFSF++FSH
Sbjct  435  YLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVGESGMGCYHGKFSFDSFSH  494

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK+VL ++F  D   RYPPYTP+K  +LRA+  GN+  II ALLG 
Sbjct  495  KKSVLYKTFDSDPSIRYPPYTPEKENILRAIFGGNIFQIILALLGW  540



>gb|EAY82454.1| hypothetical protein OsI_37671 [Oryza sativa Indica Group]
Length=464

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+RL KL+DD+ VS KIV
Sbjct  235  FIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFNRLKKLMDDENVSDKIV  294

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  K LAA
Sbjct  295  FGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKIHESFALINSMTKALAA  354

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT + KL++++   +SAGG+L+NDTA+H+    LPF GVGESG G+YHG+FSFEAFSH
Sbjct  355  YLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSFEAFSH  414

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+LG 
Sbjct  415  KKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAILGF  460



>gb|EAZ19830.1| hypothetical protein OsJ_35414 [Oryza sativa Japonica Group]
Length=464

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+RL KL+DD+ VS KIV
Sbjct  235  FIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFNRLKKLMDDENVSDKIV  294

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  K LAA
Sbjct  295  FGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKIHESFALINSMTKALAA  354

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT + KL++++   +SAGG+L+NDTA+H+    LPF GVGESG G+YHG+FSFEAFSH
Sbjct  355  YLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSFEAFSH  414

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+LG 
Sbjct  415  KKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAILGF  460



>gb|ABA96616.1| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=484

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+RL KL+DD+ VS KIV
Sbjct  255  FIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFNRLKKLMDDENVSDKIV  314

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  K LAA
Sbjct  315  FGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKIHESFALINSMTKALAA  374

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT + KL++++   +SAGG+L+NDTA+H+    LPF GVGESG G+YHG+FSFEAFSH
Sbjct  375  YLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSFEAFSH  434

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+LG 
Sbjct  435  KKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAILGF  480



>ref|XP_009350139.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=450

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL K+LD+DKVS KIV
Sbjct  223  YIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKVLDEDKVSNKIV  282

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+ I+TV K+ED   +I+++ KPLA 
Sbjct  283  LGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMSIVTVEKIEDSFSVIHSKPKPLAV  342

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
              FT+N++ ++ FV N+S+GG+LINDT LHV++  LPF GVGESG GSYHGKFSF+ FSH
Sbjct  343  CAFTNNEQPKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSH  402

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGGD   RYPPYTP+K RL +A+++ N++ II +L+G 
Sbjct  403  KKAVLYRGFGGDSDLRYPPYTPEKQRLFKAVINRNILTIILSLIGW  448



>ref|XP_004502485.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=486

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ +  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF RL KL+D+DKVS KIV
Sbjct  262  YIITTKDFSPLLVDALKTELENFFGKNPLESNDLSRIVSSNHFHRLIKLMDEDKVSDKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG +DE +L+IAPTIL+D P D+LIM EEIFGPLLPI+TVNK+E+   +IN+  KPLAA
Sbjct  322  YGGAKDESKLRIAPTILLDTPRDSLIMSEEIFGPLLPIITVNKLEESFDVINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++ K +++FV  +SAGGL+IND+ LH    TLPF GVG+SG G+YHGKFSF+AF+H
Sbjct  382  YLFTNDNKFKEQFVKKVSAGGLVINDSVLHFVACTLPFGGVGDSGMGAYHGKFSFDAFTH  441

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +KAVL R F GD   RYPPYT KK + ++AL++G++  ++RAL G
Sbjct  442  RKAVLYRGFTGDSSLRYPPYTDKKQKCMKALVAGDVPGLVRALFG  486



>ref|XP_006393739.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
 gb|ESQ31025.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
Length=483

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 185/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +++DA+K EL+ FYGK+P+ SKD+SRIVNSNHF RL+KLL++ +VS +IV
Sbjct  257  YILTTKEYAPKVIDALKHELEGFYGKNPMESKDMSRIVNSNHFDRLSKLLEEKEVSERIV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+++ + LKIAPTIL+DVP D+ IM EEIFGPLLPILT+N +E+   +I +R KPLAA
Sbjct  317  YGGQKNRESLKIAPTILLDVPLDSQIMNEEIFGPLLPILTLNNLEECFDVIRSRPKPLAA  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+A+ TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  377  YLFTQNQKLKERFAMTVSAGGIVVNDIAVHLALPTLPFGGVGESGMGSYHGKFSFDAFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL +SF GD   RYPPY+  K RLL+AL++ N++   + LLGL
Sbjct  437  KKAVLYKSFFGDSAIRYPPYSRGKLRLLKALVNSNIVEFFKVLLGL  482



>gb|KFK24209.1| hypothetical protein AALP_AAs42301U000200 [Arabis alpina]
Length=483

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 183/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK+ A +L+DAMK EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +VS KIV
Sbjct  257  YILTTKDYAPKLIDAMKNELEAFYGKNPMESKDMSRIVNSNHFDRLSKMLEEKEVSDKIV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG++D + LKIAPTIL+DVP D+L+M EEIFGPLLPILTVN +E+   +I +R KPLAA
Sbjct  317  LGGQKDRENLKIAPTILLDVPLDSLMMSEEIFGPLLPILTVNNLEESFDVIRSRPKPLAA  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++ F   +SAGG+++ND A+H+A+ TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  377  YLFTQNEKLKERFANTVSAGGIVVNDIAVHLALPTLPFGGVGESGMGSYHGKFSFDAFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL +SF GD   RY PY+  K RLL+AL++ NL+ + + L G 
Sbjct  437  KKAVLYKSFLGDSTVRYAPYSRGKLRLLKALVNSNLLEVFKVLFGF  482



>ref|XP_011002476.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=756

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L+DA++  +++F+G DP+ SKD+S IV+SNHFSRL  L+DD KV  KIV
Sbjct  528  YIITTKEFAPKLIDALRKGIEEFFGTDPMESKDISCIVSSNHFSRLESLMDDYKVFYKIV  587

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R++K+LKIAPTI +DVP D+ +M+EEIFGPLLPI+TV  V+D I +IN++ KPL A
Sbjct  588  VGGQRNQKKLKIAPTIFLDVPGDSQLMQEEIFGPLLPIITVENVKDSIDLINSKPKPLTA  647

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+KL+  FV ++S+GG++INDT LHV V +LPF GVGESG GSYHGKFSF+AFSH
Sbjct  648  YLFTNNEKLKNNFVQSVSSGGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSH  707

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP+K +L+RA+M+G +  II A +G 
Sbjct  708  KKAVLYRSFSGDTSVRYPPYTPEKQKLVRAVMNGGIFDIILAFMGW  753



>ref|XP_006663868.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like, partial 
[Oryza brachyantha]
Length=479

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK  A +LL+A++  L+KFYGKDPL S DLSRIVNSNHF+RL +L+DD+ VS KIV
Sbjct  250  FIITTKSFAPKLLEALEKVLEKFYGKDPLRSSDLSRIVNSNHFNRLKRLMDDESVSDKIV  309

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R E  LKIAPTI MDVP D++IMKEEIFGPLLPI+TV+K+ + + +IN+  KPLAA
Sbjct  310  FGGQRSEHLLKIAPTIFMDVPLDSVIMKEEIFGPLLPIITVDKIHESLALINSMTKPLAA  369

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT + KL++++V  +SAGG+L+NDTA+H+    LPF GVGESG G+YHG FSFEAFSH
Sbjct  370  YLFTKDSKLQEQYVAAISAGGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGSFSFEAFSH  429

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F  +  ARYPPY+  K ++LR ++ GNL  +I+A+LG 
Sbjct  430  KKAVLVRGFACEAAARYPPYSMAKLKILRGVLKGNLGAMIQAILGF  475



>emb|CAC84903.1| aldehyde dehydrogenase [Arabidopsis thaliana]
Length=550

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF RL  +L ++ V+ KIV
Sbjct  321  YVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHFKRLESMLKENGVANKIV  380

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG ++I ++ KPLAA
Sbjct  381  HGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQKIEDGFQVIRSKSKPLAA  440

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPF GVGESG G+YHGKFS+E FSH
Sbjct  441  YLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSH  500

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  501  KKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNMFAAILAFFGF  546



>ref|NP_001168661.1| hypothetical protein [Zea mays]
 gb|ACN29088.1| unknown [Zea mays]
 tpg|DAA38941.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=478

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+ ++K  L++FYG+DPL S DLSRIVNS HF RLT+L+++  V+ KIV
Sbjct  248  YIITTKSFAPELVASLKRVLERFYGEDPLQSADLSRIVNSKHFRRLTELIEEKSVADKIV  307

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE DEK+LKIAPT+L+DVP+D+ IM  EIFGPLLPI+TV K+E+   +INAR KPLAA
Sbjct  308  YGGEVDEKQLKIAPTLLLDVPQDSAIMTGEIFGPLLPIVTVEKIEESFDLINARPKPLAA  367

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL++EFV ++ AGG+L+NDT LH+A   +PF GVG+SG G YHGKF F+ FSH
Sbjct  368  YLFTKNKKLQEEFVADVPAGGMLVNDTVLHLANPYMPFGGVGDSGMGCYHGKFGFDCFSH  427

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  428  KKGVLVRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  473



>emb|CAB36701.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 emb|CAB80141.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=533

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF RL  +L ++ V+ KIV
Sbjct  304  YVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHFKRLESMLKENGVANKIV  363

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG ++I ++ KPLAA
Sbjct  364  HGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQKIEDGFQVIRSKPKPLAA  423

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPF GVGESG G+YHGKFS+E FSH
Sbjct  424  YLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSH  483

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  484  KKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAFFGF  529



>ref|XP_004503900.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=534

 Score =   298 bits (762),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IIT K+ A +L++A+K EL+ F+GK+P+ SKD+SRIV+   FSRL +LLD+DKVS KIV
Sbjct  307  HIITRKDFAPKLINALKEELEIFFGKNPMESKDMSRIVSPMQFSRLVRLLDEDKVSDKIV  366

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDEK+LKIAPTIL+DVPE+A++M+EEIFGP++PI+TV+ +ED   II +R KPLAA
Sbjct  367  LGGQRDEKKLKIAPTILLDVPEEAMVMQEEIFGPIMPIITVDNIEDSFSIIKSRPKPLAA  426

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N++L++E+V  +S+GG+LIND  +HVA   LPF GV ESG G YHGKF+F++FSH
Sbjct  427  YLFTNNEQLKKEYVDKISSGGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFTFDSFSH  486

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK+VL +SF  D   RYPPYTP+K +LLRA++ GN+  II AL G 
Sbjct  487  KKSVLYKSFDADPSIRYPPYTPQKEKLLRAILGGNIFDIILALFGW  532



>ref|NP_567962.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 sp|Q8W033.2|AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member I1, chloroplastic; 
Short=AtALDH3; Short=Ath-ALDH3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK96824.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM10094.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE86347.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=550

 Score =   298 bits (763),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF RL  +L ++ V+ KIV
Sbjct  321  YVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHFKRLESMLKENGVANKIV  380

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG ++I ++ KPLAA
Sbjct  381  HGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQKIEDGFQVIRSKPKPLAA  440

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPF GVGESG G+YHGKFS+E FSH
Sbjct  441  YLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSH  500

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  501  KKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAFFGF  546



>ref|XP_004503899.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=542

 Score =   298 bits (762),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 184/226 (81%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IIT K+ A +L++A+K EL+ F+GK+P+ SKD+SRIV+   FSRL +LLD+DKVS KIV
Sbjct  315  HIITRKDFAPKLINALKEELEIFFGKNPMESKDMSRIVSPMQFSRLVRLLDEDKVSDKIV  374

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDEK+LKIAPTIL+DVPE+A++M+EEIFGP++PI+TV+ +ED   II +R KPLAA
Sbjct  375  LGGQRDEKKLKIAPTILLDVPEEAMVMQEEIFGPIMPIITVDNIEDSFSIIKSRPKPLAA  434

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N++L++E+V  +S+GG+LIND  +HVA   LPF GV ESG G YHGKF+F++FSH
Sbjct  435  YLFTNNEQLKKEYVDKISSGGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFTFDSFSH  494

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK+VL +SF  D   RYPPYTP+K +LLRA++ GN+  II AL G 
Sbjct  495  KKSVLYKSFDADPSIRYPPYTPQKEKLLRAILGGNIFDIILALFGW  540



>ref|XP_010437650.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   298 bits (762),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF RL  +L ++ V+ KIV
Sbjct  319  YVITTKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHFKRLESMLKENGVANKIV  378

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K+EDG ++I ++ KPLAA
Sbjct  379  HGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEKIEDGFQVIRSKPKPLAA  438

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPF GVGESG G+YHGKFS+E FSH
Sbjct  439  YLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSH  498

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  499  KKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAFFGF  544



>ref|XP_010447116.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ AL+L+DA+K EL+ F+G+ PL SKDLSRIVNS HF RL  +L ++ V+ KIV
Sbjct  319  YVITTKDFALKLIDALKTELNTFFGETPLESKDLSRIVNSFHFRRLESMLKENGVANKIV  378

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K+EDG ++I ++ KPLAA
Sbjct  379  HGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEKIEDGFQVIRSKPKPLAA  438

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NK+L+++FV  +SAGG+ INDT LHV +  LPF GVGESG G+YHGKFS+E FSH
Sbjct  439  YLFTNNKELQEQFVQGVSAGGISINDTVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSH  498

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  499  KKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAFFGF  544



>ref|XP_010432443.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
[Camelina sativa]
Length=547

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL  F+G+ PL SKDLSRIVNS HF RL ++L ++ V+ KIV
Sbjct  317  YVITTKDFASRLIDALKTELKTFFGEKPLESKDLSRIVNSFHFKRLERMLKENGVANKIV  376

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLP++TV K+EDG ++I ++ KPLAA
Sbjct  377  HGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPVVTVEKIEDGFQVIRSKPKPLAA  436

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF++NK+L+++FV  +SAGG+ INDT LHV V  LPF GVGESG G+YHGKFS+E FSH
Sbjct  437  YLFSNNKELQEQFVQGVSAGGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSH  496

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  497  KKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAFFGF  542



>dbj|BAK01937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK    +L+D++K  L++FYG+DPL S DLSRIVN +HF RL KLLDD KV+ KI+
Sbjct  259  YIITTKAFVTELVDSLKRVLERFYGEDPLQSADLSRIVNISHFHRLAKLLDDKKVAEKIL  318

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ D ++LKIAPT+L+DVP D  +MK EIFGP+LPI+TV+K+E+GI  INA  KPLAA
Sbjct  319  LGGQTDMEQLKIAPTVLVDVPLDTELMKGEIFGPMLPIITVDKIEEGITHINAGAKPLAA  378

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPF GVG+SGTGSYHGKFSF+ F+H
Sbjct  379  YLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGGVGDSGTGSYHGKFSFDCFTH  438

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I ALLG 
Sbjct  439  RKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALILALLGF  484



>ref|XP_007048537.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
 gb|EOX92694.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
Length=487

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF RL  LLD+DKVS KIV
Sbjct  259  YIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHFMRLVNLLDEDKVSDKIV  318

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K+ED   +IN + K LAA
Sbjct  319  VGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEKLEDAFDMINRKPKALAA  378

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ ++++E++FV N+SAGG+ INDT L + V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  379  YLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSFDAFSH  438

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ ALLG 
Sbjct  439  NKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLALLGW  484



>ref|XP_002869163.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45422.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   296 bits (757),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF RL  +L ++ V  KIV
Sbjct  319  YVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHFKRLESMLKENGVDNKIV  378

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E +LKI+PTIL+DVPE + +M+EEIFGPLLP+ TV K+EDG ++I ++ KPLAA
Sbjct  379  HGGQTTEDKLKISPTILLDVPEASSMMQEEIFGPLLPVFTVQKIEDGFQVIRSKPKPLAA  438

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++ +L+++FV N+SAGG+ INDT LHV V  +PF GVGESG G+YHGKFS+E FSH
Sbjct  439  YLFTNSAELQKQFVQNVSAGGMTINDTVLHVTVKDMPFGGVGESGIGAYHGKFSYETFSH  498

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  GL
Sbjct  499  KKGVLYRSFSGDADLRYPPYTPKKKMVLKALISSNIFAAILAFFGL  544



>gb|KHG17901.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
 gb|KHG21723.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
Length=366

 Score =   290 bits (741),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKVS KIV
Sbjct  138  YIITTKELAPKLIATLVNVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKVSNKIV  197

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDE +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + KPLAA
Sbjct  198  FGGQRDESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKPKPLAA  257

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ +++++++FV N+ AGG+ INDT L V V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  258  YLFSDDEQIKRKFVQNIYAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSH  317

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  318  KKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  363



>ref|XP_010539000.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Tarenaya 
hassleriana]
Length=482

 Score =   293 bits (750),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK++A +++D +K EL+ FYGK+P+ SKDLSRIVNSNHF RL ++LD+DKV+ KIV
Sbjct  256  YILTTKDHAPKVIDVLKHELEAFYGKNPMESKDLSRIVNSNHFDRLARILDEDKVADKIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            + G++D   LKIAPTIL+DVP D+LIM EEIFGPLLPILT+  +ED   +IN+  KPLAA
Sbjct  316  YRGQKDRANLKIAPTILLDVPRDSLIMNEEIFGPLLPILTLENLEDSFDVINSGSKPLAA  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++KKL+++F   +SAGG+++ND A+H+A+HTLPF GVGESG GSYHGKFSF+AFSH
Sbjct  376  YLFTNDKKLKEKFARIVSAGGVVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSFDAFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGN  111
            KKAVL RS  GD   RYPPY+  K RLL+AL++ N
Sbjct  436  KKAVLYRSLLGDASMRYPPYSRWKLRLLKALVNRN  470



>ref|XP_002449124.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
 gb|EES08112.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
Length=478

 Score =   293 bits (750),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+ ++K  L +FYG+DPL S DLSRIVNS  F RL  L+++ +V+ KIV
Sbjct  248  YIITTKSFAPELVASLKRVLVRFYGEDPLQSADLSRIVNSKQFKRLQDLIEEKRVADKIV  307

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GGE DE++LKIAPT+L+DVP+D+ IM  EIFGPLLPI+TV K+E+   +INA+ KPLAA
Sbjct  308  FGGEADEEQLKIAPTVLLDVPQDSAIMTGEIFGPLLPIVTVEKIEESFNLINAKPKPLAA  367

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL++EFV N+ AGG+L+NDTALH+A   LPF GVG+SG G YHGKF F+ FSH
Sbjct  368  YLFTKNKKLQEEFVANVPAGGMLVNDTALHLANPYLPFGGVGDSGMGCYHGKFGFDCFSH  427

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  428  KKAVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  473



>ref|XP_003630349.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=550

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 184/233 (79%), Gaps = 7/233 (3%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A  L+DA+K EL++F+GKD + SKD+SRIV+   ++RL KLLD+DKVS KIV
Sbjct  315  YIITTKDFAPTLVDALKEELEQFFGKDLIESKDMSRIVSPTQYARLVKLLDEDKVSDKIV  374

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTV-------NKVEDGIKIINA  417
             GG+RDEK+LKIAPTIL+DVP++A++M+EEIFGP+LPI+TV       + +ED   II +
Sbjct  375  LGGQRDEKKLKIAPTILLDVPQEAMVMQEEIFGPILPIITVSTIKGKVDSIEDSFSIIQS  434

Query  416  RDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKF  237
            R KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   LPF GVGESG G YHGKF
Sbjct  435  RPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVGESGMGCYHGKF  494

Query  236  SFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            SF++FSHKK+VL ++F  D   RYPPYTP+K  +LRA+  GN+  II ALLG 
Sbjct  495  SFDSFSHKKSVLYKTFDSDPSIRYPPYTPEKENILRAIFGGNIFQIILALLGW  547



>gb|KJB75337.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=443

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKVS KIV
Sbjct  215  YIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKVSNKIV  274

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + KPLAA
Sbjct  275  FGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKPKPLAA  334

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ +++++++FV N+ AGG+ INDT L V V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  335  YLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSH  394

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  395  KKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  440



>ref|XP_007048536.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
 gb|EOX92693.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
Length=542

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF RL  LLD+DKVS KIV
Sbjct  314  YIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHFMRLVNLLDEDKVSDKIV  373

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K+ED   +IN + K LAA
Sbjct  374  VGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEKLEDAFDMINRKPKALAA  433

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ ++++E++FV N+SAGG+ INDT L + V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  434  YLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSFDAFSH  493

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ ALLG 
Sbjct  494  NKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLALLGW  539



>ref|XP_007048535.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
 gb|EOX92692.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
Length=547

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF RL  LLD+DKVS KIV
Sbjct  319  YIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHFMRLVNLLDEDKVSDKIV  378

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K+ED   +IN + K LAA
Sbjct  379  VGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEKLEDAFDMINRKPKALAA  438

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ ++++E++FV N+SAGG+ INDT L + V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  439  YLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSFDAFSH  498

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ ALLG 
Sbjct  499  NKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLALLGW  544



>gb|KJB75341.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
 gb|KJB75342.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=488

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKVS KIV
Sbjct  260  YIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKVSNKIV  319

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + KPLAA
Sbjct  320  FGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKPKPLAA  379

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ +++++++FV N+ AGG+ INDT L V V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  380  YLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSH  439

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  440  KKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  485



>emb|CDX69039.1| BnaC01g04140D [Brassica napus]
Length=549

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V+ KIV
Sbjct  320  YVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGVADKIV  379

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ KPLAA
Sbjct  380  HGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKPKPLAA  439

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK+L+ +FV N+SAGG+ IN+T LHV +  LPF GVGESG G+YHGKFS+E FSH
Sbjct  440  YLFTDNKELQNQFVQNVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSH  499

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  500  KKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  545



>ref|XP_006412252.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
 dbj|BAJ33838.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53705.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
Length=547

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 176/226 (78%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL  F+G++PL SKDLSRIVNS HF RL  +L ++ ++ KIV
Sbjct  318  YVITTKDFASKLIDALKTELKTFFGENPLESKDLSRIVNSFHFKRLESMLKENGMADKIV  377

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+  E +LKI+PTIL+DVPE   +M+EEIFGPLLPI+TV K+EDG ++I ++ KPLAA
Sbjct  378  KGGQTSEDKLKISPTILLDVPEACSMMQEEIFGPLLPIITVQKIEDGFQVIRSKAKPLAA  437

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK+L+++FV +++AGG+ INDT LHV V  LPF GVGESG G+YHGKFS+E FSH
Sbjct  438  YLFTDNKELQKKFVQDVAAGGIGINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSH  497

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  498  KKGVLYRSFAGDSDLRYPPYTPKKKMVLKALLSSNIFAAILAFFGF  543



>gb|AFW65463.1| hypothetical protein ZEAMMB73_893012 [Zea mays]
Length=456

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F RLT L+++ +V+ KIV
Sbjct  226  YIITTKSFAPELVASFKRVLERFYGEDPLESADLSRIVNSKQFKRLTNLIEEKRVADKIV  285

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K+E+   +INA+ KPLAA
Sbjct  286  YGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEKIEESFDLINAKPKPLAA  345

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++EFV ++ AGG+L+NDTALH+    +PF GVG+SG G YHGKF F+ FSH
Sbjct  346  YLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGFDCFSH  405

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  406  KKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  451



>ref|XP_006283479.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
 gb|EOA16377.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
Length=546

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL+ F+G++PL SKD+SRIVNS HF RL  +L ++ V+ KIV
Sbjct  316  YVITTKDFASKLIDALKTELETFFGENPLESKDISRIVNSFHFKRLESMLKENGVANKIV  375

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E++LKI+PTI++DVPE + +M+EEIFGPLLP++TV K+EDG ++I ++ KPLAA
Sbjct  376  HGGQTIEEKLKISPTIVVDVPEASSMMQEEIFGPLLPVVTVAKIEDGFQVIRSKPKPLAA  435

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+NK+L+++FV  +SAGG+ INDT LHV    LPF GVGESG G+YHGKFS+E FSH
Sbjct  436  YLFTNNKELQEQFVQGVSAGGISINDTVLHVTQKDLPFGGVGESGIGAYHGKFSYETFSH  495

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  496  KKGVLYRSFSGDADLRYPPYTTKKKMVLKALISSNIFAAILAFFGF  541



>gb|KJB75338.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=544

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKVS KIV
Sbjct  316  YIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKVSNKIV  375

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + KPLAA
Sbjct  376  FGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKPKPLAA  435

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ +++++++FV N+ AGG+ INDT L V V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  436  YLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSH  495

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  496  KKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  541



>gb|KJB75340.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 180/226 (80%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKVS KIV
Sbjct  319  YIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKVSNKIV  378

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + KPLAA
Sbjct  379  FGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKPKPLAA  438

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ +++++++FV N+ AGG+ INDT L V V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  439  YLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSH  498

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  499  KKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  544



>gb|ACG29168.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F RLT L+++ +V+ KIV
Sbjct  248  YIITTKSFAPELVASFKRVLERFYGEDPLQSADLSRIVNSKQFKRLTNLIEEKRVADKIV  307

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K+E+   +INA+ KPLAA
Sbjct  308  YGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEKIEESFDLINAKPKPLAA  367

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++EFV ++ AGG+L+NDTALH+    +PF GVG+SG G YHGKF F+ FSH
Sbjct  368  YLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGFDCFSH  427

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  428  KKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  473



>gb|KFK30059.1| hypothetical protein AALP_AA7G211500 [Arabis alpina]
Length=560

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITT++ A +L+DA+K EL+ F+GK+PL SKDLSRIVNS HF RL  +L ++ V+ KIV
Sbjct  331  YVITTEDFASKLIDAVKTELESFFGKNPLESKDLSRIVNSFHFKRLEGMLKENGVANKIV  390

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E +LKI+PTIL+DV E++ +M+EEIFGPLLPI+TV K+EDGI++I ++ KPLAA
Sbjct  391  HGGQTIEDKLKISPTILVDVSEESSMMREEIFGPLLPIVTVQKIEDGIQVIRSKPKPLAA  450

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK+L+Q+FV +++AGG+ +NDT LHV V  LPF GVGESG G+YHGKFS++ FSH
Sbjct  451  YLFTDNKELQQQFVQDVAAGGIGVNDTILHVTVKDLPFGGVGESGIGAYHGKFSYDTFSH  510

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  511  KKGVLYRSFVGDSDIRYPPYTTKKKTVLKALLSSNIFRAILAFFGF  556



>ref|XP_009115077.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Brassica rapa]
Length=554

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V+ KIV
Sbjct  325  YVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGVANKIV  384

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ KPLAA
Sbjct  385  HGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKPKPLAA  444

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF GVGESG G+YHGKFS+E FSH
Sbjct  445  YLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSH  504

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  505  KKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  550



>gb|ACF85700.1| unknown [Zea mays]
 gb|AFW65462.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F RLT L+++ +V+ KIV
Sbjct  248  YIITTKSFAPELVASFKRVLERFYGEDPLESADLSRIVNSKQFKRLTNLIEEKRVADKIV  307

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K+E+   +INA+ KPLAA
Sbjct  308  YGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEKIEESFDLINAKPKPLAA  367

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++EFV ++ AGG+L+NDTALH+    +PF GVG+SG G YHGKF F+ FSH
Sbjct  368  YLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGFDCFSH  427

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  428  KKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  473



>ref|NP_001288985.1| aldehyde dehydrogenase family 3 member I1, chloroplastic [Brassica 
rapa]
 gb|ABC41273.1| putative aldehyde dehydrogenase [Brassica rapa]
Length=555

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V+ KIV
Sbjct  326  YVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGVANKIV  385

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ KPLAA
Sbjct  386  HGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKPKPLAA  445

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF GVGESG G+YHGKFS+E FSH
Sbjct  446  YLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSH  505

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  506  KKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  551



>ref|XP_009115014.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Brassica rapa]
Length=556

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V+ KIV
Sbjct  327  YVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGVANKIV  386

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ KPLAA
Sbjct  387  HGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKPKPLAA  446

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF GVGESG G+YHGKFS+E FSH
Sbjct  447  YLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSH  506

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  507  KKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  552



>emb|CDX75414.1| BnaA01g02880D [Brassica napus]
Length=556

 Score =   290 bits (743),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V+ KIV
Sbjct  327  YVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGVADKIV  386

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ KPLAA
Sbjct  387  HGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKPKPLAA  446

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF GVGESG G+YHGKFS+E FSH
Sbjct  447  YLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSH  506

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  507  KKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  552



>gb|AID60136.1| aldehyde dehydrogenase 3 [Brassica napus]
Length=554

 Score =   290 bits (742),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V+ KIV
Sbjct  325  YVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGVADKIV  384

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ KPLAA
Sbjct  385  HGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKPKPLAA  444

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF GVGESG G+YHGKFS+E FSH
Sbjct  445  YLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSH  504

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  505  KKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  550



>gb|ABK24239.1| unknown [Picea sitchensis]
Length=478

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIIT +  A +L+DA+K  L+KFYG+DP+ S DLSRIVNS+HF RLT+LLDD KVS K++
Sbjct  250  YIITPESFAPKLIDALKNTLEKFYGQDPIQSADLSRIVNSSHFVRLTRLLDDPKVSDKVI  309

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+RDEKRL IAPT+++D P D+LIM EEIFGPLL I+TV K+E+ ++++++  KPLAA
Sbjct  310  YGGQRDEKRLIIAPTLVLDAPMDSLIMIEEIFGPLLTIITVQKMEEALEVVSSFSKPLAA  369

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT NKK E++ V ++SAGG+L+NDTALHV  H LPF GVGESG GSYHGKFSFEAFSH
Sbjct  370  YVFTKNKKFERQVVASVSAGGMLVNDTALHVTNHHLPFGGVGESGVGSYHGKFSFEAFSH  429

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F GDL ARYPPYT +K +++R L+SG+ + ++ A+LG 
Sbjct  430  KKAVLYRGFMGDLMARYPPYTTRKQKIVRCLLSGDFLGLLYAILGW  475



>gb|EMS62407.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=450

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 179/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK    +L+D++K  L++FYG+DPL S DLSRIV+ +HF RL KL++D +V+ KI 
Sbjct  220  YIITTKAFVTELVDSLKRVLERFYGEDPLQSADLSRIVSISHFERLAKLIEDKEVATKIQ  279

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ D+++LKIAPT+L+DVP D  +M  EIFGP+LPI+TV+K+E+ I  INA  KPLAA
Sbjct  280  LGGQTDQEQLKIAPTVLVDVPLDTELMTGEIFGPMLPIITVDKIEESITHINAGAKPLAA  339

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPF GVG+SGTGSYHGKFSF+ F+H
Sbjct  340  YLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGGVGDSGTGSYHGKFSFDCFTH  399

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I ALLG 
Sbjct  400  RKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALILALLGF  445



>ref|NP_001148092.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG29697.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=481

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F RLT L+++ +V+ KIV
Sbjct  251  YIITTKSFAPELVASFKRVLERFYGEDPLQSADLSRIVNSKQFKRLTNLIEEKRVADKIV  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K+E+   +INA+ KPLAA
Sbjct  311  YGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEKIEESFDLINAKPKPLAA  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N+KL++EFV ++ AGG+L+ND ALH+    +PF GVG+SG G YHGKF F+ FSH
Sbjct  371  YLFTKNRKLQEEFVASVPAGGMLVNDIALHLTNPYMPFGGVGDSGMGCYHGKFGFDCFSH  430

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  431  KKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  476



>gb|EPS67421.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=250

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +++DA+  ELD FYGK PL S DLSRIVN  HF RL  LL D+KVS +IV
Sbjct  26   YLITTKDYASRVVDAISTELDNFYGKHPLRSHDLSRIVNPKHFERLLTLLQDEKVSCRIV  85

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GGE D   L+IAPT++ DVP D+++M++EIFGPLLPILTV ++E+ + +I+A++K LAA
Sbjct  86   RGGEHDRTTLRIAPTVIFDVPRDSVLMEDEIFGPLLPILTVERIEESLDVIDAKEKALAA  145

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++ KL+ EFV  +SAG + IN+T LH    +LPF GVGESG G+YHGKFSFEAFSH
Sbjct  146  YLFTNSPKLKSEFVRKVSAGAVCINETNLHFMEPSLPFGGVGESGMGAYHGKFSFEAFSH  205

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +KAVL+R   GD+ ARYPPY+ +K  LL+ L+ G L+   +ALLG
Sbjct  206  RKAVLERVLFGDVPARYPPYSRRKMDLLKNLLQGRLVAATQALLG  250



>gb|EMT24757.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=334

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITT+  A +LL+++K  L+KFYGKDPL S DLSR+VN++HF RL  L+D++ VS KIV
Sbjct  105  FIITTQAFAPKLLESLKKVLEKFYGKDPLLSADLSRVVNASHFGRLKGLMDEEMVSDKIV  164

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDE++LKIAPTI +DVP D+ IMKEEIFGPLLPILTV+K+ +   +IN+  KPLAA
Sbjct  165  FGGQRDEQQLKIAPTIFLDVPLDSAIMKEEIFGPLLPILTVDKIHESFGLINSMAKPLAA  224

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT + +L+ +F   +SAGG+L NDT++H+    LPF GVGESGTG+YHGKFSF+AFSH
Sbjct  225  YLFTRDSELQNQFEGAISAGGMLFNDTSIHLTNPYLPFGGVGESGTGAYHGKFSFDAFSH  284

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAV+ R F G+  ARYPPY+  K ++L+ ++ G L  +I+A+LG 
Sbjct  285  RKAVMNRGFAGEARARYPPYSAPKLKILKGVLEGKLGDMIQAILGF  330



>gb|EMS67813.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=334

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 177/226 (78%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITT+  A +LL+++K  L+KFYGKDPL S DLSR+VN++HF RL  L+D++ VS KIV
Sbjct  105  FIITTQAFAPKLLESLKKVLEKFYGKDPLLSADLSRVVNASHFGRLKGLMDEEMVSDKIV  164

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG RDE++LKIAPTI +DVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  KPLAA
Sbjct  165  FGGHRDEQQLKIAPTIFLDVPLDSAIMKEEIFGPLLPIITVDKIHESFGLINSMAKPLAA  224

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT + +L+ +F   +SAGG+L NDT++H+    LPF GVGESGTGSYHGKFSF+AFSH
Sbjct  225  YLFTRDSELQNQFEGAISAGGMLFNDTSIHLTNPYLPFGGVGESGTGSYHGKFSFDAFSH  284

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAV+ R F G+  ARYPPY+  + ++L+ ++ G L  +I+A+LG 
Sbjct  285  RKAVMNRGFAGEARARYPPYSAPRLKILKGVLEGKLGDMIQAILGF  330



>ref|XP_002893982.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70241.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 175/226 (77%), Gaps = 5/226 (2%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNS HF RL+KLLD+ +VS KIV
Sbjct  271  YILTTKEYAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHFDRLSKLLDEKEVSDKIV  330

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GGE+D + LKIAPTIL+DVP D+LIM EE   P     + +   +   +I +R KPLAA
Sbjct  331  YGGEKDRENLKIAPTILLDVPLDSLIMSEENIWP-----SPSNSHESFDMIRSRPKPLAA  385

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT NKKL++ F T +SAGG+++ND A+H+A+HTLPF GVGESG G+YHGKFSF+AFSH
Sbjct  386  YLFTHNKKLKERFATTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSH  445

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I +ALLGL
Sbjct  446  KKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKALLGL  491



>gb|EMT33845.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=517

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 180/232 (78%), Gaps = 6/232 (3%)
 Frame = -2

Query  755  YIITTKENALQL------LDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDK  594
            YIITTK    +L      +D++K  L++FYG+DPL S DLSRIV+ +HF RLTKL++D +
Sbjct  281  YIITTKAFVTELEINFLQVDSLKRVLERFYGEDPLQSADLSRIVSISHFKRLTKLIEDKE  340

Query  593  VSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR  414
            V+ KI  GG+ D+++LKIAPT+L+DVP D  +M  EIFGP+LPI+TV+K+E+ I  INA 
Sbjct  341  VATKIQLGGQTDQEQLKIAPTVLVDVPLDTELMTGEIFGPMLPIITVDKIEESIAHINAG  400

Query  413  DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFS  234
             KPLAAYLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPF GVG+SGTGSYHGKFS
Sbjct  401  AKPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGGVGDSGTGSYHGKFS  460

Query  233  FEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            F+ F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I ALLG 
Sbjct  461  FDCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALILALLGF  512



>ref|XP_002441918.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
 gb|EES15756.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
Length=487

 Score =   281 bits (718),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 178/226 (79%), Gaps = 1/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+TTK  A +LL+++K  L KFYG+DPL S DLSRIVNSNHF+RL  L+DD  V+GKI 
Sbjct  254  YIVTTKSLAPKLLESLKKVLRKFYGEDPLRSPDLSRIVNSNHFNRLRTLMDDGTVAGKIA  313

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE++L+IAPT+L+DVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  KPLAA
Sbjct  314  FGGQSDEQQLRIAPTLLLDVPLDSAIMKEEIFGPLLPIITVDKISESFAVINSVSKPLAA  373

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT++ +L+Q+F  N+S+GG++ NDTA+H+    LPF GVGESG G+YHG FSF+AF+H
Sbjct  374  YLFTNDSRLKQQFERNISSGGMIFNDTAIHLTNPHLPFGGVGESGMGAYHGAFSFDAFTH  433

Query  215  KKAVLKR-SFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +KAVL R SF G+  ARYPPYTP K  +LR ++ GN + ++ A +G
Sbjct  434  RKAVLDRSSFLGEARARYPPYTPAKLGILRGVLKGNPLAMVLAAVG  479



>gb|KJB75339.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKVS KIV
Sbjct  316  YIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKVSNKIV  375

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + KPLAA
Sbjct  376  FGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKPKPLAA  435

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ +++++++FV N+ AGG+ INDT L V V TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  436  YLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSH  495

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMS  117
            KKAVL RSF GD   RYPPYTP K + ++AL+S
Sbjct  496  KKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLS  528



>gb|AFW56225.1| hypothetical protein ZEAMMB73_146423 [Zea mays]
Length=420

 Score =   273 bits (698),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 175/226 (77%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+RL  L+DD  VSG + 
Sbjct  188  YVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFNRLMALMDDYSVSGNVA  247

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+ +   +IN+  KPLAA
Sbjct  248  FGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKIGESFAVINSMPKPLAA  307

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+++ +L+Q+F   +SAGG++ NDT +H+    LPF GVGESG G+YHG FSF+AFSH
Sbjct  308  YLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSFDAFSH  367

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  G 
Sbjct  368  RKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAAGC  413



>gb|ACL53721.1| unknown [Zea mays]
 gb|AFW56224.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 175/226 (77%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+RL  L+DD  VSG + 
Sbjct  259  YVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFNRLMALMDDYSVSGNVA  318

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+ +   +IN+  KPLAA
Sbjct  319  FGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKIGESFAVINSMPKPLAA  378

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+++ +L+Q+F   +SAGG++ NDT +H+    LPF GVGESG G+YHG FSF+AFSH
Sbjct  379  YLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSFDAFSH  438

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  G 
Sbjct  439  RKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAAGC  484



>ref|NP_001152171.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG46203.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 175/226 (77%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+RL  L+DD  VSG + 
Sbjct  259  YVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFNRLMALMDDYSVSGNVA  318

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+ +   +IN+  KPLAA
Sbjct  319  FGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKIGESFAVINSMPKPLAA  378

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+++ +L+Q+F   +SAGG++ NDT +H+    LPF GVGESG G+YHG FSF+AFSH
Sbjct  379  YLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSFDAFSH  438

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  G 
Sbjct  439  RKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAAGC  484



>ref|XP_010238657.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=479

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 173/226 (77%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITT   A +L++ +K  L KFYGKDPL S DLSRIVNSNHF+RL  L+D++ V  KIV
Sbjct  250  FIITTSSFAPKLIEELKKVLGKFYGKDPLGSADLSRIVNSNHFNRLKTLMDEEMVFEKIV  309

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ D  +LKIAPTIL+DVP D+ IM+EEIFGP LPI+TV+K+ +   +IN+  KPLAA
Sbjct  310  FGGQMDAYQLKIAPTILLDVPLDSAIMREEIFGPFLPIITVDKINECFGLINSMSKPLAA  369

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ N KL+ +F  ++SAGG+L+NDT++H+    LPF GVGESGTG+YHGKFSF+AFSH
Sbjct  370  YLFSRNSKLQDKFERSISAGGMLLNDTSIHLTNPYLPFGGVGESGTGAYHGKFSFDAFSH  429

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R F G+  ARYPPY+  K ++++ ++ G L  +I+A LG 
Sbjct  430  KKAVLNRGFFGEAKARYPPYSEPKLKIMKGVLEGKLGDMIQAFLGF  475



>ref|XP_004977224.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Setaria italica]
Length=482

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 177/225 (79%), Gaps = 0/225 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +LLD++   L+KFYGKDPL S DLSRIVNSNHF+RL  L+D++ V  KIV
Sbjct  253  YIITTKSFAPKLLDSLSKVLEKFYGKDPLRSADLSRIVNSNHFNRLKALMDEEMVYDKIV  312

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE++LKIAPT+L+D P D+ IMKEE+FGPLLPI+TV+K+ +   +IN+  KPLAA
Sbjct  313  FGGQSDEQQLKIAPTLLLDPPLDSAIMKEEVFGPLLPIITVDKIHESFALINSMSKPLAA  372

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF+ + KL+ +F  N+SAGG++ NDT++H+    LPF GVGESG GSYHG FSF+AF+H
Sbjct  373  YLFSKDSKLKHQFERNVSAGGMVFNDTSIHLTNQHLPFGGVGESGVGSYHGTFSFDAFAH  432

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            KKAVL RSF G+  ARYPPYTP K ++L+ ++ GN + +++A +G
Sbjct  433  KKAVLDRSFLGEAKARYPPYTPGKLKILKGVLKGNPLAMVQAAVG  477



>ref|XP_010547359.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=438

 Score =   263 bits (673),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 177/224 (79%), Gaps = 0/224 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L++A+K EL   +G++PL SKD+SRIV+S HF RL  +L++  V+ KIV
Sbjct  215  YVITTKDFAPKLIEALKSELVTSFGENPLESKDISRIVSSFHFKRLESMLNESGVADKIV  274

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+++E++L+I+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG +II ++ KPLAA
Sbjct  275  IGGQKNEEKLQISPTILLDVPEGSSMMQEEIFGPLLPIITVQKIEDGFEIIRSKPKPLAA  334

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+ L+++FV N+SAGG+ IND  LHV V  LPF GVGESG G YHGKFSFE FSH
Sbjct  335  YLFTNNELLKKKFVENISAGGMGINDAVLHVTVDGLPFGGVGESGMGGYHGKFSFETFSH  394

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            KK VL RSF  D   RYPPYTPKK ++L AL+SGNL   I AL 
Sbjct  395  KKGVLYRSFSWDSDLRYPPYTPKKQKVLTALLSGNLFDAILALF  438



>ref|XP_010093107.1| Aldehyde dehydrogenase family 3 member I1 [Morus notabilis]
 gb|EXB53545.1| Aldehyde dehydrogenase family 3 member I1 [Morus notabilis]
Length=588

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 186/298 (62%), Gaps = 73/298 (24%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A  L+D+++ EL++ +G++PL ++D+SRIVN  HFSRL KLLD+DKVS KIV
Sbjct  289  YIITTKDFAPTLIDSLRRELEQSFGQNPLETRDVSRIVNKYHFSRLLKLLDEDKVSDKIV  348

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ +E +L+IAPTIL+DVP+D  IMKEEIFGP LPI+TV K+ED   +IN+R +PL A
Sbjct  349  LGGQSNEDQLRIAPTILLDVPDDTEIMKEEIFGPFLPIVTVEKIEDSFDVINSRPQPLVA  408

Query  395  YL-----------------------------FTSNKKLEQEFVTNLSAGGLLINDTALHV  303
            YL                             FT+N +L++++V N+S+GG+L+NDT LHV
Sbjct  409  YLFTNNDQLKKDYVQNVSSGGMLVNDTVLHIFTNNDQLKKDYVQNVSSGGMLVNDTVLHV  468

Query  302  AVHTLPFAGVGESGTGSYHGKFSFEAFSHKKAVLKRS-------------FGG-------  183
             V  LPF GVGESG GSYHGKFSF+ FSHKK+V+ R              FGG       
Sbjct  469  TVDGLPFGGVGESGMGSYHGKFSFDGFSHKKSVMYRGFEPDASVTVDGLPFGGVGESGMG  528

Query  182  ------------------------DLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
                                    D   RYPPYTP+K RLL+AL+SG ++ II+AL+G
Sbjct  529  SYHGKFSFDGFSHKKSVMYRGFEPDASVRYPPYTPQKQRLLKALLSGKILAIIQALIG  586



>ref|XP_001780129.1| variable substrate [Physcomitrella patens]
 gb|EDQ55048.1| variable substrate [Physcomitrella patens]
Length=500

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 165/226 (73%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  +  A +L+D +K  ++ FYGK+P+ S +LSRIVN+ H+ RL   L+D ++  KIV
Sbjct  273  YILVDESIASELVDNLKEIIETFYGKNPISSTNLSRIVNTKHYLRLISFLEDPQICSKIV  332

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERDEK+L IAPT++ D   D+ +M EEIFGP+LPI+ V   ++ I IINAR KPLAA
Sbjct  333  HGGERDEKKLYIAPTLVCDALMDSFLMSEEIFGPILPIIKVQGEQEAIDIINARPKPLAA  392

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT+NK +E+  V N+S+GG+++NDT +H     LPF GVGESG GSYHGKFSF+AFSH
Sbjct  393  YVFTTNKAVEERMVKNVSSGGMVVNDTVMHFVNPGLPFGGVGESGMGSYHGKFSFDAFSH  452

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R+  GD  ARYPP+T KK   LR ++ G+ I  I +L GL
Sbjct  453  KKAVLYRTSLGDFPARYPPFTTKKQNFLRCVLDGDYIGAILSLTGL  498



>ref|XP_010547357.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010547358.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=540

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 177/224 (79%), Gaps = 0/224 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+ITTK+ A +L++A+K EL   +G++PL SKD+SRIV+S HF RL  +L++  V+ KIV
Sbjct  317  YVITTKDFAPKLIEALKSELVTSFGENPLESKDISRIVSSFHFKRLESMLNESGVADKIV  376

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+++E++L+I+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG +II ++ KPLAA
Sbjct  377  IGGQKNEEKLQISPTILLDVPEGSSMMQEEIFGPLLPIITVQKIEDGFEIIRSKPKPLAA  436

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT+N+ L+++FV N+SAGG+ IND  LHV V  LPF GVGESG G YHGKFSFE FSH
Sbjct  437  YLFTNNELLKKKFVENISAGGMGINDAVLHVTVDGLPFGGVGESGMGGYHGKFSFETFSH  496

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            KK VL RSF  D   RYPPYTPKK ++L AL+SGNL   I AL 
Sbjct  497  KKGVLYRSFSWDSDLRYPPYTPKKQKVLTALLSGNLFDAILALF  540



>ref|XP_002978104.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
 gb|EFJ20761.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
Length=479

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 160/226 (71%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++     + + ++AMK  L  FYG++P  S D+SR+VN NHF+RL  LLDD  ++ KI 
Sbjct  252  YVLVDSSCSTKFIEAMKDTLKSFYGENPRESMDISRVVNINHFNRLVGLLDDPNIASKIA  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+DE +L IAPT+L DVP D+ +M EEIFGP+LPI++V  +++ I I+N+R KPLA 
Sbjct  312  HGGEKDETKLYIAPTLLEDVPLDSKVMSEEIFGPILPIISVRSIDEAIDIVNSRPKPLAL  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT   K++++ +   SAGG+++ND  LH    TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  372  YLFTKKDKVKEKVIAETSAGGMVVNDCCLHFLTTTLPFGGVGESGMGSYHGKFSFDAFSH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KA+L R F  D+ ARYPPY+  K   +R L+  + + +I  LLGL
Sbjct  432  HKAILTRPFWMDIMARYPPYSAHKKTFIRCLLEADFVGVILCLLGL  477



>ref|XP_002966639.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
 gb|EFJ32666.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
Length=479

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 160/226 (71%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++     + + ++AMK  L  FYG++P  S D+SR+VN NHF+RL  LLDD  ++ KI 
Sbjct  252  YVLVDSSCSTKFIEAMKDTLKSFYGENPRESMDISRVVNINHFNRLVGLLDDPNIASKIA  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGE+DE +L IAPT+L DVP D+ +M EEIFGP+LPI++V  +++ I I+N+R KPLA 
Sbjct  312  HGGEKDETKLYIAPTLLEDVPLDSKVMSEEIFGPILPIISVRSIDEAIDIVNSRPKPLAL  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT   K++++ +   SAGG+++ND  LH    TLPF GVGESG GSYHGKFSF+AFSH
Sbjct  372  YLFTKKDKVKEKVIAETSAGGMVVNDCCLHFLTTTLPFGGVGESGMGSYHGKFSFDAFSH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KA+L R F  D+ ARYPPY+  K   +R L+  + + +I  LLGL
Sbjct  432  HKAILTRPFWMDIMARYPPYSAHKKTFIRCLLEADFVGVILCLLGL  477



>ref|XP_002978037.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
 gb|EFJ20694.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
Length=480

 Score =   254 bits (650),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 159/224 (71%), Gaps = 0/224 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  +    +L+ A+K  L +FYG DP  SKD++R+VN +HF RLT LLD+D V  KIV
Sbjct  252  YILADESVVPKLITAIKECLLEFYGDDPSKSKDIARVVNGSHFERLTGLLDEDGVKDKIV  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG RD  +L IAPT+++D P D+ +M EEIFGPLLP++ V+ +E  +  +N R KPLA 
Sbjct  312  FGGARDSNKLFIAPTVILDPPADSAVMTEEIFGPLLPVIPVDSMESAMSFVNTRPKPLAL  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +K LE++ V+  SAGG+++NDT LH    T+PF GVG SG G+YHGKFSF+AFSH
Sbjct  372  YLFTRDKALEKKVVSETSAGGMVVNDTVLHFVTETMPFGGVGHSGMGAYHGKFSFDAFSH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            +KAVL R F GD+ +RYPPYT  K   ++  + GN +  I+ALL
Sbjct  432  RKAVLYRGFWGDMASRYPPYTIAKQTFVKNFLQGNYLEAIKALL  475



>ref|XP_002966702.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
 gb|EFJ32729.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
Length=480

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 158/224 (71%), Gaps = 0/224 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  +    +L+ A+K  L +FYG DP  SKD++R+VN +HF RLT LLD+D V  KIV
Sbjct  252  YILADESVVPKLITAIKECLLEFYGDDPSRSKDIARVVNGSHFERLTGLLDEDGVKDKIV  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG RD  +L IAPT+++D P D+ +M EEIFGPLLP++ V+ +E  +  +N R KPLA 
Sbjct  312  FGGARDSNKLFIAPTVILDPPADSAVMTEEIFGPLLPVIPVDSMESAMSFVNTRPKPLAL  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT +K LE++ V+  SAGG+++NDT LH    T+PF GVG SG G+YHGKFSF+AFSH
Sbjct  372  YLFTRDKALEKKVVSETSAGGMVVNDTVLHFVTETMPFGGVGHSGMGAYHGKFSFDAFSH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            +KAVL R F  D+ +RYPPYT  K   +R  + GN +  I+ALL
Sbjct  432  RKAVLYRGFWADMASRYPPYTIAKQNFVRNFLQGNYLEAIKALL  475



>ref|XP_001764841.1| variable substrate [Physcomitrella patens]
 gb|EDQ70283.1| variable substrate [Physcomitrella patens]
Length=492

 Score =   249 bits (637),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 164/226 (73%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  +  A +++D +   ++ FYGKDP  S+DLSRIVN+ H+SRL   LDD K+S KIV
Sbjct  265  YLLIDEIIASEVVDTLIDVIETFYGKDPKTSQDLSRIVNTKHYSRLAGFLDDPKISSKIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG RD+ +L I+PT++ DVP D+ +M EEIFGP+LPI+ V  V++ I II+ R KPL A
Sbjct  325  HGGARDDNKLYISPTLVCDVPMDSTLMSEEIFGPILPIIKVKGVQEAIDIISDRPKPLVA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT NK++E+  V ++S+GG+++NDT +H     LPF GVGESG  SYHGKFSF+AFSH
Sbjct  385  YVFTKNKEVEKRIVASISSGGMVVNDTIVHFLNPGLPFGGVGESGMSSYHGKFSFDAFSH  444

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R+  GD+ AR+PP+T  K    RA+M G+ +  + +L GL
Sbjct  445  KKAVLYRNNLGDVPARFPPFTTMKQNFRRAIMDGHYLSAVISLTGL  490



>ref|XP_001757163.1| variable substrate [Physcomitrella patens]
 gb|EDQ78022.1| variable substrate [Physcomitrella patens]
Length=479

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 161/226 (71%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  +  A  L+  ++  L +FYG DP  S DL+RI+N NHF RL+ +LDD  ++ KIV
Sbjct  252  YVLVEEHFAPTLIKQLQKTLLEFYGPDPSASVDLARIINKNHFQRLSSMLDDPSIADKIV  311

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERDEK L IAPT++ + P D+ +M EEIFGP+LPI+TV  V+  + IIN + KPL  
Sbjct  312  HGGERDEKSLYIAPTLIDNPPLDSPVMVEEIFGPMLPIITVRNVDHALNIINDKPKPLEV  371

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+F++NK L   F    S+GG+++ND  L   +  LPF GVGESGTG+YHGK +F+AFSH
Sbjct  372  YVFSNNKDLFNRFRDETSSGGIVMNDCVLQFIIPELPFGGVGESGTGAYHGKATFDAFSH  431

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL ++ GGD+ ARYPP+T +K  L++AL++G +I II A LG 
Sbjct  432  RKAVLVKNMGGDVFARYPPFTVRKQSLIKALLTGTIIDIILAALGW  477



>ref|XP_004977223.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Setaria italica]
Length=520

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 178/263 (68%), Gaps = 38/263 (14%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK  A +LLD++   L+KFYGKDPL S DLSRIVNSNHF+RL  L+D++ V  KIV
Sbjct  253  YIITTKSFAPKLLDSLSKVLEKFYGKDPLRSADLSRIVNSNHFNRLKALMDEEMVYDKIV  312

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ DE++LKIAPT+L+D P D+ IMKEE+FGPLLPI+TV+K+ +   +IN+  KPLAA
Sbjct  313  FGGQSDEQQLKIAPTLLLDPPLDSAIMKEEVFGPLLPIITVDKIHESFALINSMSKPLAA  372

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHT-------------------------  291
            YLF+ + KL+ +F  N+SAGG++ NDT++HV  +                          
Sbjct  373  YLFSKDSKLKHQFERNVSAGGMVFNDTSIHVRKNCTEPELQSVSELRILFSFITDGCSLP  432

Query  290  -------------LPFAGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTP  150
                         LPF GVGESG GSYHG FSF+AF+HKKAVL RSF G+  ARYPPYTP
Sbjct  433  YKLVATLQLTNQHLPFGGVGESGVGSYHGTFSFDAFAHKKAVLDRSFLGEAKARYPPYTP  492

Query  149  KKARLLRALMSGNLIFIIRALLG  81
             K ++L+ ++ GN + +++A +G
Sbjct  493  GKLKILKGVLKGNPLAMVQAAVG  515



>gb|KHN21904.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=446

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 148/210 (70%), Gaps = 0/210 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K   L+L++ MKV + K +G++P  SK +++IVN +HFSRL  LL D +V G +V
Sbjct  209  YVLVEKGYCLKLVELMKVWIKKMFGQNPRKSKTIAKIVNKHHFSRLKNLLADKQVKGSVV  268

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K+ED IK INAR KPLA 
Sbjct  269  YGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEKIEDSIKFINARPKPLAL  328

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT N  L++  ++  S+G + IND  L  A  T+PF GVGESG G YHGKFSF+ FSH
Sbjct  329  YVFTKNHTLQRRMISETSSGSVTINDAVLQYAADTIPFGGVGESGFGMYHGKFSFDTFSH  388

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRA  126
            +KA+++RSF  D   RYPP+T  K +LL  
Sbjct  389  QKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  418



>gb|EPS67391.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=432

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+IT+++ +L+L+DA+  ELD F   DPL S D +RIVNS HF RL +LL+D K+SGKIV
Sbjct  243  YVITSRDYSLKLIDAISSELDNFCSGDPLQSDDSTRIVNSGHFERLVRLLEDPKISGKIV  302

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-DKPLA  399
             GG+ D+ +LKI+PT++MD P+D+L+M EEIFGPLLPI+TV  +E+ I +IN + +KPLA
Sbjct  303  IGGKWDKAKLKISPTVIMDAPKDSLVMNEEIFGPLLPIITVEDIEESIAVINGKGNKPLA  362

Query  398  AYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFS  219
            AY+FT N+KL  +F+ N+SAG + IND  L V    LPF GVGESG G YHGKFSF+AFS
Sbjct  363  AYIFTRNEKLRDDFIRNVSAGSMAINDVNLQVVEPELPFGGVGESGMGCYHGKFSFDAFS  422

Query  218  HKKAVLKRSF  189
            H+K VL R F
Sbjct  423  HRKPVLDRHF  432



>ref|XP_003539064.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Glycine 
max]
Length=494

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 148/210 (70%), Gaps = 0/210 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K   L+L++ MKV + K +G++P  SK +++IVN +HFSRL  LL D +V G +V
Sbjct  257  YVLVEKGYCLKLVELMKVWIKKMFGQNPRKSKTIAKIVNKHHFSRLKNLLADKQVKGSVV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K+ED IK INAR KPLA 
Sbjct  317  YGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEKIEDSIKFINARPKPLAL  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT N  L++  ++  S+G + IND  L  A  T+PF GVGESG G YHGKFSF+ FSH
Sbjct  377  YVFTKNHTLQRRMISETSSGSVTINDAVLQYAADTIPFGGVGESGFGMYHGKFSFDTFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRA  126
            +KA+++RSF  D   RYPP+T  K +LL  
Sbjct  437  QKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  466



>gb|KDO80591.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=434

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            +IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKVSGKIV
Sbjct  265  HIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIV  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  KPLAA
Sbjct  325  HGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAA  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTL  288
            YLFT+NKKL+Q+FV  +SAGGL+INDTA+HV +  L
Sbjct  385  YLFTNNKKLKQQFVETVSAGGLVINDTAVHVIMLAL  420



>ref|XP_003539464.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Glycine 
max]
Length=494

 Score =   234 bits (597),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 147/210 (70%), Gaps = 0/210 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K    +L++ MKV + K  G++P  SK +++IVN +HFSRL  LL D KV   ++
Sbjct  257  YVLVEKVYCFKLVELMKVWIKKMCGENPQQSKTIAKIVNKHHFSRLKNLLADKKVKESVI  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K+ED IK IN+R KPLA 
Sbjct  317  YGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEKIEDSIKFINSRPKPLAL  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT N+ L++  ++  S+G + IND  L  AV T+PF GVGESG G YHGKFSF+ FSH
Sbjct  377  YVFTKNQTLQRRMISETSSGSVTINDAILQYAVDTVPFGGVGESGFGMYHGKFSFDTFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRA  126
            +KA+++RSF  D   RYPP+T  K +LL  
Sbjct  437  QKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  466



>ref|XP_007132014.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
 gb|ESW04008.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
Length=492

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 146/208 (70%), Gaps = 0/208 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K+   +L++ MKV + K +G++P  SK +++IVN +HFSRL  LL D  V   +V
Sbjct  255  YVLVEKKYCSKLVELMKVWIKKMFGENPQHSKTITKIVNKHHFSRLNNLLTDKMVKESVV  314

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K+ED IK I++R KPLA 
Sbjct  315  YGGSMDEENLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEKIEDSIKFISSRPKPLAL  374

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+F+ NK LE+  V+  S+G L  ND  +  A  TLPF GVGESG G YHGKFSF+ FSH
Sbjct  375  YVFSRNKTLERRMVSETSSGSLTFNDAIVQYAADTLPFGGVGESGFGMYHGKFSFDTFSH  434

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLL  132
            +KA+++RSF  D   RYPP+T  K +LL
Sbjct  435  QKAIVRRSFLTDFWFRYPPWTLNKLQLL  462



>ref|XP_001767194.1| variable substrate [Physcomitrella patens]
 gb|EDQ68115.1| variable substrate [Physcomitrella patens]
Length=485

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 150/226 (66%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  +  A +L+   +  L +F+G+DP  SKDLSRIVN NHF RL++LLDD   + +IV
Sbjct  258  YILVEEHLAPKLIKQFRSTLVEFFGEDPRTSKDLSRIVNKNHFQRLSRLLDDPATADRIV  317

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERDE  L IAPT++ D   D+ IM +EIFGPLLPI+TV  V   I +IN + K L  
Sbjct  318  HGGERDEDSLYIAPTLIEDPALDSPIMADEIFGPLLPIITVRNVNAAIDLINDKPKALVV  377

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            +LF++NK   + F    S+GGL++ND  +   V  LPF GVGESGTG+YHGK SF+ FSH
Sbjct  378  HLFSTNKDYVKMFTEETSSGGLVMNDCIMQFIVPELPFGGVGESGTGAYHGKASFDTFSH  437

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             K++  +S  GD   RYPP+T  K  +LRA + G    +I+ LLGL
Sbjct  438  FKSIFNKSQSGDAPIRYPPFTLWKQAMLRAFLEGRFFKLIQLLLGL  483



>gb|AFK41010.1| unknown [Lotus japonicus]
Length=293

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 140/210 (67%), Gaps = 0/210 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++      L+L++ MKV + K +G+ P  S  ++RIVN  HF RL  LL D KV   +V
Sbjct  57   YVLVENRYCLKLVELMKVWIKKMFGEVPQHSNSIARIVNEKHFFRLKNLLTDQKVLKSVV  116

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L I PTIL++ P DA IM +EIFGPLLPI+T++K+ED +  IN+  KPLA 
Sbjct  117  YGGSVDEENLFIEPTILVNPPLDAAIMSDEIFGPLLPIITLDKIEDSVNFINSMPKPLAL  176

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT NK L+   ++  S+G L+ ND+ L  A  TLPF GVGESG G YHGKFSF+ FSH
Sbjct  177  YVFTKNKTLQNRMISETSSGSLMFNDSMLQYAADTLPFGGVGESGFGMYHGKFSFDTFSH  236

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRA  126
             K +++RS+  D   RYPP+T  K +LL  
Sbjct  237  HKGIVRRSYLTDFWYRYPPWTLNKFQLLEV  266



>ref|XP_004507095.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=488

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 142/208 (68%), Gaps = 0/208 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+I  + N  ++++ MK+ + K +G +P  SK ++RIVN  H  RL  LL D KV   +V
Sbjct  253  YVIVERSNCSKVVELMKMWIKKMFGDNPKHSKSIARIVNKQHLFRLKNLLTDKKVQKSVV  312

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG  DE+ L + PTIL++ P DA IM +E+FGPLLPI+TV K+ED I+ I+ R KPLA 
Sbjct  313  CGGSVDEENLFVEPTILVNPPLDATIMTDEVFGPLLPIITVEKIEDSIEFISCRPKPLAL  372

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT N+ L++  ++  S+G ++ ND  L  A  +LPF GVGESG G YHGKFSF+ FSH
Sbjct  373  YVFTKNQTLQKRMISETSSGSVVFNDAILQYAADSLPFGGVGESGFGMYHGKFSFDTFSH  432

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLL  132
            +KA+++RSF  D   RYPP+ P K +LL
Sbjct  433  QKAIVRRSFFTDFWYRYPPWKPHKFQLL  460



>gb|KDO71077.1| hypothetical protein CISIN_1g0386172mg, partial [Citrus sinensis]
Length=361

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 145/209 (69%), Gaps = 0/209 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF RL KLL D  V+  IV
Sbjct  134  YILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHFERLRKLLKDPLVADAIV  193

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N +++ I+ IN+R KPLA 
Sbjct  194  HGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNNIQESIEFINSRPKPLAI  253

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT ++  +++ V+  S+G L+ NDT +      LPF GVG+SG G YHG +SFE FSH
Sbjct  254  YAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQSGIGRYHGHYSFETFSH  313

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            +KA+++RSF  +L  RYPP+   K + LR
Sbjct  314  EKAIMQRSFFLELEPRYPPWNDFKMKFLR  342



>ref|XP_001770374.1| variable substrate [Physcomitrella patens]
 gb|EDQ64864.1| variable substrate [Physcomitrella patens]
Length=466

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 150/226 (66%), Gaps = 1/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  +  A +L+  ++  L +FYG+DP  +KDL+RIVN NHF RL++LLD    +  I+
Sbjct  240  YILVEEHLAPKLIKQLQSTLVQFYGEDPRSTKDLARIVNKNHFQRLSRLLDHPSTAENII  299

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERDE+ L IAPT++ D P  + IM+EEIFGPLLPI+T + V+  + +IN + K L  
Sbjct  300  HGGERDEESLYIAPTLIKDPPLSSPIMEEEIFGPLLPIIT-DHVDAAVDLINDKPKALEI  358

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF++ K    +F    S+GGL++ND  +  AV  LPF GVGESGTG+YHG  SF  FSH
Sbjct  359  YLFSTRKDYAMKFAEETSSGGLVMNDCIVQFAVSELPFGGVGESGTGAYHGVASFNTFSH  418

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             K++  +S G D+  RYPP+T +K  ++RA + G  +  I   LGL
Sbjct  419  YKSIFNKSLGVDVAFRYPPFTTQKQGMMRAFLEGRFVNFILLALGL  464



>ref|XP_002298405.2| hypothetical protein POPTR_0001s26630g [Populus trichocarpa]
 gb|EEE83210.2| hypothetical protein POPTR_0001s26630g [Populus trichocarpa]
Length=485

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 147/226 (65%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K  A  L++ MKV + K +G++P  +  ++RIVN  HF RL  LL D  V   IV
Sbjct  256  YILVEKRFASILVELMKVMIKKMFGENPRETNTVARIVNEQHFLRLKNLLSDSAVQNSIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DEK L + PTIL+D P DA IM EEIFGPLLPI+T++KVED I  IN++ KPLA 
Sbjct  316  YGGSMDEKNLFVEPTILVDPPLDAAIMTEEIFGPLLPIITLDKVEDSIAFINSKPKPLAI  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT+N+K  +  ++  S+G L+ ND  +  A   LPF G+GESG G YHGKFSF+ FSH
Sbjct  376  YAFTNNEKFRRRMLSETSSGSLVFNDAVIQYAADALPFGGIGESGIGKYHGKFSFDTFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KAV +RSF  D   R+PP+   K  LL A  + + + ++  +LGL
Sbjct  436  YKAVTRRSFLTDFWFRFPPWNDYKLLLLEATYNYDYLGMLLVILGL  481



>gb|KJB29204.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=415

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKVS KIV
Sbjct  262  YIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKVSSKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+KVED   +IN+  KPLAA
Sbjct  322  HGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDKVEDSFDVINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHV  303
            YLFT+ KKL+++FV  +SAGGL+INDT +HV
Sbjct  382  YLFTNKKKLKEKFVATVSAGGLVINDTTVHV  412



>ref|XP_010045018.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
 gb|KCW87156.1| hypothetical protein EUGRSUZ_B03683 [Eucalyptus grandis]
Length=487

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 150/226 (66%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y+I  K+ +  LL+ MKV + K  G++P  S+ ++RIVN +HF RL  LL+D  V   IV
Sbjct  256  YVIVEKKFSSTLLELMKVRIGKMLGENPRESRSMARIVNKHHFLRLKTLLEDPNVKASIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DEK L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R KPLA 
Sbjct  316  YGGSMDEKSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKKIEDSINFINSRPKPLAL  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT N  L +  V   S+G +  ND  +     TLPF G+GESG G+YHGKFSF+ FSH
Sbjct  376  YVFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGESGMGNYHGKFSFDTFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KAVL+RSF  D   R+PP+   K +L R++   + + ++  +LGL
Sbjct  436  HKAVLRRSFLVDFWFRFPPWNDHKLQLFRSVYLFDYLGMLLTVLGL  481



>ref|XP_006425564.1| hypothetical protein CICLE_v10025492mg [Citrus clementina]
 gb|ESR38804.1| hypothetical protein CICLE_v10025492mg [Citrus clementina]
Length=484

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 146/209 (70%), Gaps = 0/209 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF RL KLL+D  V+  IV
Sbjct  257  YILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHFERLRKLLEDPLVADAIV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N +++ I+ IN+R KPLA 
Sbjct  317  HGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNNIQESIEFINSRPKPLAI  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT ++  +++ V+  S+G L+ NDT +      LPF GVG+SG G YHG +SFE FSH
Sbjct  377  YAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQSGIGRYHGHYSFETFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            +KA+++RSF  +L  RYPP+   K + LR
Sbjct  437  EKAIMQRSFFLELEPRYPPWNDFKMKFLR  465



>ref|XP_010031796.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
 gb|KCW51187.1| hypothetical protein EUGRSUZ_J00773 [Eucalyptus grandis]
Length=495

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 151/226 (67%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K+ +  L++ MKV + K +G+ P  S+ ++RIVN +HF RL  LL D  V   IV
Sbjct  260  YVLVEKKFSSALVELMKVVMKKMFGESPRESQSVARIVNKHHFLRLRSLLLDPLVKSSIV  319

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L I PTILMD P  A IM +EIFGPLLPI+T+NK+ED I+ IN+R KPLA 
Sbjct  320  YGGSMDEESLFIEPTILMDPPLQAAIMMDEIFGPLLPIVTLNKIEDSIEFINSRPKPLAI  379

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT ++ L +  V+  S+G ++ ND  +     TLPF G+GESG G YHGKFSF+ FSH
Sbjct  380  YVFTKDEPLRRSMVSKTSSGSIVFNDAIIQYLADTLPFGGIGESGMGRYHGKFSFDTFSH  439

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAV++RSF  D   R+PP+   K +L R+    + + I+  +LGL
Sbjct  440  QKAVVRRSFLVDFWFRFPPWNDHKLQLFRSSYHYDYLGIVLTVLGL  485



>ref|XP_006466887.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Citrus 
sinensis]
Length=484

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 145/209 (69%), Gaps = 0/209 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF RL KLL D  V+  IV
Sbjct  257  YILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHFERLRKLLKDPLVADAIV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N +++ I+ IN+R KPLA 
Sbjct  317  HGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNNIQESIEFINSRPKPLAI  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT ++  +++ V+  S+G L+ NDT +      LPF GVG+SG G YHG +SFE FSH
Sbjct  377  YAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQSGIGRYHGHYSFETFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            +KA+++RSF  +L  RYPP+   K + LR
Sbjct  437  EKAIMQRSFFLELEPRYPPWNDFKMKFLR  465



>gb|KCW87154.1| hypothetical protein EUGRSUZ_B03682 [Eucalyptus grandis]
Length=441

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 139/211 (66%), Gaps = 0/211 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++   + +  LL+ MKV + K  G++P  S  ++RIVN NHFSRL  LL+D  V   IV
Sbjct  210  YVLVETKFSSTLLELMKVWIGKMLGENPRESHSMARIVNKNHFSRLKTLLEDPNVKASIV  269

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R KPLA 
Sbjct  270  YGGSMDENSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKKIEDSINFINSRPKPLAI  329

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT N  L +  V   S+G +  ND  +     TLPF G+GESG G+YHGKFSF+ FSH
Sbjct  330  YAFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGESGMGNYHGKFSFDTFSH  389

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
             KAVL+RSF  D   R+PP+   K +L R++
Sbjct  390  HKAVLRRSFLVDFWFRFPPWNDHKLQLFRSM  420



>ref|XP_009768441.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nicotiana 
sylvestris]
Length=481

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 149/226 (66%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K  A +L+  +K  + K +G++P  S  +SRI+N  HF RL  LLD+ KV   IV
Sbjct  253  YILVEKTYANELVQLIKDAIPKTFGENPKESHSISRIINRTHFLRLKNLLDEPKVKASIV  312

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE  L I PT+L+D P  A IM EEIFGPLLPI+T++K+ED I+ INAR K L  
Sbjct  313  YGGSTDEDNLFIEPTVLLDPPLKAAIMTEEIFGPLLPIITLDKIEDSIEFINARPKTLTI  372

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT ++ L+++ ++  S+G ++ NDT +  AV TLPF GVG+SG G YHGKFSF+ FSH
Sbjct  373  YAFTKDEALKKKIISRTSSGSVVFNDTIIQYAVDTLPFGGVGQSGFGRYHGKFSFDTFSH  432

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +K V +RSF  D+  RYPP+  K  +L R+    + + ++   LGL
Sbjct  433  EKTVARRSFLTDIWFRYPPWNNKSLQLFRSAYRYDYLSVVLITLGL  478



>ref|XP_010673629.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Beta 
vulgaris subsp. vulgaris]
Length=483

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 149/226 (66%), Gaps = 2/226 (1%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K+ +  L++ +K  + K +G++P   + ++RI+N +HF+RL  LLDD +V   IV
Sbjct  250  YILVEKKLSSTLVELLKDGIKKSFGENP--EECVARIINKHHFNRLKGLLDDPRVKTSIV  307

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG   E +L I PTIL+D P DA IM EEIFGPLLPI+T+  +E  I+ IN+R KPL  
Sbjct  308  HGGSIHEDKLFIEPTILVDPPLDAEIMTEEIFGPLLPIITLENIEGSIEFINSRSKPLVI  367

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT+N K  +   +  S+G +L NDT +  A  T+PF GVGESG G YHGKF+F+AFSH
Sbjct  368  YCFTNNNKFMKRVSSETSSGAVLFNDTIVQYAADTIPFGGVGESGFGRYHGKFTFDAFSH  427

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +K ++KR    D   R+PP+T KK  LLRA  S N   I+  +LGL
Sbjct  428  EKPIVKRDLFPDFWFRFPPWTSKKLELLRAAFSYNYFLIVLIVLGL  473



>ref|XP_011006203.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X1 [Populus euphratica]
Length=485

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 144/226 (64%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K  A  L++ MKV + K +G+ P  +  ++RIVN  HF RL  LL D  V   +V
Sbjct  256  YILVEKRFASTLVELMKVLIKKMFGETPRETNTVARIVNEQHFLRLKNLLSDSAVRNSVV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L + PTIL+D P DA IM EEIFGPLLP++T++KVED I  IN++ KPLA 
Sbjct  316  YGGSMDERNLFVEPTILVDPPLDAAIMTEEIFGPLLPVITLDKVEDSIAFINSKPKPLAI  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y F++N+K  +   +  S+G L+ ND  +  A   LPF G+GESG G YHGKFSF+ FSH
Sbjct  376  YAFSNNEKFRRRISSETSSGSLVFNDAVIQYAAEGLPFGGIGESGLGKYHGKFSFDTFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KAV KRSF  D   R+PP+   K  LL A    + + ++  +LGL
Sbjct  436  YKAVTKRSFLTDFWFRFPPWNDYKLLLLEATYYSDYLGMLLVILGL  481



>ref|XP_011006204.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X2 [Populus euphratica]
Length=485

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 144/226 (64%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K  A  L++ MKV + K +G+ P  +  ++RIVN  HF RL  LL D  V   +V
Sbjct  256  YILVEKRFASTLVELMKVLIKKMFGETPRETNTVARIVNEQHFLRLKNLLSDSAVRNSVV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L + PTIL+D P DA IM EEIFGPLLP++T++KVED I  IN++ KPLA 
Sbjct  316  YGGSMDERNLFVEPTILVDPPLDAAIMTEEIFGPLLPVITLDKVEDSIAFINSKPKPLAI  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y F++N+K  +   +  S+G L+ ND  +  A   LPF G+GESG G YHGKFSF+ FSH
Sbjct  376  YAFSNNEKFRRRISSETSSGSLVFNDAVIQYAAEGLPFGGIGESGLGKYHGKFSFDTFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KAV KRSF  D   R+PP+   K  LL A    + + ++  +LGL
Sbjct  436  YKAVTKRSFLTDFWFRFPPWNDYKLLLLEATYYSDYLGMLLVILGL  481



>ref|XP_010045016.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=487

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 139/211 (66%), Gaps = 0/211 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++   + +  LL+ MKV + K  G++P  S  ++RIVN NHFSRL  LL+D  V   IV
Sbjct  256  YVLVETKFSSTLLELMKVWIGKMLGENPRESHSMARIVNKNHFSRLKTLLEDPNVKASIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R KPLA 
Sbjct  316  YGGSMDENSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKKIEDSINFINSRPKPLAI  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT N  L +  V   S+G +  ND  +     TLPF G+GESG G+YHGKFSF+ FSH
Sbjct  376  YAFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGESGMGNYHGKFSFDTFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
             KAVL+RSF  D   R+PP+   K +L R++
Sbjct  436  HKAVLRRSFLVDFWFRFPPWNDHKLQLFRSM  466



>dbj|BAJ96457.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 155/227 (68%), Gaps = 5/227 (2%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  ++ A  L++ +K  L++F+ K     +D++RIVN   F+RL+ LL+D KVS  IV
Sbjct  261  YILVEEQFAPILIELLKSTLERFFTK----PEDMARIVNERQFNRLSGLLEDHKVSCSIV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+ D K L I PTIL++ P D+ +M EEIFGPLLPI+TV K+ED I+ +N+R KPLA 
Sbjct  317  HGGDLDPKTLSIEPTILLNPPLDSDVMTEEIFGPLLPIITVKKIEDSIEFVNSRPKPLAI  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT+++ L+Q+ +   S+G +  ND  +   + ++PF GVG+SG G YHGK+SFE FSH
Sbjct  377  YAFTTSEALKQQIIKETSSGSVTFNDAIVQYGLESIPFGGVGQSGFGQYHGKYSFEMFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPK-KARLLRALMSGNLIFIIRALLGL  78
            KKAV +RSF  +   RYPP+  + K  LLR +   + + ++ ALLGL
Sbjct  437  KKAVFRRSFLVEFMFRYPPWNDESKLGLLRHVFRYDYVSLVLALLGL  483



>ref|XP_009355864.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=534

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 138/177 (78%), Gaps = 6/177 (3%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLLD+DKVS KIV
Sbjct  333  YIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKLLDEDKVSNKIV  392

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+RDEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K+ED   +IN++ KPLA 
Sbjct  393  LGGQRDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEKIEDSFSVINSKPKPLAV  452

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAG------VGESGTGSYHG  243
            Y FT+N++L++ FV N+S+GG+LINDT LH  V  LP         +G  GTG   G
Sbjct  453  YAFTNNEQLKKGFVDNVSSGGMLINDTVLHAMVSRLPDKAEKIQKQIGVLGTGEVEG  509



>ref|XP_006345274.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Solanum 
tuberosum]
Length=495

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 148/226 (65%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  K    +L+  +K+ + K +G++P  S  +SRIVN NHF RL  LLD+  V   ++
Sbjct  267  YILVDKTFVNELVKLIKLGIPKMFGENPKESHSISRIVNRNHFLRLKNLLDEPMVKKSVI  326

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE  L I PT+L+D P  + IM EEIFGPLLPI+T++K+ED I+ INAR KPL  
Sbjct  327  YGGSSDEDNLYIEPTVLLDPPMQSTIMTEEIFGPLLPIITLDKIEDSIEFINARPKPLTI  386

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT N++ +++     S+G L+ NDT +  A  TLPF GVG+SG G YHGKFSF+ FSH
Sbjct  387  YAFTKNEEFKRKITKGTSSGSLVFNDTIIQYAADTLPFGGVGQSGFGRYHGKFSFDTFSH  446

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KA+ +RSF  D+  RYPP++    +L ++    + + I+   LGL
Sbjct  447  EKAIARRSFLTDIWFRYPPWSDHTLQLFKSAFIYDYLSIVLITLGL  492



>gb|KJE97385.1| aldehyde dehydrogenase type III-PG [Capsaspora owczarzaki ATCC 
30864]
Length=511

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 142/214 (66%), Gaps = 6/214 (3%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K+     L+A +  L++FYG DP  S DLSRI+N  H+ RL+ LL     SG + 
Sbjct  255  YVLIDKKLQPAFLEAARAALNEFYGPDPKASPDLSRIINDAHWKRLSALL----TSGTVA  310

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ D     IAPTIL+DVP DA +M+ E+FGP+LPI+ V+ +++ IK I +RDKPLA 
Sbjct  311  IGGQTDAATRYIAPTILVDVPHDAPVMQNEVFGPILPIINVSSIDEAIKFITSRDKPLAT  370

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N KL+ EF+   S+G   +NDT L   VH LPF GVG SG GSYHGK+SFEAFSH
Sbjct  371  YLFTRNSKLQDEFLKRTSSGSTCVNDTILQGGVHGLPFGGVGASGMGSYHGKYSFEAFSH  430

Query  215  KKAVLKRSFGGDL--GARYPPYTPKKARLLRALM  120
             +AV+ ++ G ++    RYPPY+ KK   +  LM
Sbjct  431  LRAVVYKNPGMEIVNTIRYPPYSDKKISWVSWLM  464



>ref|XP_010034275.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=461

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 145/214 (68%), Gaps = 0/214 (0%)
 Frame = -2

Query  719  LDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIVHGGERDEKRLKI  540
            ++ MKV + K +G++P  S+ ++RIVN +HF RL  LL D  V   IV+GG  DE+ L I
Sbjct  237  VELMKVVMKKMFGENPRESRSVARIVNKHHFLRLRSLLLDPLVESSIVYGGSMDEESLFI  296

Query  539  APTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQE  360
             PTILMD P  A IM +EIFGPLLPI+T+NK+ED I+ IN+R KPLA Y+FT ++ L + 
Sbjct  297  EPTILMDPPLQAAIMMDEIFGPLLPIVTLNKIEDSIEFINSRPKPLAIYVFTKDEPLRRS  356

Query  359  FVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGD  180
             V+  S+G ++ ND  +     TLPF G+GESG G YHGKFSF+ FSH+KAV++RSF  D
Sbjct  357  MVSKTSSGSIVFNDAIVQYLADTLPFGGIGESGMGRYHGKFSFDTFSHQKAVVRRSFLVD  416

Query  179  LGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
               R+PP+   K +L R+    + + I+  +LGL
Sbjct  417  FWFRFPPWNDHKLQLFRSSYHYDYLGIVLTVLGL  450



>ref|XP_004486968.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=494

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 148/226 (65%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K  +  L++ MK  + K +G +P  S  ++RIVN  H +R+  LL + KV   +V
Sbjct  257  YVLVEKSFSSTLVELMKEGIKKMFGDNPKASNTIARIVNKKHSNRIKSLLSEPKVKESVV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG  D+  L I PTIL+D P D+ IM EEIF PLLPI+T+ K+EDGIK I ++ KPLA 
Sbjct  317  FGGSMDDDDLFIEPTILLDPPLDSAIMTEEIFAPLLPIITLEKIEDGIKFIKSKPKPLAI  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT +K L++  V+  S+G ++ ND  +  AV TLPF GVGESG G YHGKFSF+ FSH
Sbjct  377  YVFTKSKTLQRRMVSETSSGSIVFNDAIIQYAVDTLPFGGVGESGLGRYHGKFSFDTFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
             KAV +RSF  D   R+PP+T +K +LL    + + I I  A+LGL
Sbjct  437  HKAVARRSFYTDFWFRFPPWTLEKFQLLEEAYNLDYIGIPLAILGL  482



>ref|XP_010045013.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=474

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 139/211 (66%), Gaps = 0/211 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++   + +  LL+ MK  + K  G++P  S+ ++RIVN NHF RL  LL+D  V   IV
Sbjct  243  YVLVETKFSSTLLELMKAWISKMLGENPRESRSMARIVNKNHFFRLKTLLEDPNVKASIV  302

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R KPLA 
Sbjct  303  YGGSMDENSLFIEPTILLDPPLESGLMQDEIFGPLLPIITLKKIEDSINFINSRPKPLAI  362

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT N  L +  V   S+G +  ND  +     TLPF G+GESG G+YHGKFSF+ FSH
Sbjct  363  YVFTHNDSLRKRMVAETSSGSVTFNDAMVQYVADTLPFGGIGESGMGNYHGKFSFDTFSH  422

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
             KAV++RSF  D   R+PP+   K +L R++
Sbjct  423  HKAVVRRSFLVDFWFRFPPWNDHKLQLFRSM  453



>gb|KCW51189.1| hypothetical protein EUGRSUZ_J00776 [Eucalyptus grandis]
Length=479

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 145/215 (67%), Gaps = 0/215 (0%)
 Frame = -2

Query  722  LLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIVHGGERDEKRLK  543
             ++ MKV + K +G++P  S+ ++RIVN +HF RL  LL D  V   IV+GG  DE+ L 
Sbjct  254  FVELMKVVMKKMFGENPRESRSVARIVNKHHFLRLRSLLLDPLVESSIVYGGSMDEESLF  313

Query  542  IAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQ  363
            I PTILMD P  A IM +EIFGPLLPI+T+NK+ED I+ IN+R KPLA Y+FT ++ L +
Sbjct  314  IEPTILMDPPLQAAIMMDEIFGPLLPIVTLNKIEDSIEFINSRPKPLAIYVFTKDEPLRR  373

Query  362  EFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGG  183
              V+  S+G ++ ND  +     TLPF G+GESG G YHGKFSF+ FSH+KAV++RSF  
Sbjct  374  SMVSKTSSGSIVFNDAIVQYLADTLPFGGIGESGMGRYHGKFSFDTFSHQKAVVRRSFLV  433

Query  182  DLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            D   R+PP+   K +L R+    + + I+  +LGL
Sbjct  434  DFWFRFPPWNDHKLQLFRSSYHYDYLGIVLTVLGL  468



>ref|XP_010271510.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nelumbo 
nucifera]
Length=484

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 151/226 (67%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+  ++ A  L+D +K  +D+FYG+     KDL+RIVN +HF RL  L+ D  VS  IV
Sbjct  257  YILVEEKFAPTLIDLLKKSIDQFYGRKAKDFKDLTRIVNRHHFERLHNLIKDPAVSDSIV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG+ D++R+ I PTIL+D P +A IM EEIFGP LPI+T+  +E+ I+ +++R KPL  
Sbjct  317  HGGQVDKERMFIEPTILLDPPLEAEIMTEEIFGPFLPIITLKNIEESIEFVSSRPKPLVL  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT ++ L++  ++  S+G +  ND A+      LPF G+G+SG G YHGKFSFEAF+H
Sbjct  377  YAFTKDETLKRLVLSRTSSGSVTFNDIAVQFMSDDLPFGGIGQSGLGKYHGKFSFEAFTH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAVL+R+F  DL +RYPP++  K   +R L   +   II   LGL
Sbjct  437  EKAVLRRNFIFDLESRYPPWSDFKLNFIRLLYKYDYFGIILLFLGL  482



>gb|KCW87152.1| hypothetical protein EUGRSUZ_B03680 [Eucalyptus grandis]
Length=487

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 139/211 (66%), Gaps = 0/211 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++   + +  LL+ MK  + K  G++P  S+ ++RIVN NHF RL  LL+D  V   IV
Sbjct  256  YVLVETKFSSTLLELMKAWISKMLGENPRESRSMARIVNKNHFFRLKTLLEDPNVKASIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R KPLA 
Sbjct  316  YGGSMDENSLFIEPTILLDPPLESGLMQDEIFGPLLPIITLKKIEDSINFINSRPKPLAI  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT N  L +  V   S+G +  ND  +     TLPF G+GESG G+YHGKFSF+ FSH
Sbjct  376  YVFTHNDSLRKRMVAETSSGSVTFNDAMVQYVADTLPFGGIGESGMGNYHGKFSFDTFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
             KAV++RSF  D   R+PP+   K +L R++
Sbjct  436  HKAVVRRSFLVDFWFRFPPWNDHKLQLFRSM  466



>ref|XP_004343114.1| aldehyde dehydrogenase type III-PG [Capsaspora owczarzaki ATCC 
30864]
Length=540

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 142/214 (66%), Gaps = 6/214 (3%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K+     L+A +  L++FYG DP  S DLSRI+N  H+ RL+ LL     SG + 
Sbjct  284  YVLIDKKLQPAFLEAARAALNEFYGPDPKASPDLSRIINDAHWKRLSALL----TSGTVA  339

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ D     IAPTIL+DVP DA +M+ E+FGP+LPI+ V+ +++ IK I +RDKPLA 
Sbjct  340  IGGQTDAATRYIAPTILVDVPHDAPVMQNEVFGPILPIINVSSIDEAIKFITSRDKPLAT  399

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLFT N KL+ EF+   S+G   +NDT L   VH LPF GVG SG GSYHGK+SFEAFSH
Sbjct  400  YLFTRNSKLQDEFLKRTSSGSTCVNDTILQGGVHGLPFGGVGASGMGSYHGKYSFEAFSH  459

Query  215  KKAVLKRSFGGDL--GARYPPYTPKKARLLRALM  120
             +AV+ ++ G ++    RYPPY+ KK   +  LM
Sbjct  460  LRAVVYKNPGMEIVNTIRYPPYSDKKISWVSWLM  493



>gb|EAZ31491.1| hypothetical protein OsJ_15627 [Oryza sativa Japonica Group]
Length=363

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 139/226 (62%), Gaps = 4/226 (2%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  +     L+ A+K  L KF+      S  ++RIVN+ HF RL+ LL D  V+  ++
Sbjct  140  YVLVEERFVPVLIKALKSTLKKFFAD----SDHMARIVNARHFQRLSDLLKDKSVAASVL  195

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG  D K L I PTIL++ P D+ IM EEIFGPLLPI+TV K+ED I  + AR +PLA 
Sbjct  196  HGGTLDAKNLCIEPTILLNPPLDSAIMTEEIFGPLLPIITVKKIEDSIAFVRARPRPLAV  255

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT N  L +  V   S+G +  ND  +   + +LPF GVGESG G YHGK+SFE FSH
Sbjct  256  YAFTKNAALRRRIVEETSSGSVTFNDAVVQYGIDSLPFGGVGESGFGQYHGKYSFEMFSH  315

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            KKAVL R +  +L ARYPP+   K  ++R L   N +  +   LGL
Sbjct  316  KKAVLTRGYLIELTARYPPWDDSKISMMRQLYRYNYVGFVLTFLGL  361



>ref|XP_004502484.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Cicer arietinum]
Length=422

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YIITTK+ A  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF+RL KL+D+DKVS KIV
Sbjct  262  YIITTKDFAPLLVDALKTELENFFGKNPLESNDLSRIVSSNHFNRLIKLMDEDKVSDKIV  321

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG +DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK+E+   +IN+  KPLAA
Sbjct  322  YGGAKDESKLRIAPTILLDVPRDSLIMSEEIFGPLLPIITVNKLEESFDVINSGTKPLAA  381

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHV  303
            YLFT++ K +++FV  +SAGGLLINDT LHV
Sbjct  382  YLFTNDNKFKEQFVKKVSAGGLLINDTVLHV  412



>ref|XP_010102335.1| Aldehyde dehydrogenase family 3 member F1 [Morus notabilis]
 gb|EXB93296.1| Aldehyde dehydrogenase family 3 member F1 [Morus notabilis]
Length=491

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 147/226 (65%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K+   + ++ MK    K +G++P  +  ++RIVN  HF RL  LLDD  V   IV
Sbjct  256  YVLVEKKFLPKAVELMKAITTKMFGENPRETNTVARIVNRRHFLRLKNLLDDPTVKASIV  315

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG+ DE+ L I PTIL+D P +A IM EEIFGPLLPI+T+  +ED I+ I AR +PL  
Sbjct  316  YGGKTDEENLFIEPTILVDPPLEAEIMTEEIFGPLLPIITLENIEDSIEFIKARPRPLTI  375

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT +K LE++ V+  S+G L+ ND  +  A  T+PF GVGESG G YHGKFSF+ FSH
Sbjct  376  YAFTKSKTLERKLVSETSSGSLVFNDAIIQYAADTIPFGGVGESGIGRYHGKFSFDTFSH  435

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAV +RSF  D   R+PP+   K +L R   + + + +I  +LGL
Sbjct  436  EKAVARRSFLVDFWFRFPPWNDYKLQLFREAYNFDYLGVIFVVLGL  481



>gb|KCW51186.1| hypothetical protein EUGRSUZ_J00772 [Eucalyptus grandis]
Length=495

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 154/226 (68%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K+ +  L++ MK+ + K +G++P  S+ ++RIVN +HF RL  LL D  V   IV
Sbjct  260  YVLVEKKFSSSLVELMKMMMKKMFGENPRESQSVARIVNKHHFLRLRSLLLDPLVKSSIV  319

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L I PTILMD P  A IM +EIFGPLLPI+T+NK+ED I+ IN+R KPLA 
Sbjct  320  YGGSMDEESLFIEPTILMDPPLQAAIMMDEIFGPLLPIVTLNKIEDSIEFINSRPKPLAI  379

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT ++ L +  V+  S+G ++ ND  +   V TLPF G+GESG G YHGKFSF+ FSH
Sbjct  380  YVFTKDEPLRRSMVSKTSSGSIVFNDAIVQCLVDTLPFGGIGESGMGRYHGKFSFDTFSH  439

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAV++RSF  D+  R+PP+   K +L R+    + + I+  +LGL
Sbjct  440  QKAVMRRSFLVDVWFRFPPWNDHKLQLFRSSYHYDYLGIVLTVLGL  485



>ref|XP_008449722.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cucumis 
melo]
Length=481

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 147/226 (65%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            YI+   +    L++ +K  + KF+ K    +K+++RIVN  +F RL  ++D+  V   I+
Sbjct  253  YILVEHKFISTLVELLKKYIKKFFDKGSNEAKNMARIVNKQNFLRLKNMVDEPAVQATII  312

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE +L + PTIL++ P DA IM+EEIFGP+LPI+ ++K+ED I  IN+R KPLA 
Sbjct  313  YGGSMDEDKLFVEPTILLNPPNDAEIMREEIFGPILPIIGMDKIEDSIDFINSRAKPLAI  372

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT +K  ++  V+  ++G L  ND  +  AV TLPF GVGESG G YHGKFSF+ FSH
Sbjct  373  YAFTKDKAFQRRLVSETTSGSLTFNDAIIQYAVDTLPFGGVGESGIGRYHGKFSFDTFSH  432

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAV+KRSF  D   RYPP+   K  LLR   + N   ++  +LGL
Sbjct  433  EKAVVKRSFLIDFWFRYPPWNNHKLELLRHAYNFNYFQLVLTVLGL  478



>ref|XP_010034106.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=503

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 154/226 (68%), Gaps = 0/226 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K+ +  L++ MK+ + K +G++P  S+ ++RIVN +HF RL  LL D  V   IV
Sbjct  268  YVLVEKKFSSSLVELMKMMMKKMFGENPRESQSVARIVNKHHFLRLRSLLLDPLVKSSIV  327

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  DE+ L I PTILMD P  A IM +EIFGPLLPI+T+NK+ED I+ IN+R KPLA 
Sbjct  328  YGGSMDEESLFIEPTILMDPPLQAAIMMDEIFGPLLPIVTLNKIEDSIEFINSRPKPLAI  387

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y+FT ++ L +  V+  S+G ++ ND  +   V TLPF G+GESG G YHGKFSF+ FSH
Sbjct  388  YVFTKDEPLRRSMVSKTSSGSIVFNDAIVQCLVDTLPFGGIGESGMGRYHGKFSFDTFSH  447

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +KAV++RSF  D+  R+PP+   K +L R+    + + I+  +LGL
Sbjct  448  QKAVMRRSFLVDVWFRFPPWNDHKLQLFRSSYHYDYLGIVLTVLGL  493



>gb|KFM72617.1| Aldehyde dehydrogenase, dimeric NADP-preferring, partial [Stegodyphus 
mimosarum]
Length=523

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 146/217 (67%), Gaps = 8/217 (4%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++ +K+   + +   K  L +F+G DP  S DL+RIVN+ HF R+ K L      GKI 
Sbjct  269  YVLCSKKTEKKFIQIAKRVLLEFFGDDPEASPDLARIVNAEHFERVIKFLS----CGKIA  324

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
             GG+ D K   IAPTIL DV ED  +M+EEIFGP+LPI+TVN  E+ I  IN R+KPL  
Sbjct  325  VGGDYDPKEKYIAPTILTDVKEDDCVMQEEIFGPILPIITVNSPEEAINFINKREKPLTL  384

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            YLF SNKK+   F+++ S+G + +NDT +H++V  LPF GVG SG G+Y GK+SF+ FSH
Sbjct  385  YLFASNKKVLDMFLSSTSSGSMCVNDTMVHLSVDALPFGGVGMSGMGTYQGKYSFDTFSH  444

Query  215  KKAVLKR---SFGGDLG-ARYPPYTPKKARLLRALMS  117
            K++VL+R   SFG  +G ARYPPY   K ++L+  +S
Sbjct  445  KRSVLERSLSSFGEYMGKARYPPYNNNKIKILKMFLS  481



>ref|XP_007150367.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
 gb|ESW22361.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
Length=490

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 138/209 (66%), Gaps = 0/209 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y++  K  +  L+  MK  + K +G++P  S  ++RIVN  HF RL  LL D +V   +V
Sbjct  257  YVLVEKSFSSTLVTLMKAGIKKMFGENPKESNTVARIVNHKHFMRLKNLLTDPRVKDSVV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            +GG  +EK L I PTIL++ P D+ IM +EIFGP+LPI+TV K+ED I+ IN+R KPLA 
Sbjct  317  YGGSMNEKDLFIEPTILLNPPLDSPIMADEIFGPVLPIITVEKIEDSIEFINSRPKPLAI  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT NK L +  ++  S+G L+ ND  L   V TLPF GVGE G G YHGKFSF+AFSH
Sbjct  377  YAFTKNKTLHKRLLSETSSGSLVFNDAILQYVVDTLPFGGVGECGFGKYHGKFSFDAFSH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLR  129
             KAV +RS+  D   R+PP+T  K +LL 
Sbjct  437  HKAVARRSYFTDFWYRFPPWTLNKLQLLE  465



>ref|XP_010555061.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X1 [Tarenaya hassleriana]
Length=488

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 141/211 (67%), Gaps = 0/211 (0%)
 Frame = -2

Query  755  YIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIV  576
            Y +  K  A  L++ MK  + K +G++P  S  + RI ++N FSRL +LLDD ++   +V
Sbjct  257  YALVEKGYAPTLIEVMKGSIKKMFGENPRKSSTVGRISHTNCFSRLKRLLDDKRIRECVV  316

Query  575  HGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAA  396
            HGG  D++ + I PTIL+D P D+ IM EEIFGPLLPI+T+ K++D I+ IN+R KPLA 
Sbjct  317  HGGSVDDETMFIEPTILLDPPLDSEIMTEEIFGPLLPIITLEKIQDSIEFINSRPKPLAI  376

Query  395  YLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFAGVGESGTGSYHGKFSFEAFSH  216
            Y FT ++K  +   +  ++G L+ ND  +  A  TLPF G+GESG G YHGK+SFEAF+H
Sbjct  377  YAFTKDEKFRKRLASETTSGSLVFNDAIIQYAADTLPFGGIGESGMGKYHGKYSFEAFTH  436

Query  215  KKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
             KA+++RSF  D   R+PP+   K +L R +
Sbjct  437  YKAIVRRSFLTDFWFRFPPWNDHKLQLFRTV  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260