BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002A22

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADV02778.1|  actin depolymerizing factor 1                           280   2e-92   Ipomoea batatas [batate]
ref|XP_002533101.1|  actin depolymerizing factor, putative              277   2e-91   Ricinus communis
ref|XP_002273958.2|  PREDICTED: actin-depolymerizing factor 1-like      277   1e-90   Vitis vinifera
ref|XP_011094831.1|  PREDICTED: actin-depolymerizing factor 1 iso...    275   2e-90   Sesamum indicum [beniseed]
gb|KHG06644.1|  Actin-depolymerizing factor 1                           274   3e-90   Gossypium arboreum [tree cotton]
ref|XP_010529845.1|  PREDICTED: actin-depolymerizing factor 2-like      273   7e-90   Tarenaya hassleriana [spider flower]
ref|XP_007016496.1|  Actin depolymerizing factor 4                      273   7e-90   Theobroma cacao [chocolate]
ref|XP_010047513.1|  PREDICTED: actin-depolymerizing factor 2           273   8e-90   Eucalyptus grandis [rose gum]
ref|XP_002284292.1|  PREDICTED: actin-depolymerizing factor 2           273   1e-89   Vitis vinifera
gb|KDP35600.1|  hypothetical protein JCGZ_09038                         273   1e-89   Jatropha curcas
gb|KJB20158.1|  hypothetical protein B456_003G135600                    272   2e-89   Gossypium raimondii
gb|KHG23104.1|  Actin-depolymerizing factor 1                           272   3e-89   Gossypium arboreum [tree cotton]
ref|XP_009586917.1|  PREDICTED: actin-depolymerizing factor 1           271   3e-89   Nicotiana tomentosiformis
ref|XP_011094830.1|  PREDICTED: actin-depolymerizing factor 1 iso...    272   4e-89   Sesamum indicum [beniseed]
ref|XP_010253266.1|  PREDICTED: actin-depolymerizing factor 2           271   8e-89   Nelumbo nucifera [Indian lotus]
gb|ACB32233.1|  actin-depolymerizing factor 1                           270   1e-88   Solanum chacoense
ref|XP_011077447.1|  PREDICTED: actin-depolymerizing factor 1-like      271   1e-88   Sesamum indicum [beniseed]
gb|EYU26572.1|  hypothetical protein MIMGU_mgv1a015955mg                270   1e-88   Erythranthe guttata [common monkey flower]
ref|XP_010553292.1|  PREDICTED: actin-depolymerizing factor 1           270   1e-88   Tarenaya hassleriana [spider flower]
ref|XP_004246462.1|  PREDICTED: actin-depolymerizing factor 1           270   2e-88   Solanum lycopersicum
ref|XP_010260094.1|  PREDICTED: actin-depolymerizing factor 2-like      270   2e-88   Nelumbo nucifera [Indian lotus]
ref|XP_006341057.1|  PREDICTED: actin-depolymerizing factor 1-like      269   3e-88   Solanum tuberosum [potatoes]
ref|XP_010535543.1|  PREDICTED: actin-depolymerizing factor 4           268   7e-88   Tarenaya hassleriana [spider flower]
ref|XP_002299887.1|  hypothetical protein POPTR_0001s24330g             268   7e-88   Populus trichocarpa [western balsam poplar]
emb|CDP06641.1|  unnamed protein product                                269   9e-88   Coffea canephora [robusta coffee]
ref|XP_011042674.1|  PREDICTED: actin-depolymerizing factor 2-lik...    268   1e-87   Populus euphratica
gb|KDP29838.1|  hypothetical protein JCGZ_18413                         268   1e-87   Jatropha curcas
ref|XP_002314194.1|  actin-depolymerizing factor 3 family protein       267   2e-87   Populus trichocarpa [western balsam poplar]
gb|ADI78873.1|  actin-depolymerizing factor                             266   4e-87   Hevea brasiliensis [jebe]
emb|CAL25339.1|  actin-depolymerizing factor                            265   1e-86   Platanus x hispanica [London plane tree]
ref|XP_008463478.1|  PREDICTED: actin-depolymerizing factor 2 iso...    265   2e-86   Cucumis melo [Oriental melon]
ref|XP_004249528.1|  PREDICTED: actin-depolymerizing factor 1-like      265   2e-86   Solanum lycopersicum
ref|XP_011000294.1|  PREDICTED: actin-depolymerizing factor 2-like      265   2e-86   Populus euphratica
ref|NP_001238519.1|  uncharacterized protein LOC100499953               264   2e-86   Glycine max [soybeans]
gb|ADV04049.1|  actin depolymerizing factor 4                           264   3e-86   Hevea brasiliensis [jebe]
sp|Q9FVI2.1|ADF1_PETHY  RecName: Full=Actin-depolymerizing factor...    264   3e-86   Petunia x hybrida [garden petunia]
emb|CBI31711.3|  unnamed protein product                                266   3e-86   Vitis vinifera
emb|CAJ38388.1|  actin-depolymerizing factor                            264   3e-86   Plantago major [cart-track plant]
ref|XP_010920670.1|  PREDICTED: actin-depolymerizing factor 7           264   4e-86   Elaeis guineensis
ref|XP_002314195.1|  actin-depolymerizing factor family protein         264   4e-86   Populus trichocarpa [western balsam poplar]
ref|XP_002284029.1|  PREDICTED: actin-depolymerizing factor 2-lik...    264   4e-86   Vitis vinifera
ref|XP_011016059.1|  PREDICTED: actin-depolymerizing factor 2-like      263   5e-86   Populus euphratica
ref|XP_007218573.1|  hypothetical protein PRUPE_ppa013105mg             263   5e-86   Prunus persica
ref|XP_002299888.1|  actin-depolymerizing factor family protein         263   6e-86   Populus trichocarpa [western balsam poplar]
ref|XP_011027144.1|  PREDICTED: actin-depolymerizing factor 1-like      263   6e-86   Populus euphratica
gb|ABD66504.1|  actin depolymerizing factor 8                           263   7e-86   Gossypium hirsutum [American cotton]
ref|XP_007144457.1|  hypothetical protein PHAVU_007G157800g             263   9e-86   Phaseolus vulgaris [French bean]
ref|XP_004142738.1|  PREDICTED: actin-depolymerizing factor 2-like      263   1e-85   Cucumis sativus [cucumbers]
gb|ABX79380.1|  actin-depolymerizing factor                             263   1e-85   Gossypium barbadense [Egyptian cotton]
ref|XP_006424770.1|  hypothetical protein CICLE_v10029538mg             263   1e-85   Citrus clementina [clementine]
ref|XP_006339034.1|  PREDICTED: actin-depolymerizing factor 1-like      263   1e-85   Solanum tuberosum [potatoes]
gb|KJB78849.1|  hypothetical protein B456_013G022900                    262   1e-85   Gossypium raimondii
gb|EPS63340.1|  hypothetical protein M569_11446                         262   2e-85   Genlisea aurea
ref|XP_010031001.1|  PREDICTED: actin-depolymerizing factor 2-like      262   2e-85   Eucalyptus grandis [rose gum]
gb|AEJ88268.1|  putative actin-depolymerizing factor                    262   2e-85   Wolffia arrhiza
ref|XP_002311154.2|  hypothetical protein POPTR_0008s05210g             265   2e-85   
ref|XP_008788089.1|  PREDICTED: actin-depolymerizing factor 7-like      262   2e-85   Phoenix dactylifera
gb|KHN48988.1|  Actin-depolymerizing factor 2                           263   2e-85   Glycine soja [wild soybean]
ref|XP_006418975.1|  hypothetical protein EUTSA_v10002704mg             262   2e-85   Eutrema salsugineum [saltwater cress]
gb|ABK94603.1|  unknown                                                 262   2e-85   Populus trichocarpa [western balsam poplar]
ref|XP_007027090.1|  Actin depolymerizing factor 4 isoform 2            263   2e-85   
ref|XP_010543331.1|  PREDICTED: actin-depolymerizing factor 1-like      261   3e-85   
ref|XP_006436042.1|  hypothetical protein CICLE_v10033029mg             261   3e-85   Citrus clementina [clementine]
gb|ABD63906.1|  actin depolymerizing factor 2                           261   3e-85   Gossypium hirsutum [American cotton]
gb|AEZ00870.1|  putative actin depolymerizing factor protein            263   4e-85   Elaeis guineensis
ref|XP_010909358.1|  PREDICTED: actin-depolymerizing factor 7-like      261   5e-85   Elaeis guineensis
ref|NP_851228.1|  actin depolymerizing factor 4                         261   5e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002316301.1|  actin-depolymerizing factor family protein         261   6e-85   Populus trichocarpa [western balsam poplar]
ref|XP_006281292.1|  hypothetical protein CARUB_v10027342mg             260   8e-85   Capsella rubella
emb|CDX88731.1|  BnaA03g09180D                                          263   8e-85   
ref|XP_009126640.1|  PREDICTED: actin-depolymerizing factor 4 iso...    260   9e-85   Brassica rapa
ref|XP_008776502.1|  PREDICTED: actin-depolymerizing factor 7           260   9e-85   Phoenix dactylifera
ref|XP_006424771.1|  hypothetical protein CICLE_v10029538mg             260   9e-85   
ref|NP_001236448.1|  uncharacterized protein LOC100305514               260   1e-84   Glycine max [soybeans]
ref|XP_010937681.1|  PREDICTED: actin-depolymerizing factor 7-like      260   1e-84   Elaeis guineensis
ref|XP_006400899.1|  hypothetical protein EUTSA_v10014975mg             260   1e-84   Eutrema salsugineum [saltwater cress]
gb|ABD66505.1|  actin depolymerizing factor 3                           260   1e-84   Gossypium hirsutum [American cotton]
ref|XP_007206123.1|  hypothetical protein PRUPE_ppa013110mg             260   1e-84   Prunus persica
gb|KGN58886.1|  hypothetical protein Csa_3G734880                       259   2e-84   Cucumis sativus [cucumbers]
gb|KJB78850.1|  hypothetical protein B456_013G022900                    260   2e-84   Gossypium raimondii
ref|XP_010455715.1|  PREDICTED: actin-depolymerizing factor 4           259   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010514926.1|  PREDICTED: actin-depolymerizing factor 1           259   2e-84   Camelina sativa [gold-of-pleasure]
ref|NP_190187.1|  actin depolymerizing factor 1                         259   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418976.1|  hypothetical protein EUTSA_v10002704mg             259   3e-84   
gb|KDP44204.1|  hypothetical protein JCGZ_05671                         259   3e-84   Jatropha curcas
ref|XP_009131962.1|  PREDICTED: actin-depolymerizing factor 3           259   3e-84   
ref|XP_006586815.1|  PREDICTED: actin-depolymerizing factor 2-like      259   3e-84   Glycine max [soybeans]
gb|AFK48761.1|  unknown                                                 259   4e-84   Lotus japonicus
gb|ABD66508.1|  actin depolymerizing factor 6                           259   4e-84   Gossypium hirsutum [American cotton]
ref|XP_010922979.1|  PREDICTED: actin-depolymerizing factor 7-like      263   4e-84   
emb|CDY09242.1|  BnaA02g06680D                                          259   4e-84   Brassica napus [oilseed rape]
ref|XP_004142080.1|  PREDICTED: actin-depolymerizing factor 1-like      258   8e-84   Cucumis sativus [cucumbers]
ref|XP_004294586.1|  PREDICTED: actin-depolymerizing factor 2           258   8e-84   Fragaria vesca subsp. vesca
ref|XP_010528350.1|  PREDICTED: actin-depolymerizing factor 1-like      258   8e-84   
ref|XP_010096647.1|  Actin-depolymerizing factor 2                      258   8e-84   
ref|XP_009593022.1|  PREDICTED: actin-depolymerizing factor 2-like      258   9e-84   Nicotiana tomentosiformis
ref|NP_001078247.1|  actin depolymerizing factor 1                      258   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426028.1|  PREDICTED: actin-depolymerizing factor 1-like      258   1e-83   Camelina sativa [gold-of-pleasure]
ref|XP_008442569.1|  PREDICTED: actin-depolymerizing factor 2-like      257   1e-83   Cucumis melo [Oriental melon]
emb|CBI16177.3|  unnamed protein product                                257   1e-83   Vitis vinifera
ref|XP_004307556.2|  PREDICTED: uncharacterized protein LOC101301142    268   1e-83   Fragaria vesca subsp. vesca
gb|EYU36258.1|  hypothetical protein MIMGU_mgv1a015971mg                257   1e-83   Erythranthe guttata [common monkey flower]
ref|XP_004236758.1|  PREDICTED: actin-depolymerizing factor 2           257   1e-83   Solanum lycopersicum
gb|KCW50259.1|  hypothetical protein EUGRSUZ_J00048                     257   2e-83   Eucalyptus grandis [rose gum]
gb|KFK27528.1|  hypothetical protein AALP_AA8G395200                    257   2e-83   Arabis alpina [alpine rockcress]
ref|XP_009131961.1|  PREDICTED: actin-depolymerizing factor 4-like      257   2e-83   Brassica rapa
ref|XP_010669849.1|  PREDICTED: actin-depolymerizing factor 4-like      257   2e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004172071.1|  PREDICTED: actin-depolymerizing factor 1-like      256   2e-83   
ref|XP_006365713.1|  PREDICTED: actin-depolymerizing factor 2-like      257   3e-83   Solanum tuberosum [potatoes]
ref|XP_010503215.1|  PREDICTED: actin-depolymerizing factor 1-like      256   3e-83   Camelina sativa [gold-of-pleasure]
gb|KHN05922.1|  Actin-depolymerizing factor 2                           256   3e-83   Glycine soja [wild soybean]
emb|CDX71068.1|  BnaC03g11520D                                          257   3e-83   
emb|CDX88730.1|  BnaA03g09190D                                          256   4e-83   
ref|XP_009406977.1|  PREDICTED: actin-depolymerizing factor 2 iso...    256   4e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009600590.1|  PREDICTED: actin-depolymerizing factor 2           256   5e-83   Nicotiana tomentosiformis
ref|XP_009419950.1|  PREDICTED: actin-depolymerizing factor 4           256   6e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008447631.1|  PREDICTED: actin-depolymerizing factor 1-like      256   6e-83   Cucumis melo [Oriental melon]
gb|AAD09110.1|  actin depolymerizing factor 4                           255   7e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010031003.1|  PREDICTED: actin-depolymerizing factor 2-like      255   8e-83   Eucalyptus grandis [rose gum]
gb|EYU18949.1|  hypothetical protein MIMGU_mgv1a015984mg                255   1e-82   Erythranthe guttata [common monkey flower]
sp|Q9FVI1.1|ADF2_PETHY  RecName: Full=Actin-depolymerizing factor...    255   1e-82   Petunia x hybrida [garden petunia]
ref|XP_002528457.1|  actin depolymerizing factor, putative              254   1e-82   Ricinus communis
ref|XP_010669850.1|  PREDICTED: actin-depolymerizing factor 4           254   2e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009416252.1|  PREDICTED: actin-depolymerizing factor 7-like      254   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006292022.1|  hypothetical protein CARUB_v10018211mg             254   2e-82   Capsella rubella
ref|XP_009420088.1|  PREDICTED: actin-depolymerizing factor 7-like      254   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP09013.1|  unnamed protein product                                254   2e-82   Coffea canephora [robusta coffee]
ref|XP_009388628.1|  PREDICTED: actin-depolymerizing factor 7           254   3e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406976.1|  PREDICTED: actin-depolymerizing factor 7 iso...    254   4e-82   
ref|XP_009421345.1|  PREDICTED: actin-depolymerizing factor 7-like      253   5e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010111772.1|  Actin-depolymerizing factor 1                      253   6e-82   
ref|XP_003594440.1|  Actin depolymerizing factor                        253   7e-82   Medicago truncatula
ref|XP_004495011.1|  PREDICTED: actin-depolymerizing factor 2-like      253   8e-82   Cicer arietinum [garbanzo]
ref|XP_007009413.1|  Actin depolymerizing factor 4 isoform 1            263   1e-81   
ref|XP_008343560.1|  PREDICTED: actin-depolymerizing factor 1           252   1e-81   Malus domestica [apple tree]
ref|XP_009404611.1|  PREDICTED: actin-depolymerizing factor 7-like      252   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX80216.1|  BnaC09g35260D                                          256   2e-81   
ref|XP_009120511.1|  PREDICTED: actin-depolymerizing factor 3-like      252   2e-81   Brassica rapa
gb|EPS73519.1|  actin-depolymerizing factor                             252   2e-81   Genlisea aurea
ref|XP_009353719.1|  PREDICTED: actin-depolymerizing factor 1-like      252   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_009357677.1|  PREDICTED: actin-depolymerizing factor 1           252   2e-81   Pyrus x bretschneideri [bai li]
emb|CAJ38384.1|  actin-depolymerizing factor                            251   3e-81   Plantago major [cart-track plant]
ref|XP_006846080.1|  hypothetical protein AMTR_s00012p00089320          251   4e-81   Amborella trichopoda
ref|XP_009775372.1|  PREDICTED: actin-depolymerizing factor 2-like      251   5e-81   Nicotiana sylvestris
ref|XP_007027089.1|  Actin depolymerizing factor 4 isoform 1            253   5e-81   
gb|AFK42408.1|  unknown                                                 250   9e-81   Lotus japonicus
ref|XP_008233662.1|  PREDICTED: uncharacterized protein LOC103332693    263   1e-80   
ref|XP_006476590.1|  PREDICTED: actin-depolymerizing factor 1-like      250   1e-80   
gb|ACJ84098.1|  unknown                                                 250   1e-80   Medicago truncatula
gb|KJB76068.1|  hypothetical protein B456_012G069600                    249   1e-80   Gossypium raimondii
ref|XP_009358343.1|  PREDICTED: actin-depolymerizing factor 1-like      249   2e-80   Pyrus x bretschneideri [bai li]
gb|ABC49719.1|  actin depolymerizing factor-like protein                249   2e-80   Arachis hypogaea [goober]
ref|XP_008357628.1|  PREDICTED: actin-depolymerizing factor 1-like      249   2e-80   Malus domestica [apple tree]
ref|XP_008244913.1|  PREDICTED: actin-depolymerizing factor 10          249   3e-80   Prunus mume [ume]
ref|XP_009337572.1|  PREDICTED: actin-depolymerizing factor 1-like      249   3e-80   Pyrus x bretschneideri [bai li]
ref|XP_007218574.1|  hypothetical protein PRUPE_ppa013108mg             249   3e-80   Prunus persica
ref|XP_009612959.1|  PREDICTED: actin-depolymerizing factor 2-like      249   3e-80   Nicotiana tomentosiformis
ref|XP_008369858.1|  PREDICTED: actin-depolymerizing factor 2-like      248   5e-80   Malus domestica [apple tree]
ref|XP_008385227.1|  PREDICTED: actin-depolymerizing factor 1-like      248   7e-80   
ref|XP_003637508.1|  Actin-depolymerizing factor                        247   1e-79   
ref|XP_010558792.1|  PREDICTED: actin-depolymerizing factor 2-lik...    247   1e-79   Tarenaya hassleriana [spider flower]
gb|KCW50261.1|  hypothetical protein EUGRSUZ_J00048                     246   2e-79   Eucalyptus grandis [rose gum]
ref|XP_004486422.1|  PREDICTED: actin-depolymerizing factor 2-like      247   2e-79   Cicer arietinum [garbanzo]
ref|XP_006436041.1|  hypothetical protein CICLE_v10033029mg             246   3e-79   
ref|XP_007147534.1|  hypothetical protein PHAVU_006G132700g             246   3e-79   Phaseolus vulgaris [French bean]
ref|XP_004306801.2|  PREDICTED: actin-depolymerizing factor 10 is...    246   4e-79   Fragaria vesca subsp. vesca
ref|XP_006439576.1|  hypothetical protein CICLE_v10023304mg             246   4e-79   Citrus clementina [clementine]
ref|NP_568916.2|  actin depolymerizing factor 4                         245   6e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27529.1|  hypothetical protein AALP_AA8G395300                    245   6e-79   Arabis alpina [alpine rockcress]
gb|ACJ84058.1|  unknown                                                 245   7e-79   Medicago truncatula
ref|XP_009374667.1|  PREDICTED: actin-depolymerizing factor 2-lik...    245   7e-79   Pyrus x bretschneideri [bai li]
ref|XP_007206122.1|  hypothetical protein PRUPE_ppa013109mg             245   8e-79   Prunus persica
gb|EPS60626.1|  hypothetical protein M569_14175                         246   8e-79   Genlisea aurea
ref|XP_002271495.1|  PREDICTED: actin-depolymerizing factor 10          245   1e-78   Vitis vinifera
ref|XP_003629907.1|  Actin depolymerizing factor-like protein           244   1e-78   Medicago truncatula
ref|XP_002877448.1|  hypothetical protein ARALYDRAFT_484979             244   1e-78   
ref|XP_002468086.1|  hypothetical protein SORBIDRAFT_01g039300          244   2e-78   Sorghum bicolor [broomcorn]
ref|XP_002864657.1|  hypothetical protein ARALYDRAFT_332260             244   2e-78   
ref|XP_008371032.1|  PREDICTED: actin-depolymerizing factor 1           244   2e-78   
ref|XP_008393892.1|  PREDICTED: actin-depolymerizing factor 1           244   3e-78   Malus domestica [apple tree]
ref|XP_008387742.1|  PREDICTED: actin-depolymerizing factor 2-like      244   4e-78   
ref|NP_566882.1|  actin depolymerizing factor 2                         243   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851227.1|  actin depolymerizing factor 3                         243   7e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503214.1|  PREDICTED: actin-depolymerizing factor 2           242   1e-77   Camelina sativa [gold-of-pleasure]
emb|CDX71067.1|  BnaC03g11510D                                          242   1e-77   
gb|KFK33962.1|  hypothetical protein AALP_AA5G084200                    242   1e-77   Arabis alpina [alpine rockcress]
ref|XP_010534301.1|  PREDICTED: actin-depolymerizing factor 1-like      242   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_009150048.1|  PREDICTED: actin-depolymerizing factor 2           242   1e-77   Brassica rapa
ref|XP_006843593.1|  hypothetical protein AMTR_s00007p00126220          242   1e-77   Amborella trichopoda
ref|XP_008457551.1|  PREDICTED: actin-depolymerizing factor 2           242   1e-77   Cucumis melo [Oriental melon]
ref|XP_006292028.1|  hypothetical protein CARUB_v10018217mg             242   1e-77   Capsella rubella
gb|AFK39900.1|  unknown                                                 242   2e-77   Lotus japonicus
ref|XP_004504229.1|  PREDICTED: actin-depolymerizing factor 2-like      242   2e-77   Cicer arietinum [garbanzo]
ref|XP_010455704.1|  PREDICTED: actin-depolymerizing factor 3           241   3e-77   Camelina sativa [gold-of-pleasure]
gb|AAR23800.1|  putative actin-depolymerizing factor 2                  241   3e-77   Helianthus annuus
emb|CBI40336.3|  unnamed protein product                                245   4e-77   Vitis vinifera
ref|XP_010514925.1|  PREDICTED: actin-depolymerizing factor 2-like      241   4e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010662752.1|  PREDICTED: actin-depolymerizing factor 1           241   4e-77   Vitis vinifera
emb|CDX99133.1|  BnaA06g18240D                                          241   5e-77   
gb|KDO76170.1|  hypothetical protein CISIN_1g046281mg                   240   5e-77   Citrus sinensis [apfelsine]
gb|KCW50264.1|  hypothetical protein EUGRSUZ_J00048                     240   6e-77   Eucalyptus grandis [rose gum]
ref|XP_010426027.1|  PREDICTED: actin-depolymerizing factor 2-like      240   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010249803.1|  PREDICTED: actin-depolymerizing factor             240   7e-77   Nelumbo nucifera [Indian lotus]
ref|XP_006281290.1|  hypothetical protein CARUB_v10027340mg             240   7e-77   Capsella rubella
emb|CDY31586.1|  BnaA10g12850D                                          240   7e-77   Brassica napus [oilseed rape]
ref|XP_004149045.1|  PREDICTED: actin-depolymerizing factor 2-lik...    240   1e-76   Cucumis sativus [cucumbers]
ref|XP_004953378.1|  PREDICTED: actin-depolymerizing factor 1-like      240   1e-76   Setaria italica
ref|XP_006418977.1|  hypothetical protein EUTSA_v10002714mg             239   1e-76   Eutrema salsugineum [saltwater cress]
ref|XP_004984753.1|  PREDICTED: actin-depolymerizing factor 7-lik...    239   1e-76   Setaria italica
ref|XP_006367965.1|  PREDICTED: actin-depolymerizing factor 2-like      239   1e-76   Solanum tuberosum [potatoes]
emb|CDX86048.1|  BnaC03g55630D                                          240   2e-76   
ref|XP_011080987.1|  PREDICTED: actin-depolymerizing factor-like        239   2e-76   Sesamum indicum [beniseed]
ref|XP_008438059.1|  PREDICTED: actin-depolymerizing factor 7-like      239   2e-76   
ref|XP_010053689.1|  PREDICTED: actin-depolymerizing factor             239   2e-76   Eucalyptus grandis [rose gum]
ref|XP_002439159.1|  hypothetical protein SORBIDRAFT_09g001500          238   3e-76   Sorghum bicolor [broomcorn]
ref|XP_003524462.1|  PREDICTED: actin-depolymerizing factor 7-like      239   4e-76   Glycine max [soybeans]
ref|XP_011029243.1|  PREDICTED: actin-depolymerizing factor isofo...    238   4e-76   Populus euphratica
gb|AET05009.2|  cofilin/actin-depolymerizing factor-like protein        238   6e-76   Medicago truncatula
gb|KDP25456.1|  hypothetical protein JCGZ_20612                         238   8e-76   Jatropha curcas
emb|CDP00056.1|  unnamed protein product                                237   9e-76   Coffea canephora [robusta coffee]
ref|XP_008794195.1|  PREDICTED: actin-depolymerizing factor-like        237   1e-75   Phoenix dactylifera
ref|XP_004240732.1|  PREDICTED: actin-depolymerizing factor 7           237   1e-75   Solanum lycopersicum
ref|XP_004503768.1|  PREDICTED: actin-depolymerizing factor 7-like      237   1e-75   Cicer arietinum [garbanzo]
ref|XP_002303579.1|  actin-depolymerizing factor family protein         237   1e-75   Populus trichocarpa [western balsam poplar]
ref|XP_004240356.1|  PREDICTED: actin-depolymerizing factor 2-like      237   2e-75   Solanum lycopersicum
ref|NP_001047657.1|  Os02g0663800                                       236   2e-75   
ref|XP_004984752.1|  PREDICTED: actin-depolymerizing factor 7-lik...    237   3e-75   Setaria italica
ref|XP_002298043.1|  actin-depolymerizing factor family protein         236   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_004302775.1|  PREDICTED: actin-depolymerizing factor 3-like      236   3e-75   Fragaria vesca subsp. vesca
ref|XP_008392560.1|  PREDICTED: actin-depolymerizing factor 7-like      236   3e-75   Malus domestica [apple tree]
ref|XP_002509779.1|  actin depolymerizing factor, putative              236   4e-75   Ricinus communis
ref|XP_002864656.1|  hypothetical protein ARALYDRAFT_496124             236   4e-75   Arabidopsis lyrata subsp. lyrata
gb|KHN16833.1|  Actin-depolymerizing factor 7                           236   5e-75   Glycine soja [wild soybean]
ref|XP_002892045.1|  hypothetical protein ARALYDRAFT_887267             236   5e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_010672167.1|  PREDICTED: actin-depolymerizing factor 10          235   6e-75   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN56524.1|  hypothetical protein Csa_3G122480                       235   6e-75   Cucumis sativus [cucumbers]
ref|XP_003630533.1|  Actin depolymerizing factor                        235   7e-75   
gb|KJB33315.1|  hypothetical protein B456_006G198000                    235   8e-75   Gossypium raimondii
ref|XP_003532683.1|  PREDICTED: actin-depolymerizing factor 7-like      235   8e-75   Glycine max [soybeans]
ref|XP_008804935.1|  PREDICTED: actin-depolymerizing factor isofo...    235   9e-75   
ref|XP_007038697.1|  Actin depolymerizing factor 7                      235   9e-75   Theobroma cacao [chocolate]
gb|KDP22276.1|  hypothetical protein JCGZ_26107                         235   9e-75   Jatropha curcas
ref|NP_171680.1|  actin depolymerizing factor 11                        234   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538360.1|  PREDICTED: actin-depolymerizing factor 7-lik...    234   2e-74   Glycine max [soybeans]
ref|XP_006304638.1|  hypothetical protein CARUB_v10011760mg             234   2e-74   Capsella rubella
ref|XP_006490391.1|  PREDICTED: actin-depolymerizing factor 7-like      234   2e-74   
ref|XP_007040194.1|  Actin depolymerizing factor 8                      234   2e-74   Theobroma cacao [chocolate]
ref|XP_004511586.1|  PREDICTED: actin-depolymerizing factor 7-lik...    233   3e-74   Cicer arietinum [garbanzo]
ref|XP_006363318.1|  PREDICTED: actin-depolymerizing factor 7-like      233   3e-74   Solanum tuberosum [potatoes]
gb|ACU23570.1|  unknown                                                 233   3e-74   Glycine max [soybeans]
ref|XP_007160047.1|  hypothetical protein PHAVU_002G288100g             235   3e-74   Phaseolus vulgaris [French bean]
ref|XP_002872934.1|  hypothetical protein ARALYDRAFT_490501             233   3e-74   
gb|AEW90956.1|  actin depolymerizing factor 4-2                         233   4e-74   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_002322471.2|  hypothetical protein POPTR_0015s13080g             233   4e-74   
ref|XP_006445079.1|  hypothetical protein CICLE_v10023747mg             233   5e-74   
ref|XP_006590525.1|  PREDICTED: actin-depolymerizing factor 7-lik...    233   5e-74   Glycine max [soybeans]
ref|XP_006647644.1|  PREDICTED: actin-depolymerizing factor 1-like      233   7e-74   
ref|XP_006843087.1|  hypothetical protein AMTR_s00140p00036970          233   8e-74   Amborella trichopoda
ref|XP_010479839.1|  PREDICTED: actin-depolymerizing factor 10          233   8e-74   Camelina sativa [gold-of-pleasure]
ref|XP_009384093.1|  PREDICTED: actin-depolymerizing factor 1           233   8e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB52790.1|  hypothetical protein B456_008G277000                    232   8e-74   Gossypium raimondii
gb|KCW71635.1|  hypothetical protein EUGRSUZ_E00162                     232   9e-74   Eucalyptus grandis [rose gum]
ref|XP_009411533.1|  PREDICTED: actin-depolymerizing factor 1-like      233   1e-73   
gb|AAL91667.1|  pollen specific actin-depolymerizing factor 2           232   1e-73   Nicotiana tabacum [American tobacco]
ref|NP_567182.1|  actin depolymerizing factor 8                         232   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009770352.1|  PREDICTED: actin-depolymerizing factor 7           232   1e-73   Nicotiana sylvestris
ref|XP_002318237.1|  actin-depolymerizing factor family protein         232   1e-73   
gb|AEP25120.1|  actin depolymerising factor                             232   1e-73   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|KCW46430.1|  hypothetical protein EUGRSUZ_K00262                     232   2e-73   Eucalyptus grandis [rose gum]
ref|NP_001240195.1|  uncharacterized protein LOC100795241               231   2e-73   Glycine max [soybeans]
sp|P30175.1|ADF_LILLO  RecName: Full=Actin-depolymerizing factor;...    231   2e-73   Lilium longiflorum [Easter lily]
ref|XP_007051847.1|  Actin depolymerizing factor 11                     231   2e-73   Theobroma cacao [chocolate]
ref|XP_008343556.1|  PREDICTED: actin-depolymerizing factor 1-like      231   2e-73   
ref|XP_010427310.1|  PREDICTED: actin-depolymerizing factor 8           231   2e-73   Camelina sativa [gold-of-pleasure]
emb|CDY38025.1|  BnaCnng08860D                                          233   2e-73   Brassica napus [oilseed rape]
ref|XP_008647356.1|  PREDICTED: hypothetical protein isoform X1         231   2e-73   Zea mays [maize]
gb|KJB34132.1|  hypothetical protein B456_006G049100                    231   2e-73   Gossypium raimondii
ref|XP_010544380.1|  PREDICTED: actin-depolymerizing factor 8 iso...    231   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_010433613.1|  PREDICTED: actin-depolymerizing factor 7-like      231   2e-73   Camelina sativa [gold-of-pleasure]
gb|AGW22223.1|  actin-depolymerizing factor 4                           231   2e-73   
ref|XP_004511585.1|  PREDICTED: actin-depolymerizing factor 7-lik...    231   2e-73   
ref|XP_006285474.1|  hypothetical protein CARUB_v10006893mg             231   3e-73   
ref|XP_007143417.1|  hypothetical protein PHAVU_007G070500g             231   3e-73   
ref|XP_006401834.1|  hypothetical protein EUTSA_v10014982mg             231   3e-73   
ref|XP_010448409.1|  PREDICTED: actin-depolymerizing factor 7           231   3e-73   
gb|KGN50293.1|  hypothetical protein Csa_5G165880                       231   4e-73   
ref|XP_009386059.1|  PREDICTED: actin-depolymerizing factor             231   4e-73   
ref|XP_004300779.2|  PREDICTED: actin-depolymerizing factor 7-like      231   4e-73   
ref|XP_008241374.1|  PREDICTED: actin-depolymerizing factor 2-like      230   4e-73   
ref|XP_010910598.1|  PREDICTED: actin-depolymerizing factor             232   5e-73   
gb|AEJ90198.1|  actin depolymerizing factor 1                           230   5e-73   
gb|AEW90955.1|  actin depolymerizing factor 4-1                         230   6e-73   
ref|XP_010419619.1|  PREDICTED: actin-depolymerizing factor 8-like      230   7e-73   
ref|XP_011084418.1|  PREDICTED: actin-depolymerizing factor 7           230   7e-73   
gb|ABD66503.1|  actin depolymerizing factor 7                           230   7e-73   
ref|XP_009346958.1|  PREDICTED: actin-depolymerizing factor 1 iso...    229   8e-73   
gb|KFK26837.1|  hypothetical protein AALP_AA8G300400                    229   1e-72   
gb|KEH20707.1|  cofilin/actin-depolymerizing factor-like protein        229   1e-72   
ref|XP_006418454.1|  hypothetical protein EUTSA_v10009057mg             230   1e-72   
ref|XP_008437023.1|  PREDICTED: actin-depolymerizing factor 7           229   1e-72   
ref|XP_009414703.1|  PREDICTED: actin-depolymerizing factor-like        229   1e-72   
dbj|BAK04382.1|  predicted protein                                      229   1e-72   
ref|XP_009118832.1|  PREDICTED: actin-depolymerizing factor 10 is...    229   1e-72   
ref|XP_006572866.1|  PREDICTED: uncharacterized protein LOC100795...    229   2e-72   
ref|XP_009389157.1|  PREDICTED: actin-depolymerizing factor 1-like      229   2e-72   
ref|XP_010456252.1|  PREDICTED: actin-depolymerizing factor 8-like      229   2e-72   
ref|XP_009119731.1|  PREDICTED: actin-depolymerizing factor 10-like     229   2e-72   
ref|XP_010908104.1|  PREDICTED: zinc finger CCHC domain-containin...    236   2e-72   
ref|XP_009599636.1|  PREDICTED: actin-depolymerizing factor 7           229   2e-72   
dbj|BAK06235.1|  predicted protein                                      229   2e-72   
ref|XP_007211217.1|  hypothetical protein PRUPE_ppa013153mg             229   2e-72   
ref|XP_006396264.1|  hypothetical protein EUTSA_v10029050mg             229   2e-72   
ref|NP_001053519.1|  Os04g0555700                                       229   3e-72   
gb|AFK48601.1|  unknown                                                 228   3e-72   
gb|ABK22764.1|  unknown                                                 228   3e-72   
ref|XP_009127248.1|  PREDICTED: actin-depolymerizing factor 12          228   3e-72   
emb|CAB82824.1|  actin depolymerizing factor 2 (ADF2)                   228   4e-72   
gb|AFK35836.1|  unknown                                                 228   6e-72   
ref|XP_009109200.1|  PREDICTED: actin-depolymerizing factor-like        228   6e-72   
emb|CDY15154.1|  BnaC05g00330D                                          228   6e-72   
ref|NP_194289.2|  actin depolymerizing factor 7                         228   6e-72   
ref|XP_002865909.1|  hypothetical protein ARALYDRAFT_495305             228   7e-72   
sp|Q0DLA3.2|ADF7_ORYSJ  RecName: Full=Actin-depolymerizing factor...    228   7e-72   
ref|XP_009118831.1|  PREDICTED: actin-depolymerizing factor 10 is...    228   7e-72   
ref|NP_001148898.1|  actin-depolymerizing factor                        228   7e-72   
ref|XP_010544379.1|  PREDICTED: actin-depolymerizing factor 8 iso...    229   9e-72   
ref|XP_004496563.1|  PREDICTED: actin-depolymerizing factor 7-like      227   9e-72   
gb|ABK26220.1|  unknown                                                 227   1e-71   
ref|XP_009397611.1|  PREDICTED: actin-depolymerizing factor 1-like      227   1e-71   
emb|CBI22738.3|  unnamed protein product                                227   1e-71   
ref|XP_009591841.1|  PREDICTED: actin-depolymerizing factor 2-like      226   1e-71   
ref|XP_006653969.1|  PREDICTED: actin-depolymerizing factor 7-like      227   1e-71   
ref|XP_009387944.1|  PREDICTED: zinc finger CCHC domain-containin...    234   1e-71   
ref|XP_002867603.1|  actin binding protein                              226   2e-71   
ref|XP_009132530.1|  PREDICTED: actin-depolymerizing factor 12-like     226   2e-71   
ref|XP_009111466.1|  PREDICTED: actin-depolymerizing factor 8           226   2e-71   
ref|XP_006413292.1|  hypothetical protein EUTSA_v10026532mg             226   2e-71   
gb|ABF60823.1|  actin depolymerizing factor                             226   2e-71   
ref|XP_003611106.1|  Actin depolymerizing factor                        226   3e-71   
gb|AFS49701.1|  actin-depolymerizing factor 7                           226   3e-71   
ref|XP_009106793.1|  PREDICTED: actin-depolymerizing factor 7           226   4e-71   
ref|XP_009767736.1|  PREDICTED: actin-depolymerizing factor 7-lik...    225   4e-71   
ref|XP_002877449.1|  hypothetical protein ARALYDRAFT_484981             225   6e-71   
ref|XP_009342975.1|  PREDICTED: actin-depolymerizing factor 7           225   6e-71   
ref|NP_001054456.1|  Os05g0113400                                       225   6e-71   
ref|XP_008385142.1|  PREDICTED: actin-depolymerizing factor 1-like      225   7e-71   
ref|XP_010555668.1|  PREDICTED: actin-depolymerizing factor 7           225   7e-71   
gb|KGN57376.1|  hypothetical protein Csa_3G182120                       225   7e-71   
gb|AFK45315.1|  unknown                                                 225   8e-71   
dbj|BAJ93061.1|  predicted protein                                      225   8e-71   
gb|ABK21557.1|  unknown                                                 226   8e-71   
ref|XP_008804936.1|  PREDICTED: zinc finger CCHC domain-containin...    232   9e-71   
gb|KDO72931.1|  hypothetical protein CISIN_1g032504mg                   224   9e-71   
ref|XP_006418978.1|  hypothetical protein EUTSA_v10002714mg             224   9e-71   
gb|ACR38016.1|  unknown                                                 224   9e-71   
ref|XP_002448300.1|  hypothetical protein SORBIDRAFT_06g024870          224   1e-70   
ref|XP_010038440.1|  PREDICTED: uncharacterized protein LOC104426974    234   1e-70   
gb|AAD51856.1|AF179295_1  putative actin depolymerizing factor          224   1e-70   
ref|XP_009793756.1|  PREDICTED: actin-depolymerizing factor 7-like      224   1e-70   
gb|EMT12807.1|  Actin-depolymerizing factor 7                           226   2e-70   
gb|EAY86979.1|  hypothetical protein OsI_08373                          223   2e-70   
ref|XP_010910431.1|  PREDICTED: actin-depolymerizing factor-like        223   2e-70   
ref|XP_009767730.1|  PREDICTED: uncharacterized protein LOC104218...    228   4e-70   
ref|XP_011030201.1|  PREDICTED: uncharacterized protein LOC105129717    228   4e-70   
ref|XP_010444761.1|  PREDICTED: actin-depolymerizing factor 12-like     223   4e-70   
emb|CDP08835.1|  unnamed protein product                                224   4e-70   
ref|NP_568769.1|  actin depolymerizing factor 10                        223   4e-70   
ref|XP_010482597.1|  PREDICTED: actin-depolymerizing factor 12          223   4e-70   
ref|XP_003569002.1|  PREDICTED: actin-depolymerizing factor 7           223   5e-70   
emb|CDY51146.1|  BnaA09g51810D                                          230   6e-70   
gb|KHN26651.1|  Actin-depolymerizing factor 7                           223   6e-70   
ref|XP_004133872.1|  PREDICTED: actin-depolymerizing factor 10-like     222   7e-70   
gb|KHG18554.1|  Actin-depolymerizing factor                             222   7e-70   
ref|XP_008376578.1|  PREDICTED: actin-depolymerizing factor 7 iso...    222   7e-70   
ref|XP_002969368.1|  hypothetical protein SELMODRAFT_146459             223   8e-70   
ref|XP_010537182.1|  PREDICTED: actin-depolymerizing factor 7-lik...    222   9e-70   
ref|XP_006491074.1|  PREDICTED: actin-depolymerizing factor 10-like     222   9e-70   
gb|AAL91666.1|  pollen specific actin-depolymerizing factor 1           222   9e-70   
ref|XP_010442763.1|  PREDICTED: actin-depolymerizing factor 12-like     222   1e-69   
ref|XP_007158489.1|  hypothetical protein PHAVU_002G156700g             222   1e-69   
ref|XP_002510785.1|  actin depolymerizing factor, putative              233   1e-69   
ref|XP_009350096.1|  PREDICTED: actin-depolymerizing factor 2-like      221   1e-69   
gb|KJB41305.1|  hypothetical protein B456_007G098100                    221   1e-69   
gb|AAM61402.1|  actin depolymerizing factor-like                        221   1e-69   
ref|NP_001148445.1|  actin-depolymerizing factor                        221   1e-69   
ref|NP_001151716.1|  LOC100285352                                       221   2e-69   
gb|KDP28647.1|  hypothetical protein JCGZ_14418                         221   2e-69   
ref|XP_002452789.1|  hypothetical protein SORBIDRAFT_04g032550          220   3e-69   
ref|XP_004960504.1|  PREDICTED: actin-depolymerizing factor 7-like      220   4e-69   
emb|CDY27075.1|  BnaA02g10950D                                          229   4e-69   
ref|XP_011048781.1|  PREDICTED: uncharacterized protein LOC105142716    231   5e-69   
ref|XP_007218580.1|  hypothetical protein PRUPE_ppa013189mg             220   5e-69   
ref|XP_009382377.1|  PREDICTED: actin-depolymerizing factor 1-like      220   6e-69   
emb|CDY07204.1|  BnaCnng02190D                                          224   6e-69   
gb|EMS51874.1|  Actin-depolymerizing factor 6                           226   6e-69   
gb|EYU25097.1|  hypothetical protein MIMGU_mgv11b015928mg               220   7e-69   
ref|XP_010245480.1|  PREDICTED: actin-depolymerizing factor 1-like      219   7e-69   
ref|XP_009137539.1|  PREDICTED: actin-depolymerizing factor-like        219   1e-68   
ref|XP_010537181.1|  PREDICTED: actin-depolymerizing factor 7-lik...    219   1e-68   
ref|XP_006421922.1|  hypothetical protein CICLE_v10007087mg             219   1e-68   
ref|XP_010055150.1|  PREDICTED: actin-depolymerizing factor 8           219   1e-68   
ref|XP_011093147.1|  PREDICTED: actin-depolymerizing factor 10-like     219   1e-68   
ref|XP_010521323.1|  PREDICTED: actin-depolymerizing factor 7-like      219   1e-68   
gb|EMT04440.1|  Actin-depolymerizing factor 1                           219   2e-68   
gb|KHN35014.1|  Actin-depolymerizing factor 7                           218   2e-68   
ref|XP_011024249.1|  PREDICTED: actin-depolymerizing factor 1-lik...    218   2e-68   
ref|XP_009400269.1|  PREDICTED: actin-depolymerizing factor-like        218   3e-68   
gb|AFN53632.1|  actin-depolymerizing factor 12                          226   3e-68   
gb|EEE61469.1|  hypothetical protein OsJ_15732                          227   3e-68   
gb|EAY95118.1|  hypothetical protein OsI_16935                          227   3e-68   
ref|XP_004137944.1|  PREDICTED: actin-depolymerizing factor 2-like      219   3e-68   
gb|AAC13618.1|  Similar to actin binding protein; F6N23.12              218   5e-68   
emb|CDP05195.1|  unnamed protein product                                217   7e-68   
ref|XP_010040886.1|  PREDICTED: actin-depolymerizing factor 7-like      217   9e-68   
emb|CDY38916.1|  BnaA03g12630D                                          226   1e-67   
ref|XP_002460700.1|  hypothetical protein SORBIDRAFT_02g033380          216   2e-67   
ref|XP_011076485.1|  PREDICTED: uncharacterized protein C683.02c        224   2e-67   
emb|CDX92721.1|  BnaC07g39790D                                          217   3e-67   
gb|EYU35082.1|  hypothetical protein MIMGU_mgv1a015967mg                216   3e-67   
dbj|BAK05349.1|  predicted protein                                      216   3e-67   
ref|XP_008376580.1|  PREDICTED: uncharacterized protein LOC103439...    224   3e-67   
ref|XP_010227222.1|  PREDICTED: uncharacterized protein LOC100826202    227   3e-67   
ref|XP_004957704.1|  PREDICTED: actin-depolymerizing factor 2-like      215   4e-67   
ref|XP_004152385.1|  PREDICTED: actin-depolymerizing factor 7-like      215   4e-67   
gb|AFN53688.1|  putative actin-depolymerizing factor 12                 224   4e-67   
gb|EEC82036.1|  hypothetical protein OsI_26009                          215   4e-67   
ref|XP_011470359.1|  PREDICTED: actin-depolymerizing factor 7 iso...    215   5e-67   
emb|CDX90057.1|  BnaA10g00250D                                          215   5e-67   
gb|AAT42170.1|  putative actin depolymerizing factor                    225   5e-67   
ref|XP_010089132.1|  Actin-depolymerizing factor 7                      214   6e-67   
ref|XP_010317604.1|  PREDICTED: actin-depolymerizing factor 12          215   6e-67   
ref|XP_008439227.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    223   6e-67   
ref|XP_006353297.1|  PREDICTED: actin-depolymerizing factor 12-like     215   6e-67   
ref|XP_010671964.1|  PREDICTED: actin-depolymerizing factor 7           214   6e-67   
ref|XP_006657701.1|  PREDICTED: actin-depolymerizing factor 9-like      215   7e-67   
ref|XP_004140838.1|  PREDICTED: uncharacterized protein LOC101212555    223   8e-67   
ref|XP_004157224.1|  PREDICTED: uncharacterized LOC101212555            223   8e-67   
ref|XP_011091992.1|  PREDICTED: actin-depolymerizing factor 10-like     214   1e-66   
emb|CDX91636.1|  BnaC02g15240D                                          214   1e-66   
ref|XP_009615468.1|  PREDICTED: actin-depolymerizing factor 10-like     214   1e-66   
gb|EMT14364.1|  Actin-depolymerizing factor 6                           214   1e-66   
emb|CDO99231.1|  unnamed protein product                                214   2e-66   
gb|EYU32098.1|  hypothetical protein MIMGU_mgv1a026462mg                214   2e-66   
ref|NP_001059648.1|  Os07g0484200                                       214   2e-66   
emb|CDY50194.1|  BnaA03g47540D                                          216   2e-66   
ref|XP_002307641.2|  hypothetical protein POPTR_0005s24520g             213   3e-66   
ref|XP_010238336.1|  PREDICTED: actin-depolymerizing factor 9           213   3e-66   
ref|XP_003570044.1|  PREDICTED: actin-depolymerizing factor 1           213   3e-66   
ref|XP_008377508.1|  PREDICTED: actin-depolymerizing factor 7-lik...    213   4e-66   
emb|CAA18167.1|  actin depolymerizing factor-like protein               212   4e-66   
emb|CDY52365.1|  BnaA08g31000D                                          212   4e-66   
gb|EPS69954.1|  hypothetical protein M569_04811                         214   5e-66   
ref|XP_009793423.1|  PREDICTED: actin-depolymerizing factor 10-like     212   7e-66   
ref|NP_001105463.1|  actin-depolymerizing factor 1                      212   9e-66   
ref|NP_001105590.1|  actin-depolymerizing factor 2                      212   9e-66   
ref|XP_002511837.1|  actin depolymerizing factor, putative              211   1e-65   
gb|ABK23520.1|  unknown                                                 211   1e-65   
ref|XP_009371344.1|  PREDICTED: uncharacterized protein LOC103960584    221   2e-65   
emb|CDY00526.1|  BnaA10g07470D                                          211   2e-65   
ref|XP_010906274.1|  PREDICTED: actin-depolymerizing factor-like ...    211   2e-65   
emb|CDX94438.1|  BnaC01g17460D                                          210   3e-65   
ref|XP_006606908.1|  PREDICTED: uncharacterized protein LOC100783153    219   3e-65   
gb|KHN21743.1|  Actin-depolymerizing factor 7                           210   3e-65   
ref|XP_006590210.1|  PREDICTED: uncharacterized protein LOC100804471    219   4e-65   
ref|XP_009767744.1|  PREDICTED: actin-depolymerizing factor 7-lik...    210   4e-65   
ref|XP_009628017.1|  PREDICTED: actin-depolymerizing factor 7-like      210   4e-65   
emb|CDY31909.1|  BnaC09g28350D                                          210   4e-65   
gb|ADE75680.1|  unknown                                                 210   5e-65   
ref|XP_009144237.1|  PREDICTED: actin-depolymerizing factor 6           210   7e-65   
ref|XP_008668647.1|  PREDICTED: actin-depolymerizing factor 2 iso...    209   7e-65   
ref|XP_009408567.1|  PREDICTED: actin-depolymerizing factor 11-like     209   8e-65   
ref|XP_009601830.1|  PREDICTED: uncharacterized protein LOC104097027    219   9e-65   
gb|EPS71217.1|  hypothetical protein M569_03542                         209   1e-64   
gb|KHG04895.1|  Actin-depolymerizing factor 10 -like protein            209   1e-64   
dbj|BAB10533.1|  actin depolymerizing factor-like                       208   2e-64   
ref|XP_011089446.1|  PREDICTED: LOW QUALITY PROTEIN: actin-depoly...    207   3e-64   
ref|XP_008793579.1|  PREDICTED: actin-depolymerizing factor 11 is...    208   3e-64   
ref|XP_011025987.1|  PREDICTED: actin-depolymerizing factor-like        208   4e-64   
ref|XP_008234462.1|  PREDICTED: uncharacterized protein LOC103333411    218   4e-64   
gb|ACR34799.1|  unknown                                                 207   4e-64   
ref|XP_011470360.1|  PREDICTED: uncharacterized protein LOC101314...    216   4e-64   
ref|XP_006341722.1|  PREDICTED: actin-depolymerizing factor 10-like     207   4e-64   
emb|CDY24750.1|  BnaC04g13550D                                          208   4e-64   
gb|ACN27286.1|  unknown                                                 207   5e-64   
gb|AES62539.2|  cofilin/actin-depolymerizing factor-like protein        221   5e-64   
emb|CDY10786.1|  BnaA05g11500D                                          207   5e-64   
ref|XP_008377514.1|  PREDICTED: uncharacterized protein LOC103440...    215   6e-64   
ref|XP_003592288.1|  Actin depolymerizing factor                        221   6e-64   
ref|XP_009388955.1|  PREDICTED: actin-depolymerizing factor 11-like     207   6e-64   
ref|XP_007162541.1|  hypothetical protein PHAVU_001G160700g             207   8e-64   
ref|XP_009771651.1|  PREDICTED: actin-depolymerizing factor 12-like     207   8e-64   
ref|XP_010111917.1|  Actin-depolymerizing factor 6                      207   8e-64   
ref|XP_009139339.1|  PREDICTED: actin-depolymerizing factor             206   1e-63   
ref|NP_001236003.1|  uncharacterized protein LOC100527688               207   1e-63   
ref|XP_009340028.1|  PREDICTED: uncharacterized protein LOC103932...    213   1e-63   
ref|XP_009388500.1|  PREDICTED: actin-depolymerizing factor 11          206   2e-63   
ref|XP_010105396.1|  Actin-depolymerizing factor 7                      205   2e-63   
gb|AFK44911.1|  unknown                                                 205   4e-63   
ref|XP_002879310.1|  hypothetical protein ARALYDRAFT_902145             205   4e-63   
ref|XP_006410251.1|  hypothetical protein EUTSA_v10017380mg             205   5e-63   



>gb|ADV02778.1| actin depolymerizing factor 1 [Ipomoea batatas]
Length=139

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEEKQKQVIVEKVGEPA+SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVIVEKVGEPARSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PTDECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRAN
Sbjct  121  LQATDPTEMGLDVIRSRAN  139



>ref|XP_002533101.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF29273.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   277 bits (709),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRT+RFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ RSRAN
Sbjct  121  LQATDPTEMGLDVFRSRAN  139



>ref|XP_002273958.2| PREDICTED: actin-depolymerizing factor 1-like [Vitis vinifera]
 emb|CBI32606.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   277 bits (709),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = -1

Query  632  TAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFT  453
            TAKMANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEPAQSYEDFT
Sbjct  48   TAKMANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPAQSYEDFT  107

Query  452  ASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGI  273
            ASLPADECRYAVYDFDFVT ENCQKS+IFFIAW PD+SRVRSKMIYASSKDRFKRELDGI
Sbjct  108  ASLPADECRYAVYDFDFVTEENCQKSRIFFIAWCPDSSRVRSKMIYASSKDRFKRELDGI  167

Query  272  QVELQATDPTGMGMDLIRSRA  210
            QVELQATDPT MG+D+IRSRA
Sbjct  168  QVELQATDPTEMGLDVIRSRA  188



>ref|XP_011094831.1| PREDICTED: actin-depolymerizing factor 1 isoform X2 [Sesamum 
indicum]
Length=139

 Score =   275 bits (703),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEEKQKQV+VEKVGEP Q+Y+DFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTQNYDDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PVDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRAN
Sbjct  121  LQATDPTEMGLDVIKSRAN  139



>gb|KHG06644.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
 gb|KJB83792.1| hypothetical protein B456_013G264800 [Gossypium raimondii]
Length=139

 Score =   274 bits (701),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEK+GEP+QSY+DFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSQSYDDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRAN
Sbjct  121  LQATDPTEMGLDVIRSRAN  139



>ref|XP_010529845.1| PREDICTED: actin-depolymerizing factor 2-like [Tarenaya hassleriana]
Length=139

 Score =   273 bits (699),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANA SGMAVHD+CKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEP+QSYEDFTASL
Sbjct  1    MANAVSGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPSQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRAN
Sbjct  121  LQATDPTEMGLDVIRSRAN  139



>ref|XP_007016496.1| Actin depolymerizing factor 4 [Theobroma cacao]
 gb|EOY34115.1| Actin depolymerizing factor 4 [Theobroma cacao]
Length=139

 Score =   273 bits (699),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEK+GEP QSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>ref|XP_010047513.1| PREDICTED: actin-depolymerizing factor 2 [Eucalyptus grandis]
Length=139

 Score =   273 bits (698),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP QSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA 
Sbjct  121  LQATDPTEMGLDVIRSRAT  139



>ref|XP_002284292.1| PREDICTED: actin-depolymerizing factor 2 [Vitis vinifera]
Length=139

 Score =   273 bits (698),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQV+VEKVGEP QSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>gb|KDP35600.1| hypothetical protein JCGZ_09038 [Jatropha curcas]
Length=139

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEKVGEP QSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPNQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPD SRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDASRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ RSRAN
Sbjct  121  LQATDPTEMGLDVFRSRAN  139



>gb|KJB20158.1| hypothetical protein B456_003G135600 [Gossypium raimondii]
Length=139

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R+IVFKIEEKQKQV+VEK+GEP+QSY+DFT+SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVFKIEEKQKQVVVEKLGEPSQSYDDFTSSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRAN
Sbjct  121  LQATDPTEMGLDVIRSRAN  139



>gb|KHG23104.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R+IVFKIEEKQKQV+VEK+GEP+QSY+DFT+SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVFKIEEKQKQVVVEKLGEPSQSYDDFTSSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRAN
Sbjct  121  LQATDPTEMGLDVIRSRAN  139



>ref|XP_009586917.1| PREDICTED: actin-depolymerizing factor 1 [Nicotiana tomentosiformis]
 ref|XP_009774799.1| PREDICTED: actin-depolymerizing factor 1 [Nicotiana sylvestris]
Length=139

 Score =   271 bits (694),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEEKQKQV+VEKVGEP +SYEDF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTESYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRAN
Sbjct  121  LQATDPTEMGLDVIKSRAN  139



>ref|XP_011094830.1| PREDICTED: actin-depolymerizing factor 1 isoform X1 [Sesamum 
indicum]
Length=150

 Score =   272 bits (695),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEEKQKQV+VEKVGEP Q+Y+DFTASLP
Sbjct  13   ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTQNYDDFTASLP  72

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
             DECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL
Sbjct  73   VDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  132

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDPT MG+D+I+SRAN
Sbjct  133  QATDPTEMGLDVIKSRAN  150



>ref|XP_010253266.1| PREDICTED: actin-depolymerizing factor 2 [Nelumbo nucifera]
Length=139

 Score =   271 bits (692),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP +SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTESYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>gb|ACB32233.1| actin-depolymerizing factor 1 [Solanum chacoense]
Length=139

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEEKQKQV+VEKVGEPAQSYEDFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQSYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDFVTAENCQKS+IFFIAWSPDT+RVRSKMIYAS+K+RFKRELDGIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASTKERFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRAN
Sbjct  121  LQATDPTEMGLDVIKSRAN  139



>ref|XP_011077447.1| PREDICTED: actin-depolymerizing factor 1-like [Sesamum indicum]
Length=173

 Score =   271 bits (694),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -1

Query  626  KMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTAS  447
            +MANAASGMAVHDDCKLRFLEL+AKRT+RFI+FKIEEKQKQV+VEKVGEP QSY+DFTAS
Sbjct  34   EMANAASGMAVHDDCKLRFLELKAKRTYRFIIFKIEEKQKQVVVEKVGEPTQSYDDFTAS  93

Query  446  LPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQV  267
            LP DECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSR+R+KMIYASSKDRFKRELDGIQV
Sbjct  94   LPVDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRIRNKMIYASSKDRFKRELDGIQV  153

Query  266  ELQATDPTGMGMDLIRSRAN  207
            ELQATDPT MG+D+I+SRAN
Sbjct  154  ELQATDPTEMGLDVIKSRAN  173



>gb|EYU26572.1| hypothetical protein MIMGU_mgv1a015955mg [Erythranthe guttata]
Length=139

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKR+HRFIVFKIEEKQKQVIVEKVGEP +SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSHRFIVFKIEEKQKQVIVEKVGEPNESYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRY VYDFDFVTAENCQKSKIFFIAWSPDT+R+R+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYTVYDFDFVTAENCQKSKIFFIAWSPDTARIRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDPT MG+D+I+SRA
Sbjct  121  LQATDPTEMGLDVIKSRA  138



>ref|XP_010553292.1| PREDICTED: actin-depolymerizing factor 1 [Tarenaya hassleriana]
Length=139

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL++KRT+RFIV+KIEEKQKQVIVEK+GEP+QSYEDF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKSKRTYRFIVYKIEEKQKQVIVEKLGEPSQSYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT+ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTSENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRAN
Sbjct  121  LQATDPTEMGLDVIKSRAN  139



>ref|XP_004246462.1| PREDICTED: actin-depolymerizing factor 1 [Solanum lycopersicum]
Length=139

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEEKQKQV+VEKVGEPAQ YEDFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQGYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYAS+K+RFKRELDGIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASTKERFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRAN
Sbjct  121  LQATDPTEMGLDVIKSRAN  139



>ref|XP_010260094.1| PREDICTED: actin-depolymerizing factor 2-like [Nelumbo nucifera]
Length=139

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEK+GEP QSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+IRSRA+
Sbjct  121  LQATDPTEVGLDVIRSRAS  139



>ref|XP_006341057.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum tuberosum]
Length=139

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEEKQKQV+VEKVGEPAQSYEDFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQSYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDFVTAENCQKS+IFFIAWSPDT+RVRSKMIYAS+K+RFKRE+DGIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASTKERFKREVDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRAN
Sbjct  121  LQATDPTEMGLDVIKSRAN  139



>ref|XP_010535543.1| PREDICTED: actin-depolymerizing factor 4 [Tarenaya hassleriana]
Length=139

 Score =   268 bits (686),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRT+RFIV+KIEE+QKQVIVEKVGEPAQ+YEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPAQTYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA++DFDFVTAENCQKSKIFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  121  LQATDPTEMGLDVFKSRVN  139



>ref|XP_002299887.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 ref|XP_006387927.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011000286.1| PREDICTED: actin-depolymerizing factor 2 [Populus euphratica]
 gb|ABK92579.1| unknown [Populus trichocarpa]
 gb|ABK96321.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE84692.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 gb|ERP46841.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   268 bits (686),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEK+GEPAQSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT EN QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRA+
Sbjct  121  LQATDPTEMGLDVIKSRAS  139



>emb|CDP06641.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   269 bits (687),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            +ANAASGMAVHDDCKLRFLEL+AKRT+RFIV+KIEEKQKQV+VEKVGEP +SYEDFTASL
Sbjct  25   IANAASGMAVHDDCKLRFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTKSYEDFTASL  84

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  85   PVDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  144

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRA+
Sbjct  145  LQATDPTEMGLDVIKSRAS  163



>ref|XP_011042674.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011042675.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Populus 
euphratica]
Length=139

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEK+GEPAQSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECR+AVYDFDFVTAEN QKS+IFFIAWSPDTSRVRS MIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRFAVYDFDFVTAENVQKSRIFFIAWSPDTSRVRSNMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>gb|KDP29838.1| hypothetical protein JCGZ_18413 [Jatropha curcas]
Length=139

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRTHRFIVFKIEEKQKQV+VEK+GEPA SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVVVEKLGEPANSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT EN QKS+I FIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIVFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+N
Sbjct  121  LQATDPTEMGLDVIRSRSN  139



>ref|XP_002314194.1| actin-depolymerizing factor 3 family protein [Populus trichocarpa]
 gb|ABK96064.1| unknown [Populus trichocarpa]
 gb|EEE88149.1| actin-depolymerizing factor 3 family protein [Populus trichocarpa]
Length=139

 Score =   267 bits (682),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEK+GEPAQSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECR+AVYDFDFVTAEN QKS+IFFIAW PDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRFAVYDFDFVTAENVQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>gb|ADI78873.1| actin-depolymerizing factor [Hevea brasiliensis]
Length=139

 Score =   266 bits (680),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRT+R+IVFKIEEK KQVIVEK+GEP QSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRYIVFKIEEKAKQVIVEKLGEPTQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRA+
Sbjct  121  LQATDPTEMGLDVFKSRAS  139



>emb|CAL25339.1| actin-depolymerizing factor [Platanus x acerifolia]
Length=139

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG+AVHDDCKL+FLEL+ KRT+RFIVFKIE+KQKQV+VEKVGEP QSYEDF+ASL
Sbjct  1    MANAASGIAVHDDCKLKFLELKVKRTYRFIVFKIEDKQKQVVVEKVGEPTQSYEDFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAEN QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTAENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>ref|XP_008463478.1| PREDICTED: actin-depolymerizing factor 2 isoform X1 [Cucumis 
melo]
 ref|XP_008463479.1| PREDICTED: actin-depolymerizing factor 2 isoform X2 [Cucumis 
melo]
Length=139

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFL+L+AKRT+RFIVFKIEEKQKQV+VEK+GEP++SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGEPSESYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+I FIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+ 
Sbjct  121  LQATDPTEMGLDVIRSRSG  139



>ref|XP_004249528.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum lycopersicum]
Length=139

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL FLEL+ KRTHRFIVFKIEEKQKQV+VEKVGEP QSYEDF  SL
Sbjct  1    MANAASGMAVHDDCKLTFLELKTKRTHRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAESL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+I+SRAN
Sbjct  121  LQATDPTEMELDVIKSRAN  139



>ref|XP_011000294.1| PREDICTED: actin-depolymerizing factor 2-like [Populus euphratica]
Length=139

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R IVFKIEEK KQVIVEK+GEPAQSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+TAEN QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFMTAENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>ref|NP_001238519.1| uncharacterized protein LOC100499953 [Glycine max]
 gb|ACU14320.1| unknown [Glycine max]
Length=139

 Score =   264 bits (675),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEPA  Y+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>gb|ADV04049.1| actin depolymerizing factor 4 [Hevea brasiliensis]
Length=139

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG+AVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEP  SYEDFTASL
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTNSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFD+VT ENCQKS+I FIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+N
Sbjct  121  LQATDPTEMGLDVIRSRSN  139



>sp|Q9FVI2.1|ADF1_PETHY RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1 [Petunia 
x hybrida]
 gb|AAG16973.1|AF183903_1 actin-depolymerizing factor 1 [Petunia x hybrida]
 gb|AAK72617.1| actin-depolymerizing factor 1 [Petunia x hybrida]
Length=139

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQV+VEK+GEP +SYEDF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKIGEPTESYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDFVTAENCQKS+IFFIAW PDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PENECRYAVYDFDFVTAENCQKSRIFFIAWCPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQA DPT MG+D+I+SRAN
Sbjct  121  LQACDPTEMGLDVIQSRAN  139



>emb|CBI31711.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  629  AKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTA  450
            A+MANAASGMAVHDDCKL+FLEL+AKRT+R IVF+IEEKQKQVIVEKVGEP QSYEDF A
Sbjct  62   ARMANAASGMAVHDDCKLKFLELKAKRTYRSIVFQIEEKQKQVIVEKVGEPTQSYEDFAA  121

Query  449  SLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ  270
            SLPADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ
Sbjct  122  SLPADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ  181

Query  269  VELQATDPTGMGMDLIRSRA  210
            VELQATDPT +G+D+IRSRA
Sbjct  182  VELQATDPTEIGLDVIRSRA  201



>emb|CAJ38388.1| actin-depolymerizing factor [Plantago major]
Length=139

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANA SGMAVHDDCKLRFLEL+AKRTHRF+VFKIEEKQKQV+VEKVGEPA++YEDF ASL
Sbjct  1    MANAVSGMAVHDDCKLRFLELKAKRTHRFVVFKIEEKQKQVVVEKVGEPAETYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRY VYDFDFVTAENCQKS+IFFIAWSPDT+R+RSKMIYASSK+RFKRELDGIQVE
Sbjct  61   PENECRYGVYDFDFVTAENCQKSRIFFIAWSPDTARIRSKMIYASSKERFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+ RAN
Sbjct  121  LQATDPTEMGLDVIKGRAN  139



>ref|XP_010920670.1| PREDICTED: actin-depolymerizing factor 7 [Elaeis guineensis]
Length=139

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFI+FKIEEK KQ+IVEKVGEP  SYEDFTASL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQIIVEKVGEPTLSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVT ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|XP_002314195.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|EEE88150.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEE+QKQVIVEK+GEPAQSYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT EN QKS+IFFIAW PDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRA+
Sbjct  121  LQATDPTEMGLDVIKSRAS  139



>ref|XP_002284029.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Vitis 
vinifera]
 ref|XP_002284040.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010658601.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Vitis 
vinifera]
Length=139

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R IVF+IEEKQKQVIVEKVGEP QSYEDF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFQIEEKQKQVIVEKVGEPTQSYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDPT +G+D+IRSRA
Sbjct  121  LQATDPTEIGLDVIRSRA  138



>ref|XP_011016059.1| PREDICTED: actin-depolymerizing factor 2-like [Populus euphratica]
Length=139

 Score =   263 bits (673),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHD+CKL+FLEL+AKRT+RFIV+KIEE+QKQVIVEK+GEPAQSYEDFTASL
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT EN QKS+IFFIAW PDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>ref|XP_007218573.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica]
 gb|EMJ19772.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica]
Length=139

 Score =   263 bits (673),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHD+CKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEKVGEPA SYEDF+ASL
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKVGEPADSYEDFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFD+VT ENCQKS+I FIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA 
Sbjct  121  LQATDPTEMGLDVIRSRAT  139



>ref|XP_002299888.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|ABK93478.1| unknown [Populus trichocarpa]
 gb|ABK93508.1| unknown [Populus trichocarpa]
 gb|ABK93744.1| unknown [Populus trichocarpa]
 gb|ABK93767.1| unknown [Populus trichocarpa]
 gb|EEE84693.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   263 bits (673),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R IVFKIEEK KQVIVEK+GEPAQSYEDFTAS+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+TAEN QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFMTAENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA+
Sbjct  121  LQATDPTEMGLDVIRSRAS  139



>ref|XP_011027144.1| PREDICTED: actin-depolymerizing factor 1-like [Populus euphratica]
Length=139

 Score =   263 bits (673),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFL+L+AKRT+RFIVFKIEEKQKQVIVEK+GEPA SYE+F+ASL
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVIVEKLGEPADSYENFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFD+VT ENCQKS+I FIAWSPDT+RVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIVFIAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+N
Sbjct  121  LQATDPTEMGLDVIRSRSN  139



>gb|ABD66504.1| actin depolymerizing factor 8 [Gossypium hirsutum]
 gb|AAY88048.2| actin depolymerizing factor [Gossypium hirsutum]
 gb|KHG23444.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
Length=139

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP  SYE FTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTDSYEAFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ M +D+IRSRAN
Sbjct  121  LQATDPSEMDLDVIRSRAN  139



>ref|XP_007144457.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
 gb|AGV54234.1| actin-depolymerizing factor [Phaseolus vulgaris]
 gb|ESW16451.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
Length=139

 Score =   263 bits (672),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R+IV+KIEEKQKQV+VEK+GEPA  YEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVYKIEEKQKQVVVEKLGEPANGYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKSKIFFIAWSPD++RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSKIFFIAWSPDSARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  121  LQATDPTEMGLDVFKSRVN  139



>ref|XP_004142738.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus]
 ref|XP_004156722.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus]
 gb|KGN51280.1| hypothetical protein Csa_5G512870 [Cucumis sativus]
Length=139

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFL+L+AKRT+RFIVFKIEEKQKQV+VEK+G+P++SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGKPSESYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+I FIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+ 
Sbjct  121  LQATDPTEMGLDVIRSRSG  139



>gb|ABX79380.1| actin-depolymerizing factor [Gossypium barbadense]
Length=139

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP  SYE FTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPIDSYEAFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ M +D+IRSRAN
Sbjct  121  LQATDPSEMDLDVIRSRAN  139



>ref|XP_006424770.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488280.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Citrus 
sinensis]
 gb|ESR38010.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 gb|KDO72932.1| hypothetical protein CISIN_1g032504mg [Citrus sinensis]
Length=139

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEP Q+YEDF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYD+DFVTAENCQKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ MG+D+ + RAN
Sbjct  121  LQATDPSEMGLDVFKDRAN  139



>ref|XP_006339034.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum tuberosum]
Length=139

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL F EL+ KR+HRFIVFKIEEKQKQV+VEKVGEP QSYEDF  SL
Sbjct  1    MANAASGMAVHDDCKLTFFELKTKRSHRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAESL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SR N
Sbjct  121  LQATDPTEMGLDVIKSRVN  139



>gb|KJB78849.1| hypothetical protein B456_013G022900 [Gossypium raimondii]
Length=139

 Score =   262 bits (670),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP  SYE FTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTDSYEAFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ M +D+I+SRAN
Sbjct  121  LQATDPSEMDLDVIKSRAN  139



>gb|EPS63340.1| hypothetical protein M569_11446, partial [Genlisea aurea]
Length=138

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAVHD+CKLRFLEL+AKRT+RFI+FKIE+KQKQV+VEKVG+PAQ YEDFTASLP
Sbjct  1    ANAASGMAVHDECKLRFLELKAKRTYRFIIFKIEDKQKQVVVEKVGDPAQGYEDFTASLP  60

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            A+ECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSR+R+KMIYASSKDRFKRELDGIQVEL
Sbjct  61   ANECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRIRNKMIYASSKDRFKRELDGIQVEL  120

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDPT M +D+I+SRAN
Sbjct  121  QATDPTEMDLDVIKSRAN  138



>ref|XP_010031001.1| PREDICTED: actin-depolymerizing factor 2-like [Eucalyptus grandis]
 gb|KCW50260.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEK+GEP  SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPTNSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFD+VT ENCQKS+I FIAWSPDTS+VR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+ 
Sbjct  121  LQATDPTEMGLDVIRSRST  139



>gb|AEJ88268.1| putative actin-depolymerizing factor [Wolffia arrhiza]
Length=139

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRTHRFIVFKI+EKQKQVIVEK+GEPA +YEDF ASL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTHRFIVFKIDEKQKQVIVEKIGEPALTYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYA+YDFDFVT+ENCQKSKIFFIAWSPDT+RVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PDNECRYAIYDFDFVTSENCQKSKIFFIAWSPDTARVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|XP_002311154.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
 gb|EEE88521.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
Length=218

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  626  KMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTAS  447
            KMANAASGMAVHDDCKL+FLEL+AKRTHRFIVFKIEEKQKQVIVEK+G+P  SYEDFTAS
Sbjct  79   KMANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFTAS  138

Query  446  LPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQV  267
            LPA+ECRYAVYDFD+VT ENCQKS+I F+AWSPDTSRVRSKMIYASSKDRFKRELDGIQ+
Sbjct  139  LPANECRYAVYDFDYVTDENCQKSRIVFVAWSPDTSRVRSKMIYASSKDRFKRELDGIQI  198

Query  266  ELQATDPTGMGMDLIRSRA  210
            ELQATDPT MG+D+IRSR+
Sbjct  199  ELQATDPTEMGLDVIRSRS  217



>ref|XP_008788089.1| PREDICTED: actin-depolymerizing factor 7-like [Phoenix dactylifera]
Length=139

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRTHRFI+FKI+EK KQVIVEKVGEP  SYEDFTA+L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTHRFIIFKIDEKLKQVIVEKVGEPTMSYEDFTAAL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVT ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RA 
Sbjct  121  LQATDPTEMGLDVIRGRAT  139



>gb|KHN48988.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=154

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  626  KMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTAS  447
            ++ANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEPA  Y+DF AS
Sbjct  15   EVANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAAS  74

Query  446  LPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQV  267
            LPADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+
Sbjct  75   LPADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQI  134

Query  266  ELQATDPTGMGMDLIRSRAN  207
            ELQATDPT MG+D+ +SRAN
Sbjct  135  ELQATDPTEMGLDVFKSRAN  154



>ref|XP_006418975.1| hypothetical protein EUTSA_v10002704mg [Eutrema salsugineum]
 gb|ESQ37411.1| hypothetical protein EUTSA_v10002704mg [Eutrema salsugineum]
Length=139

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP Q++E+F ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPVQTFEEFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ RSRAN
Sbjct  121  LQATDPTEMDLDVFRSRAN  139



>gb|ABK94603.1| unknown [Populus trichocarpa]
Length=139

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRTHRFIVFKIEEKQKQVIVEK+G+P  SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFD+VT ENCQKS+I F+AWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PANECRYAVYDFDYVTDENCQKSRIVFVAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDPT MG+D+IRSR+
Sbjct  121  LQATDPTEMGLDVIRSRS  138



>ref|XP_007027090.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
 gb|EOY07592.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
Length=173

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  626  KMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTAS  447
            +MANAASGMAVHD+CKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEPAQSYEDF  S
Sbjct  34   EMANAASGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAQSYEDFAKS  93

Query  446  LPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQV  267
            LPADECRYAVYDFDF+T EN QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQV
Sbjct  94   LPADECRYAVYDFDFLTPENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQV  153

Query  266  ELQATDPTGMGMDLIRSRAN  207
            ELQATDPT MG+D+I+SRA+
Sbjct  154  ELQATDPTEMGLDVIKSRAS  173



>ref|XP_010543331.1| PREDICTED: actin-depolymerizing factor 1-like [Tarenaya hassleriana]
Length=139

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANA SGMAVHD+CKL+FLEL+AKR HRFIVFKIEEKQKQV+VEKVGEP   YEDF ASL
Sbjct  1    MANAVSGMAVHDECKLKFLELKAKRRHRFIVFKIEEKQKQVMVEKVGEPPLGYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SRAN
Sbjct  121  LQATDPTEMGIDVIKSRAN  139



>ref|XP_006436042.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 ref|XP_006486066.1| PREDICTED: actin-depolymerizing factor 2-like [Citrus sinensis]
 gb|ESR49282.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|KDO67706.1| hypothetical protein CISIN_1g032498mg [Citrus sinensis]
Length=139

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV DDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEK+GEP+ SYE+FTASL
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSDSYENFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKSKI FIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSKIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D++RSR+N
Sbjct  121  LQATDPTEMGLDVMRSRSN  139



>gb|ABD63906.1| actin depolymerizing factor 2 [Gossypium hirsutum]
 gb|KHG27900.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
 gb|KHG27902.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
Length=139

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRTHRFIVFKIEEKQKQVIVEK+GEP +SYEDFT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+TAEN  KS+IFFIAWSPDTSR+RSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFLTAENVPKSRIFFIAWSPDTSRIRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>gb|AEZ00870.1| putative actin depolymerizing factor protein, partial [Elaeis 
guineensis]
Length=179

 Score =   263 bits (671),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  629  AKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTA  450
            A+MANAASGMAV+DDCKL+FLEL+AKRTHR+I+FKI+EK KQVIVEKVGEP  SYEDFTA
Sbjct  39   AEMANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVEKVGEPTLSYEDFTA  98

Query  449  SLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ  270
            +LPADECRYA+YDFDFVT ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQ
Sbjct  99   ALPADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQ  158

Query  269  VELQATDPTGMGMDLIRSRA  210
            VELQATDPT MG+D+IR RA
Sbjct  159  VELQATDPTEMGLDVIRGRA  178



>ref|XP_010909358.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=139

 Score =   261 bits (667),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFI++KIEEK KQVIVEKVGEP  SYEDFTA+L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIYKIEEKLKQVIVEKVGEPTLSYEDFTAAL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVT ENCQKSKIFFIAWSPDTS+VRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|NP_851228.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
 sp|Q9ZSK3.2|ADF4_ARATH RecName: Full=Actin-depolymerizing factor 4; Short=ADF-4; Short=AtADF4 
[Arabidopsis thaliana]
 dbj|BAB08357.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
 gb|AAM61326.1| actin depolymerizing factor 4-like protein [Arabidopsis thaliana]
 dbj|BAH19834.1| AT5G59890 [Arabidopsis thaliana]
 gb|AED97247.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
Length=139

 Score =   261 bits (666),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP  +YEDF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+++SR N
Sbjct  121  LQATDPTEMDLDVLKSRVN  139



>ref|XP_002316301.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|ABK95121.1| unknown [Populus trichocarpa]
 gb|EEF02472.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   261 bits (666),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFL+L+AKRT+RFIVFKIEEKQKQVIVEK+GEPA SYE+F+ASL
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVIVEKLGEPADSYENFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFD+VT ENCQKS+I FIAW PDT+RVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIVFIAWCPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+N
Sbjct  121  LQATDPTEMGLDVIRSRSN  139



>ref|XP_006281292.1| hypothetical protein CARUB_v10027342mg [Capsella rubella]
 gb|EOA14190.1| hypothetical protein CARUB_v10027342mg [Capsella rubella]
Length=139

 Score =   260 bits (665),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP Q+Y+DF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPIQTYDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+++SR N
Sbjct  121  LQATDPTEMDLDVLKSRVN  139



>emb|CDX88731.1| BnaA03g09180D [Brassica napus]
Length=199

 Score =   263 bits (671),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  656  VSLGS*FSTAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEP  477
            V+    F  A MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQV+VEKVGEP
Sbjct  50   VTFHQRFDPAAMANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEP  109

Query  476  AQSYEDFTASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDR  297
              SYEDF ASLPA+ECRYA+YDFDFVT ENCQKSKIFFIAW PD ++VRSKMIYASSKDR
Sbjct  110  ILSYEDFAASLPAEECRYAIYDFDFVTTENCQKSKIFFIAWCPDVAKVRSKMIYASSKDR  169

Query  296  FKRELDGIQVELQATDPTGMGMDLIRSRAN  207
            FKRELDGIQVELQATDPT M +D+ +SR N
Sbjct  170  FKRELDGIQVELQATDPTEMDLDVFKSRVN  199



>ref|XP_009126640.1| PREDICTED: actin-depolymerizing factor 4 isoform X1 [Brassica 
rapa]
 ref|XP_009126641.1| PREDICTED: actin-depolymerizing factor 4 isoform X2 [Brassica 
rapa]
Length=139

 Score =   260 bits (665),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQV+VEKVGEP Q+YEDF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEPIQTYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SR N
Sbjct  121  LQATDPTEMDLDVFKSRVN  139



>ref|XP_008776502.1| PREDICTED: actin-depolymerizing factor 7 [Phoenix dactylifera]
Length=139

 Score =   260 bits (665),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFI+FKIEEK KQVIVEK+GEP  SYEDFTA+L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQVIVEKLGEPTLSYEDFTAAL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDFVT ENCQKSKIFFIAWSPDTS+VRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|XP_006424771.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488279.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Citrus 
sinensis]
 gb|ESR38011.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
Length=141

 Score =   260 bits (665),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEP Q+YEDF ASLP
Sbjct  4    ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLP  63

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            A+ECRYAVYD+DFVTAENCQKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVEL
Sbjct  64   AEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVEL  123

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDP+ MG+D+ + RAN
Sbjct  124  QATDPSEMGLDVFKDRAN  141



>ref|NP_001236448.1| uncharacterized protein LOC100305514 [Glycine max]
 gb|ACU13224.1| unknown [Glycine max]
 gb|AGM20694.1| actin depolymerizing factor 1 [Glycine max]
 gb|KHN14376.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEE+QKQVIVEK+GEPAQ YEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEQQKQVIVEKLGEPAQGYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+++T  N  KS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_010937681.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=139

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFI+FKI+EK KQVIVEKVGEP  SYEDFTA+L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKLKQVIVEKVGEPTLSYEDFTANL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVT ENCQKSKIFFIAWSPD+SRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|XP_006400899.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
 gb|ESQ42352.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
Length=139

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEE+QKQVIVEKVGEP QS++DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPGQSHDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA++DFDFVTAENCQKSKIFF+AWSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIFDFDFVTAENCQKSKIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRAN
Sbjct  121  LQATDPTEMDLDVFKSRAN  139



>gb|ABD66505.1| actin depolymerizing factor 3 [Gossypium hirsutum]
 gb|KJB16926.1| hypothetical protein B456_002G254700 [Gossypium raimondii]
Length=139

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+ KRTHRFIVFKIEEKQKQVIVEK+GEP +SYEDFT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+TAEN  KS+IFFIAWSPDTSR+RSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFLTAENVPKSRIFFIAWSPDTSRIRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_007206123.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
 ref|XP_008223136.1| PREDICTED: actin-depolymerizing factor 2 [Prunus mume]
 gb|EMJ07322.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
Length=139

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG AV DDCKL+FLEL+AKRT+RFIVFKIEE+QKQVIVEK+GEPA+SYE+FTASL
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIEEEQKQVIVEKLGEPAESYENFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+I+SRA+
Sbjct  121  LQATDPTEIGLDVIKSRAS  139



>gb|KGN58886.1| hypothetical protein Csa_3G734880 [Cucumis sativus]
Length=139

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG+AVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP QSYEDF  SL
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P+DECRYA+YDFDFVT ENCQKS+IFFIAWSPD+SRVRSKMIYASSKDRFKRELDG QVE
Sbjct  61   PSDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYASSKDRFKRELDGFQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR  
Sbjct  121  LQATDPTEMGLDVIRSRVG  139



>gb|KJB78850.1| hypothetical protein B456_013G022900 [Gossypium raimondii]
Length=149

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP  SYE FTASLP
Sbjct  12   ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTDSYEAFTASLP  71

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            ADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVEL
Sbjct  72   ADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVEL  131

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDP+ M +D+I+SRAN
Sbjct  132  QATDPSEMDLDVIKSRAN  149



>ref|XP_010455715.1| PREDICTED: actin-depolymerizing factor 4 [Camelina sativa]
 ref|XP_010443776.1| PREDICTED: actin-depolymerizing factor 4 [Camelina sativa]
 ref|XP_010483637.1| PREDICTED: actin-depolymerizing factor 4 [Camelina sativa]
Length=139

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP  +YEDF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+++SR N
Sbjct  121  LQATDPTEMDLDVLKSRVN  139



>ref|XP_010514926.1| PREDICTED: actin-depolymerizing factor 1 [Camelina sativa]
Length=139

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF+EL+AKRTHRFIV+KIEEKQKQV+VEKVGEP Q+Y+DF ASL
Sbjct  1    MANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKQKQVVVEKVGEPIQTYDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQA DPT M +D+ RSRAN
Sbjct  121  LQAADPTEMDLDVFRSRAN  139



>ref|NP_190187.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
 sp|Q39250.1|ADF1_ARATH RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=AtADF1 
[Arabidopsis thaliana]
 pdb|1F7S|A Chain A, Crystal Structure Of Adf1 From Arabidopsis Thaliana
 gb|AAB03696.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
 gb|AAC72407.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
 emb|CAB88325.1| actin depolymerizing factor 1 (ADF1) [Arabidopsis thaliana]
 gb|AAK59658.1| putative actin depolymerizing factor ADF1 [Arabidopsis thaliana]
 gb|AAL33770.1| putative actin depolymerizing factor 1 [Arabidopsis thaliana]
 gb|AAM63066.1| actin-depolymerizing factor ADF-1 (AtADF1) [Arabidopsis thaliana]
 gb|ACG24243.1| hypothetical protein [Zea mays]
 gb|AEE78100.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
Length=139

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQV+VEKVG+P Q+YE+F A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ RSRAN
Sbjct  121  LQATDPTEMDLDVFRSRAN  139



>ref|XP_006418976.1| hypothetical protein EUTSA_v10002704mg [Eutrema salsugineum]
 gb|ESQ37412.1| hypothetical protein EUTSA_v10002704mg [Eutrema salsugineum]
Length=146

 Score =   259 bits (663),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP Q++E+F ASLP
Sbjct  9    ANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPVQTFEEFAASLP  68

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            ADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVEL
Sbjct  69   ADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVEL  128

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDPT M +D+ RSRAN
Sbjct  129  QATDPTEMDLDVFRSRAN  146



>gb|KDP44204.1| hypothetical protein JCGZ_05671 [Jatropha curcas]
Length=132

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKLRFLEL+AKRT+RFIVFKIEEKQKQV+VEK+GEP QSYEDFTASLPADECRY
Sbjct  1    MAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AVYDFDFVTAENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D+IRSRA+
Sbjct  121  EMGLDVIRSRAS  132



>ref|XP_009131962.1| PREDICTED: actin-depolymerizing factor 3 [Brassica rapa]
Length=139

 Score =   259 bits (662),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEE+QKQV+VEK+GEP QS++DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA++DFDFVTAENCQKSKIFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRAN
Sbjct  121  LQATDPTEMDLDIFKSRAN  139



>ref|XP_006586815.1| PREDICTED: actin-depolymerizing factor 2-like [Glycine max]
 gb|KHN40738.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+ KRTHRFIVFKIEE+QKQVIVEK+GEPAQ YEDFTASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKTKRTHRFIVFKIEEQQKQVIVEKLGEPAQGYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+++T  N  KS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>gb|AFK48761.1| unknown [Lotus japonicus]
Length=139

 Score =   259 bits (661),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANA SGMAV DDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEK+GEPA  Y+DFTASL
Sbjct  1    MANAVSGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPANGYDDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+  SR N
Sbjct  121  LQATDPTEMGLDVFNSRVN  139



>gb|ABD66508.1| actin depolymerizing factor 6 [Gossypium hirsutum]
 gb|KJB16927.1| hypothetical protein B456_002G254800 [Gossypium raimondii]
Length=139

 Score =   259 bits (661),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F EL+AKRTHRFIVFKIEEKQKQVIVEK+GEP +SYEDFT  L
Sbjct  1    MANAASGMAVHDDCKLKFQELKAKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+TAEN  KS+IFFIAWSPDTSR+RSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFLTAENVPKSRIFFIAWSPDTSRIRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_010922979.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=256

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  629  AKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTA  450
            A+MANAASGMAV+DDCKL+FLEL+AKRTHR+I+FKI+EK KQVIVEKVGEP  SYEDFTA
Sbjct  116  AEMANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVEKVGEPTLSYEDFTA  175

Query  449  SLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ  270
            +LPADECRYA+YDFDFVT ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQ
Sbjct  176  ALPADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQ  235

Query  269  VELQATDPTGMGMDLIRSRA  210
            VELQATDPT MG+D+IR RA
Sbjct  236  VELQATDPTEMGLDVIRGRA  255



>emb|CDY09242.1| BnaA02g06680D [Brassica napus]
Length=153

 Score =   259 bits (662),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  638  FSTAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYED  459
            F  +  ANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP Q+YED
Sbjct  10   FDGSGNANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPIQTYED  69

Query  458  FTASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELD  279
            F ASLPA+ECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELD
Sbjct  70   FAASLPAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELD  129

Query  278  GIQVELQATDPTGMGMDLIRSRAN  207
            GIQVELQATDPT M +D+ +SR N
Sbjct  130  GIQVELQATDPTEMDLDVFKSRVN  153



>ref|XP_004142080.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 ref|XP_004169676.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 gb|KGN54230.1| hypothetical protein Csa_4G294380 [Cucumis sativus]
Length=139

 Score =   258 bits (659),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+D+CKL+FLEL++KRTHRFIVFKIEEK KQV+VEK+G P+QSYEDF ASL
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDFVT ENCQKS+IFFIAWSPD S+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSRIFFIAWSPDDSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRAN
Sbjct  121  LQATDPTEMGLDVIRSRAN  139



>ref|XP_004294586.1| PREDICTED: actin-depolymerizing factor 2 [Fragaria vesca subsp. 
vesca]
Length=139

 Score =   258 bits (659),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG AV DDCKL+FL+L+AKRT+RFIVFKIEEK KQV+VEK+GEPAQSYE+FTASL
Sbjct  1    MANAASGFAVDDDCKLKFLDLKAKRTYRFIVFKIEEKLKQVVVEKLGEPAQSYEEFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPDTSRVR+KMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+IRSRA+
Sbjct  121  LQATDPTEMDLDVIRSRAS  139



>ref|XP_010528350.1| PREDICTED: actin-depolymerizing factor 1-like [Tarenaya hassleriana]
Length=132

 Score =   258 bits (658),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKL+FLEL+AKR HRFIVFKIEEKQKQVIVEK+G+P+QSYEDF+ASLPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRMHRFIVFKIEEKQKQVIVEKLGDPSQSYEDFSASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AVYDFDFVTAENCQKS+IFF+AWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AVYDFDFVTAENCQKSRIFFVAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D+IRSRAN
Sbjct  121  EMGLDVIRSRAN  132



>ref|XP_010096647.1| Actin-depolymerizing factor 2 [Morus notabilis]
 gb|EXB65315.1| Actin-depolymerizing factor 2 [Morus notabilis]
Length=159

 Score =   258 bits (660),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEP QSYEDFTASLP
Sbjct  22   ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQSYEDFTASLP  81

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
             +ECRYAVYD+DF+T EN QKSKI FIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL
Sbjct  82   DNECRYAVYDYDFITEENVQKSKIIFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  141

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDPT MG+D+ RSR+N
Sbjct  142  QATDPTEMGLDVFRSRSN  159



>ref|XP_009593022.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009801697.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana sylvestris]
Length=139

 Score =   258 bits (658),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEPA+SYEDF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAESYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRY V+DFDFVT E CQKSKIFFIAWSPDT++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYTVFDFDFVTEEGCQKSKIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR  
Sbjct  121  LQATDPTEMGLDVFKSRTT  139



>ref|NP_001078247.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
 gb|AEE78101.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
Length=150

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  629  AKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTA  450
            ++ ANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQV+VEKVG+P Q+YE+F A
Sbjct  10   SRSANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAA  69

Query  449  SLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ  270
             LPADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQ
Sbjct  70   CLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQ  129

Query  269  VELQATDPTGMGMDLIRSRAN  207
            VELQATDPT M +D+ RSRAN
Sbjct  130  VELQATDPTEMDLDVFRSRAN  150



>ref|XP_010426028.1| PREDICTED: actin-depolymerizing factor 1-like [Camelina sativa]
Length=139

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVH+DCKLRF+EL+AKRTHRFIV+KIEEKQKQV+VEKVGEP Q+Y+DF ASL
Sbjct  1    MANAASGMAVHEDCKLRFMELKAKRTHRFIVYKIEEKQKQVVVEKVGEPIQTYDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQA DPT M +D+ RSRAN
Sbjct  121  LQAADPTEMDLDVFRSRAN  139



>ref|XP_008442569.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis melo]
Length=139

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV DDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP QSYEDF  SL
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P+DECRYA+YDFDFVT ENCQKS+IFFIAWSPD+SRVRSKMIYASSKDRFKRELDG QVE
Sbjct  61   PSDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYASSKDRFKRELDGFQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR  
Sbjct  121  LQATDPTEMGLDVIRSRVG  139



>emb|CBI16177.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQV+VEKVGEP QSYEDFTASLPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTQSYEDFTASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AVYDFDFVT ENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AVYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D+IRSRA+
Sbjct  121  EMGLDVIRSRAS  132



>ref|XP_004307556.2| PREDICTED: uncharacterized protein LOC101301142 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -1

Query  635  STAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDF  456
            S++ MANAASGMAVHDDCKL+FL+L+AKRT+RFIV+KIEEKQKQV+VEKVGEP++SYEDF
Sbjct  304  SSSNMANAASGMAVHDDCKLKFLDLKAKRTYRFIVYKIEEKQKQVVVEKVGEPSESYEDF  363

Query  455  TASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDG  276
            +A LPADECRYAVYDFD+VT ENCQKS+I FIAWSPD SRVRSKMIYASSKDRFKRELDG
Sbjct  364  SACLPADECRYAVYDFDYVTEENCQKSRIIFIAWSPDISRVRSKMIYASSKDRFKRELDG  423

Query  275  IQVELQATDPTGMGMDLIRSRAN  207
            IQVELQATDPT MG+D+IRSRAN
Sbjct  424  IQVELQATDPTEMGLDVIRSRAN  446



>gb|EYU36258.1| hypothetical protein MIMGU_mgv1a015971mg [Erythranthe guttata]
Length=139

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHDDCKL+F+EL+ KRTHRFIVFKIEEKQKQV+VEK+GEP Q+YEDFTA+L
Sbjct  1    MANSASGMAVHDDCKLKFMELKTKRTHRFIVFKIEEKQKQVLVEKLGEPVQTYEDFTANL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT EN  KS+IFFIAWSPDT++VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTDENVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_004236758.1| PREDICTED: actin-depolymerizing factor 2 [Solanum lycopersicum]
Length=143

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFI++KIEEKQKQVIVEK+GEP +SYEDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVIVEKLGEPTESYEDFAAGL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T ENCQKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDG QVE
Sbjct  61   PADECRYAVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ RSRA 
Sbjct  121  LQATDPTEMGLDVFRSRAG  139



>gb|KCW50259.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEK+GEPA SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPANSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T EN  KS+I FIAWSPDTS+VR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFMTEENVPKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+ 
Sbjct  121  LQATDPTEMGLDVIRSRST  139



>gb|KFK27528.1| hypothetical protein AALP_AA8G395200 [Arabis alpina]
Length=139

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEE+QKQV+VEKVGEP QS++DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKVGEPGQSHDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA++DFDFVTAENCQKSKIFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SR N
Sbjct  121  LQATDPTEMDLDVFKSRVN  139



>ref|XP_009131961.1| PREDICTED: actin-depolymerizing factor 4-like [Brassica rapa]
Length=139

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQV+VEKVGEP  SYEDF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEPILSYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA+YDFDFVT ENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PAEECRYAIYDFDFVTTENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SR N
Sbjct  121  LQATDPTEMDLDVFKSRVN  139



>ref|XP_010669849.1| PREDICTED: actin-depolymerizing factor 4-like [Beta vulgaris 
subsp. vulgaris]
Length=139

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV D CKL+FLEL+ KRT+RFI+FKIEEKQKQVIVEKVGEP++SYEDFTAS+
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFTASI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAW+PDT++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWAPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDPT M +D+I+SRA
Sbjct  121  LQATDPTEMDLDVIKSRA  138



>ref|XP_004172071.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Cucumis 
sativus]
Length=138

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASG+AVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEKVGEP QSYEDF  SLP
Sbjct  1    ANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSLP  60

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            +DECRYA+YDFDFVT ENCQKS+IFFIAWSPD+SRVRSKMIYASSKDRFKRELDG QVEL
Sbjct  61   SDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYASSKDRFKRELDGFQVEL  120

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDPT MG+D+IRSR  
Sbjct  121  QATDPTEMGLDVIRSRVG  138



>ref|XP_006365713.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum]
Length=143

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFI++KIEEKQKQV+VEK+GEP +SYEDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVVVEKLGEPTESYEDFAAGL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T ENCQKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDG QVE
Sbjct  61   PADECRYAVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ RSRA 
Sbjct  121  LQATDPTEMGLDVFRSRAG  139



>ref|XP_010503215.1| PREDICTED: actin-depolymerizing factor 1-like [Camelina sativa]
Length=139

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF+EL+AKRTHRFIV+KIEEK KQV+VEKVGEP Q+Y+DF ASL
Sbjct  1    MANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKLKQVVVEKVGEPIQTYDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQA DPT M +D+ RSRAN
Sbjct  121  LQAADPTEMDLDVFRSRAN  139



>gb|KHN05922.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHD+CKL+FLEL+AKRT+R+IVFKIEEK KQVIVEK+G+PA  Y++F ASL
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRYIVFKIEEKSKQVIVEKLGDPANGYDEFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>emb|CDX71068.1| BnaC03g11520D [Brassica napus]
Length=164

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  638  FSTAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYED  459
            F     ANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEE+QKQV+VEK+GEP QS++D
Sbjct  21   FCGGVKANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDD  80

Query  458  FTASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELD  279
            F ASLPADECRYA++DFDFVTAENCQKSKIFFIAWSPDT+RVRSKMIYASSKDRFKRELD
Sbjct  81   FAASLPADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELD  140

Query  278  GIQVELQATDPTGMGMDLIRSRAN  207
            GIQVELQATDPT M +D+ +SRAN
Sbjct  141  GIQVELQATDPTEMDLDIFKSRAN  164



>emb|CDX88730.1| BnaA03g09190D [Brassica napus]
Length=154

 Score =   256 bits (655),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEE+QKQV+VEK+GEP QS++DF ASLP
Sbjct  17   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  76

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            ADECRYA++DFDFVTAENCQKSKIFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVEL
Sbjct  77   ADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVEL  136

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDPT M +D+ +SRAN
Sbjct  137  QATDPTEMDLDIFKSRAN  154



>ref|XP_009406977.1| PREDICTED: actin-depolymerizing factor 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   256 bits (654),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RF++FKI+EKQK+V+VEKVGEP+ SYEDF ASL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFVIFKIDEKQKEVVVEKVGEPSSSYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYA+YDFDFVT EN QKSKIFFIAWSPD+SRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PTDECRYAIYDFDFVTEENLQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ RSRAN
Sbjct  121  LQATDPTEMGLDVFRSRAN  139



>ref|XP_009600590.1| PREDICTED: actin-depolymerizing factor 2 [Nicotiana tomentosiformis]
 ref|XP_009798392.1| PREDICTED: actin-depolymerizing factor 2 [Nicotiana sylvestris]
Length=143

 Score =   256 bits (654),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRTHRFI++KIEEKQKQV+VEK+GEP +SYEDFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIIYKIEEKQKQVVVEKLGEPTESYEDFTAGL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T EN QKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDG QVE
Sbjct  61   PADECRYAVYDFDFTTEENVQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ RSR  
Sbjct  121  LQATDPTEMGLDVFRSRVG  139



>ref|XP_009419950.1| PREDICTED: actin-depolymerizing factor 4 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   256 bits (653),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            M+NAASGMAV+DDCKL+FLEL+AKRT+RFI+FKI+EKQKQVIV+K+GEP  +YEDF ASL
Sbjct  1    MSNAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKQKQVIVDKLGEPTLAYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVT ENCQKSKIFFIAWSPD +RVR+KM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDIARVRNKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRAN
Sbjct  121  LQATDPTEMGLDVIRSRAN  139



>ref|XP_008447631.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis melo]
Length=139

 Score =   256 bits (653),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+D+CKL+FLEL++KRTHRFIVFKIEEK KQV+VEK+G P+QSYEDF ASL
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDFVT ENCQKS+IFFIAW PD S+VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSRIFFIAWCPDDSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRAN
Sbjct  121  LQATDPTEMGLDVIRSRAN  139



>gb|AAD09110.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
Length=139

 Score =   255 bits (652),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP  +YEDF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDG QVE
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGRQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SR N
Sbjct  121  LQATDPTEMDLDVWKSRVN  139



>ref|XP_010031003.1| PREDICTED: actin-depolymerizing factor 2-like [Eucalyptus grandis]
 gb|KCW50263.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   255 bits (652),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEK+GEPA SYEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPANSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T EN  KS+I FIAWSPDTS+VR+KMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFMTEENVPKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+I+SR+ 
Sbjct  121  LQATDPTEMGLDVIKSRST  139



>gb|EYU18949.1| hypothetical protein MIMGU_mgv1a015984mg [Erythranthe guttata]
Length=139

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHDDCKL+F+EL+AKRTHRFIV+KIEEKQKQV+VEK+GEP ++YEDFTASL
Sbjct  1    MANSASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVMVEKLGEPIETYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDFVT E+ QKSKIFFIAWSPDT++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVFDFDFVTEESVQKSKIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDPT MG+D+ +SRA
Sbjct  121  LQATDPTEMGLDVFKSRA  138



>sp|Q9FVI1.1|ADF2_PETHY RecName: Full=Actin-depolymerizing factor 2; Short=ADF-2 [Petunia 
x hybrida]
 gb|AAG16974.1|AF183904_1 actin-depolymerizing factor 2 [Petunia x hybrida]
 gb|AAK72616.1| actin-depolymerizing factor 2 [Petunia x hybrida]
Length=143

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+RFI++KIEEKQK+V+VEK+GEP +SYEDFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKEVVVEKLGEPTESYEDFTAGL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T EN QKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFMTKENHQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ RSRA 
Sbjct  121  LQATDPTEMGLDVFRSRAG  139



>ref|XP_002528457.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF33940.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKR+HRFIVFKIE  QKQV+VEK+G+P  SYEDF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRSHRFIVFKIEMVQKQVVVEKLGQPTDSYEDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFD+VT ENCQKS+I FIAWSPDT++VR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFIAWSPDTAKVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+N
Sbjct  121  LQATDPTEMGLDVIRSRSN  139



>ref|XP_010669850.1| PREDICTED: actin-depolymerizing factor 4 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV D CKL+FLEL+ KRT+RFI+FKIEEKQKQVIVEKVGEP++SYEDF AS+
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFAASI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVTAENCQKS+IFFIAWSPDT++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+I+SRA
Sbjct  121  LQATDPSEMDLDVIKSRA  138



>ref|XP_009416252.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416253.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFIVFKI+EKQK+V+V+KVGEP+ +Y+DF A+L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKQKEVVVDKVGEPSSNYDDFAAAL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYA+YDFDFVT ENCQKSKIFFIAWSPD+SRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PTDECRYAIYDFDFVTEENCQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ RSRAN
Sbjct  121  LQATDPTEMGLDVFRSRAN  139



>ref|XP_006292022.1| hypothetical protein CARUB_v10018211mg [Capsella rubella]
 gb|EOA24920.1| hypothetical protein CARUB_v10018211mg [Capsella rubella]
Length=139

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKR+HRFIV+KIEEKQKQV+VEKVGEP Q+Y++F A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSHRFIVYKIEEKQKQVVVEKVGEPVQTYDEFAACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA+YDFDFVTAENCQKSKIFFI W PD ++VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PANECRYAIYDFDFVTAENCQKSKIFFITWCPDIAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ RSRAN
Sbjct  121  LQATDPTEMDLDVFRSRAN  139



>ref|XP_009420088.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFIVFKI+EK KQVIVEKVGEP   Y+DF ASL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVEKVGEPTLGYDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYA+YDFDFVT ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PNNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>emb|CDP09013.1| unnamed protein product [Coffea canephora]
Length=132

 Score =   254 bits (648),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEKVGEP QSYEDF ASLPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPGQSYEDFAASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AV+DFDFVTAENCQKS+IFFIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AVFDFDFVTAENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D+ +SRAN
Sbjct  121  EMGLDVFKSRAN  132



>ref|XP_009388628.1| PREDICTED: actin-depolymerizing factor 7 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFIVFKI+EK KQV+VEKVGEP   Y+DF+ASL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVVVEKVGEPTLGYDDFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAV+DFDFVT ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PTNECRYAVFDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|XP_009406976.1| PREDICTED: actin-depolymerizing factor 7 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=146

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAV+DDCKL+FLEL+AKRT+RF++FKI+EKQK+V+VEKVGEP+ SYEDF ASLP
Sbjct  9    ANAASGMAVNDDCKLKFLELKAKRTYRFVIFKIDEKQKEVVVEKVGEPSSSYEDFAASLP  68

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
             DECRYA+YDFDFVT EN QKSKIFFIAWSPD+SRVRSKM+YASSKDRFKRELDGIQVEL
Sbjct  69   TDECRYAIYDFDFVTEENLQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVEL  128

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDPT MG+D+ RSRAN
Sbjct  129  QATDPTEMGLDVFRSRAN  146



>ref|XP_009421345.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   253 bits (647),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFIVFKI+EK KQVIVE +GEP  +Y+DFTASL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVETLGEPNLTYDDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYA+YDFDFVT ENCQKSKIFFIAWSPDT+RVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PTNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTARVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|XP_010111772.1| Actin-depolymerizing factor 1 [Morus notabilis]
 gb|EXC31686.1| Actin-depolymerizing factor 1 [Morus notabilis]
Length=132

 Score =   253 bits (646),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHD+CKL+FLEL+AKRTHRFIV+KIEEKQKQV+VEKVGEPA+SY+DFT SLPADECRY
Sbjct  1    MAVHDECKLKFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEPAKSYDDFTGSLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            A+YDFDFVT ENCQKSKIFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AIYDFDFVTEENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D+IRSRA+
Sbjct  121  EMGLDVIRSRAS  132



>ref|XP_003594440.1| Actin depolymerizing factor [Medicago truncatula]
 gb|AES64691.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
 gb|AFK47537.1| unknown [Medicago truncatula]
Length=139

 Score =   253 bits (646),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRTHRFIV+KIEEKQKQVIVEK+GEPAQ YEDFTA L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVIVEKLGEPAQGYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+++T EN  KS+IFFI WSPDT+RVRSKMIYAS+K+RFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFEYLTEENVPKSRIFFIGWSPDTARVRSKMIYASTKERFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_004495011.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=139

 Score =   253 bits (646),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+D+CKL+FLEL+AKRT+R+I++KIEEKQKQV+V+K+GEPA  Y+DFTA+L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKLGEPANGYDDFTANL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAW PDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  121  LQATDPTEMGLDVFKSRVN  139



>ref|XP_007009413.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao]
 gb|EOY18223.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao]
Length=475

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -1

Query  668  LVGKVSLGS*FSTAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEK  489
             +G  SL S  S   MANAASGMAV DDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEK
Sbjct  322  FLGLFSLFSSLSRETMANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEK  381

Query  488  VGEPAQSYEDFTASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYAS  309
            +GEP  SYE FTASLPADECRYAVYDFDFVT ENCQKS+I FIAWSPDTS+VRSKMIYAS
Sbjct  382  LGEPTDSYEAFTASLPADECRYAVYDFDFVTEENCQKSRIIFIAWSPDTSKVRSKMIYAS  441

Query  308  SKDRFKRELDGIQVELQATDPTGMGMDLIRSRA  210
            SKDRFKRELDGIQVELQATDPT MG+D+I+SR 
Sbjct  442  SKDRFKRELDGIQVELQATDPTEMGLDVIKSRT  474



>ref|XP_008343560.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHD+CKL+FLEL+A+RT+RFIV+KIEEKQ  VIVEK+GEP  SYEDF+ASL
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVIVEKLGEPTDSYEDFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFD+VT ENCQKS+I F+AWSPDT++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIVFVAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+IRSRAN
Sbjct  121  LQATDPTEVGLDVIRSRAN  139



>ref|XP_009404611.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+DDCKL+FLEL+AKRT+RFI+FKI+EKQKQVIVEK+GEP  +Y+DFTA+L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKQKQVIVEKLGEPNLTYDDFTATL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYA+YDFDFV  ENCQKSKI FIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PTNECRYAIYDFDFVNEENCQKSKIIFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ MG+D+IR RAN
Sbjct  121  LQATDPSEMGLDVIRGRAN  139



>emb|CDX80216.1| BnaC09g35260D [Brassica napus]
Length=252

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT RFIV+KIEE+QKQV+VEK+GEP QS++DF ASL
Sbjct  114  MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  173

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDFVTAE+CQKSKIFF+AWSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  174  PADECRYAVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  233

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRAN
Sbjct  234  LQATDPTEMDLDVFKSRAN  252



>ref|XP_009120511.1| PREDICTED: actin-depolymerizing factor 3-like [Brassica rapa]
Length=139

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT RFIV+KIEE+QKQV+VEK+GEP QS++DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDFVTAE+CQKSKIFF+AWSPDT+RVRSKMIYASSKDR KRELDGIQVE
Sbjct  61   PADECRYAVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYASSKDRCKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRAN
Sbjct  121  LQATDPTEMDLDVFKSRAN  139



>gb|EPS73519.1| actin-depolymerizing factor, partial [Genlisea aurea]
Length=143

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRTHRFIV+KIEEKQKQV+VEK+GEP Q+YEDFTASL
Sbjct  5    MANAASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVVVEKLGEPTQTYEDFTASL  64

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA ECRYAVYDFDF+T +N  KS+IFFIAWSPDT++VR+KMIYASSKDRFKRELDGIQVE
Sbjct  65   PAQECRYAVYDFDFLTEDNVPKSRIFFIAWSPDTAKVRNKMIYASSKDRFKRELDGIQVE  124

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRAN
Sbjct  125  LQATDPTEMDLDVFKSRAN  143



>ref|XP_009353719.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
 ref|XP_009338379.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338380.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG AV DDCKL+FLEL+AKRT+RFIVFKI+EK+ +VIVEK+GEPA+SYEDFTA+L
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDFVTAENCQKS+IFFI WSPDT+RVR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+I+SRAN
Sbjct  121  LQATDPTEIGLDVIKSRAN  139



>ref|XP_009357677.1| PREDICTED: actin-depolymerizing factor 1 [Pyrus x bretschneideri]
Length=139

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHD+CKL+FLEL+A+RT+RFIV+KIEEKQ  V+VEK+GEP  SYEDF+ASL
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVVVEKLGEPTDSYEDFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFD+VT ENCQKS+I F+AWSPDT++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIVFVAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+IRSRAN
Sbjct  121  LQATDPTEVGLDVIRSRAN  139



>emb|CAJ38384.1| actin-depolymerizing factor [Plantago major]
Length=139

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+ KRTHRFIV+KIEEKQKQV+VE +GEP Q+YEDFTASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRTHRFIVYKIEEKQKQVMVETLGEPVQTYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFD++T +N  KS+IFF+AWSPDT+RVR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVFDFDYMTVDNVPKSRIFFVAWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_006846080.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
 gb|ERN07755.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
Length=139

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+D+CKL+FLEL+AKRT+R++VFKIEEK KQVIVEK+GEP   YE FTASL
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYVVFKIEEKLKQVIVEKLGEPTDGYEAFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDFVT ENCQKSKIFFIAWSPD ++VRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSKIFFIAWSPDIAKVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|XP_009775372.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana sylvestris]
Length=139

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHDDCKL+FLEL+ KRT+RFIVFKIEEKQKQVIVEK+GEPA+SYEDF   L
Sbjct  1    MANSASGMAVHDDCKLKFLELKTKRTYRFIVFKIEEKQKQVIVEKLGEPAESYEDFCTHL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T E+  KS+IFFIAWSPDTS+VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFLTKESVPKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_007027089.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao]
 gb|EOY07591.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao]
Length=193

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -1

Query  611  ASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADE  432
            ASGMAVHD+CKL+FLEL+AKRT+RFIVFKIEEKQKQVIVEK+GEPAQSYEDF  SLPADE
Sbjct  59   ASGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAQSYEDFAKSLPADE  118

Query  431  CRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQAT  252
            CRYAVYDFDF+T EN QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQAT
Sbjct  119  CRYAVYDFDFLTPENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQAT  178

Query  251  DPTGMGMDLIRSRAN  207
            DPT MG+D+I+SRA+
Sbjct  179  DPTEMGLDVIKSRAS  193



>gb|AFK42408.1| unknown [Lotus japonicus]
Length=139

 Score =   250 bits (638),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF+EL+AKRTHRFI++KIEEKQKQVIVEK+GEPAQ YEDF A L
Sbjct  1    MANAASGMAVHDDCKLRFVELKAKRTHRFIIYKIEEKQKQVIVEKLGEPAQGYEDFAACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+F+T  N  KS+IFF+AWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFEFLTEGNVPKSRIFFVAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+ +SR N
Sbjct  121  LQATDPTEVGLDVFKSRVN  139



>ref|XP_008233662.1| PREDICTED: uncharacterized protein LOC103332693 [Prunus mume]
Length=531

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 151/210 (72%), Gaps = 37/210 (18%)
 Frame = -1

Query  629  AKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTA  450
             KMANAASGMAVHD+CKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEKVGEPA SYEDF+A
Sbjct  347  GKMANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKVGEPADSYEDFSA  406

Query  449  SLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ  270
            SLPADECRYAVYDFD+VT ENCQKS+I FIAWSPDTS+VRSKMIYASSKDRFKRELDGIQ
Sbjct  407  SLPADECRYAVYDFDYVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQ  466

Query  269  VELQATDPTGMGMDLIRSRAN*MQQREMDR*TSDRHCKGELTAVFFTRSKCFYGL*KGKT  90
            VELQATDPT MG+D+I                      G L  ++F              
Sbjct  467  VELQATDPTEMGLDVIGG--------------------GHLYTIWF--------------  492

Query  89   WLPIIFDCQGLPYDLLLLFIL--NKICGVW  6
             L ++F   GL + LLL  I   N IC  W
Sbjct  493  -LCVLFIVCGLEFGLLLYCIAFENVICNSW  521



>ref|XP_006476590.1| PREDICTED: actin-depolymerizing factor 1-like [Citrus sinensis]
Length=139

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN++SGMAVHDDCKL+FLEL+AKR++RFIVFKIEEK +QV VEK+GEP +SYEDFTASL
Sbjct  1    MANSSSGMAVHDDCKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFF+AWSPDTSR+RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+++SRA
Sbjct  121  LQATDPSEMSLDIVKSRA  138



>gb|ACJ84098.1| unknown [Medicago truncatula]
Length=139

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRTHRFIV+KIEEKQKQVIVEK+GEPAQ YEDFTA L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVIVEKLGEPAQGYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+++T EN  KS+IFFI WSPDT+RVRSKMIYAS+K+RFK ELDGIQ+E
Sbjct  61   PADECRYAVYDFEYLTEENVPKSRIFFIGWSPDTARVRSKMIYASTKERFKGELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>gb|KJB76068.1| hypothetical protein B456_012G069600 [Gossypium raimondii]
Length=139

 Score =   249 bits (637),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGM VHDDC+L+FLEL+AKRT+ FIVFKIEEK KQVIVEK+GEP   YE FT+SL
Sbjct  1    MANAASGMVVHDDCELKFLELKAKRTYHFIVFKIEEKHKQVIVEKLGEPTDRYEAFTSSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+I FIAWSPDTS+VRSKM+YASSKDRFKREL+GIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIIFIAWSPDTSKVRSKMVYASSKDRFKRELNGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSRA 
Sbjct  121  LQATDPTEMGLDVIRSRAT  139



>ref|XP_009358343.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG AV+DDCKL+FLEL+AKRT+RFIVFKI+EK+ +VIVEK+G+PA+SYEDFTA+L
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGQPAESYEDFTANL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDFVT ENCQKS+IFF+ WSPDT+RVR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PDNECRYAVYDFDFVTVENCQKSRIFFVGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+I+SRAN
Sbjct  121  LQATDPTEIGLDVIKSRAN  139



>gb|ABC49719.1| actin depolymerizing factor-like protein [Arachis hypogaea]
Length=139

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIVFKIEE QKQVIVEK+GEPAQ YEDFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEENQKQVIVEKLGEPAQGYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDF+++T  N  KS+IFFIAWSPDTSRVR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PPNECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRAN
Sbjct  121  LQATDPTEMDLDVFKSRAN  139



>ref|XP_008357628.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=139

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG AV+DDCKL+FLEL+AKRT+RFIVFKI+EK+ +VIVEK+GEPA+SYEDFTA+L
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDFVT ENCQKS+IFF+ WSPDT+RVR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PDNECRYAVYDFDFVTVENCQKSRIFFVGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ +G+D+I+SRAN
Sbjct  121  LQATDPSEIGLDVIKSRAN  139



>ref|XP_008244913.1| PREDICTED: actin-depolymerizing factor 10 [Prunus mume]
Length=139

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHDDCKL+FLEL+AKR HRFIVFKIEEK +QVIVEKVG P +SY+DF +S+
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFASSM  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFFIAW+PDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+IR RA
Sbjct  121  LQATDPSEMSLDIIRGRA  138



>ref|XP_009337572.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANA SGMAVHD+CKL+FLEL+AKRT+RFIV+KIEEKQ +VIVEK+GEP  SYEDF+ASL
Sbjct  1    MANARSGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQNEVIVEKLGEPTDSYEDFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFD+VT ENCQKS+I F+AWSPDT++VRSKMIYASSKD FKRELDGIQ+E
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIIFVAWSPDTAKVRSKMIYASSKDTFKRELDGIQME  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+IRSRAN
Sbjct  121  LQATDPTEVGLDVIRSRAN  139



>ref|XP_007218574.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
 gb|EMJ19773.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
Length=139

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHDDCKL+FLEL+AKR HRFIVFKIEEK +QVIVEKVG P +SY+DF AS+
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFAASM  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFFIAW+PDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+I+ RA
Sbjct  121  LQATDPSEMSLDIIKGRA  138



>ref|XP_009612959.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
Length=139

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHDDCKL+FLEL+ KR +RFIVFKIEEKQKQVIVEK+GEPA+SYEDF   L
Sbjct  1    MANSASGMAVHDDCKLKFLELKTKRAYRFIVFKIEEKQKQVIVEKLGEPAESYEDFCTHL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T E+  KS+IFFIAWSPDTS+VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDFLTKESVPKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_008369858.1| PREDICTED: actin-depolymerizing factor 2-like [Malus domestica]
 ref|XP_009374666.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=139

 Score =   248 bits (634),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R IVFKIEEKQKQV+VE VGEPA++YE FT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKQKQVVVEHVGEPAETYEQFTEKL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA++DFDF+T E  QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIFDFDFLTPEGVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+I+SRA+
Sbjct  121  LQATDPTEIGLDVIKSRAS  139



>ref|XP_008385227.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Malus 
domestica]
Length=147

 Score =   248 bits (633),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -1

Query  635  STAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDF  456
            S+ + ANAASG  V DDCKL+FLEL+AKRT+RFIVFKI+EK+ +VIVEK+G PA+SYEDF
Sbjct  5    SSYEQANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAESYEDF  64

Query  455  TASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDG  276
            TA+LP +ECRYAVYDFDFVTAENCQKS+IFFI WSPDT+RVR+KMIYASSKDRFKRELDG
Sbjct  65   TANLPDNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYASSKDRFKRELDG  124

Query  275  IQVELQATDPTGMGMDLIRSRAN  207
            IQVELQATDPT +G+D+I+SRAN
Sbjct  125  IQVELQATDPTEIGLDVIKSRAN  147



>ref|XP_003637508.1| Actin-depolymerizing factor [Medicago truncatula]
 gb|AFK41269.1| unknown [Medicago truncatula]
 gb|KEH42380.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=139

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+D+CKL+FLEL+AKRT+R+I++KIEEKQKQV+V+KVG+PA  Y+DFTA+L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKVGDPANGYDDFTANL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFVT ENCQKS+IFFIAW PD SRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWCPDISRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SR N
Sbjct  121  LQATDPTEMDLDVFKSRVN  139



>ref|XP_010558792.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Tarenaya 
hassleriana]
Length=139

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG+AVH DCKLRFL+L+AKRT+R+IV+KIE +QK+VIVEK+GEP +SYEDF+A+L
Sbjct  1    MANAASGVAVHGDCKLRFLDLKAKRTYRYIVYKIEMEQKEVIVEKLGEPTESYEDFSAAL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFD+VT ENCQKS+I FIAWSPD S+VR+KMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFIAWSPDASKVRNKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+N
Sbjct  121  LQATDPTEMGLDVIRSRSN  139



>gb|KCW50261.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=132

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEK+GEP  SYEDFTASLPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPTNSYEDFTASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AVYDFD+VT ENCQKS+I FIAWSPDTS+VR+KMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AVYDFDYVTEENCQKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D+IRSR+ 
Sbjct  121  EMGLDVIRSRST  132



>ref|XP_004486422.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=139

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRT+RFI++KIEE QKQV+VEK+G+P Q YEDFTA++
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIIYKIEEAQKQVVVEKLGDPTQGYEDFTANI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+++T  N  KS+IFFI WSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFEYLTEGNVPKSRIFFIGWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  121  LQATDPTEMGLDVFKSRAN  139



>ref|XP_006436041.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|ESR49281.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|KDO67707.1| hypothetical protein CISIN_1g032498mg [Citrus sinensis]
Length=132

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAV DDCKL+FLEL+AKRT+RFIVFKIEEKQKQV+VEK+GEP+ SYE+FTASLPADECRY
Sbjct  1    MAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSDSYENFTASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AVYDFDFVT ENCQKSKI FIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AVYDFDFVTDENCQKSKIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D++RSR+N
Sbjct  121  EMGLDVMRSRSN  132



>ref|XP_007147534.1| hypothetical protein PHAVU_006G132700g [Phaseolus vulgaris]
 gb|ESW19528.1| hypothetical protein PHAVU_006G132700g [Phaseolus vulgaris]
Length=139

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIEE+QKQVIVEK+GEP Q YEDF +SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEQQKQVIVEKLGEPNQGYEDFASSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+++T  N  KS+IFFIAWSPDT+RVRSKMIYASSKDRF+RELDGIQ+E
Sbjct  61   PADECRYAVYDFEYMTEGNVPKSRIFFIAWSPDTARVRSKMIYASSKDRFRRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ M +D+ +SRAN
Sbjct  121  LQATDPSEMDLDVFKSRAN  139



>ref|XP_004306801.2| PREDICTED: actin-depolymerizing factor 10 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469032.1| PREDICTED: actin-depolymerizing factor 10 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=139

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            M+NA+SGMAVHDDCKL+FLEL+AKR HRFIVFKIEEK +QVIVEK+G P ++YEDFT S+
Sbjct  1    MSNASSGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKIGGPDETYEDFTNSI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFFI+WSPDTSRVRSKM+YASSKDRFKREL+GIQVE
Sbjct  61   PADECRYAVYDFDFTTEENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELEGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+I+ RA
Sbjct  121  LQATDPSEMSLDVIKGRA  138



>ref|XP_006439576.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
 gb|ESR52816.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
Length=140

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            AN++SGMAVHD+CKL+FLEL+AKR++RFIVFKIEEK +QV VEK+GEP +SYEDFTASLP
Sbjct  3    ANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASLP  62

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            ADECRYAVYDFDF T ENCQKSKIFF+AWSPDTSR+RSKM+YASSKDRF+RELDG+QVEL
Sbjct  63   ADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVEL  122

Query  260  QATDPTGMGMDLIRSRA  210
            QATDP+ M +D+++SRA
Sbjct  123  QATDPSEMSLDIVKSRA  139



>ref|NP_568916.2| actin depolymerizing factor 4 [Arabidopsis thaliana]
 gb|AAK91473.1| AT5g59890/mmn10_110 [Arabidopsis thaliana]
 gb|AAL90997.1| At1g05180/YUP8H12_21 [Arabidopsis thaliana]
 gb|AED97248.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
Length=132

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP  +YEDF ASLPADECRY
Sbjct  1    MAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            A+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             M +D+++SR N
Sbjct  121  EMDLDVLKSRVN  132



>gb|KFK27529.1| hypothetical protein AALP_AA8G395300 [Arabis alpina]
Length=137

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKRTHRFIV+KIE   KQV+VEKVGEP  +Y+DF ASL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIE--GKQVVVEKVGEPILTYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVE
Sbjct  59   PAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+++SR N
Sbjct  119  LQATDPTEMDLDVLKSRVN  137



>gb|ACJ84058.1| unknown [Medicago truncatula]
Length=139

 Score =   245 bits (626),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+D+CKL+FLEL+AKRT+R+I++KIEEKQKQV+V+KVG+PA  Y+DFTA+L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKVGDPANGYDDFTANL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDFV  ENCQKS+IFFIAW PD SRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVYDFDFVAEENCQKSRIFFIAWCPDISRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SR N
Sbjct  121  LQATDPTEMDLDVFKSRVN  139



>ref|XP_009374667.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score =   245 bits (626),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R IVFKIEEKQKQV+VE VGEPA++YE FT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKQKQVVVEHVGEPAETYEQFTEKL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA ECRYA++DFDF+T E  QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PAGECRYAIFDFDFLTPEGVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+I+SRA+
Sbjct  121  LQATDPTEIGLDVIKSRAS  139



>ref|XP_007206122.1| hypothetical protein PRUPE_ppa013109mg [Prunus persica]
 gb|EMJ07321.1| hypothetical protein PRUPE_ppa013109mg [Prunus persica]
Length=139

 Score =   245 bits (626),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R IVFKIEEKQKQV+VE VGEP ++YE F   L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKQKQVVVESVGEPTETYEQFAGKL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDF+T E  QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVFDFDFLTPEGVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+I+SRA+
Sbjct  121  LQATDPTEIGLDVIKSRAS  139



>gb|EPS60626.1| hypothetical protein M569_14175, partial [Genlisea aurea]
Length=150

 Score =   246 bits (627),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  632  TAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFT  453
            +A MAN+ASGMAVHDDCKL+F+EL+AKRTHRFIVFKIEEKQKQVIVEK+GEPA++YE F 
Sbjct  9    SALMANSASGMAVHDDCKLKFMELKAKRTHRFIVFKIEEKQKQVIVEKLGEPAETYESFA  68

Query  452  ASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGI  273
            ASLPA+ECRYAVYDF+F+T  N  KS+IFFIAWSPDT++VRSKMIYASSKDRFKRELDGI
Sbjct  69   ASLPAEECRYAVYDFEFLTEGNVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGI  128

Query  272  QVELQATDPTGMGMDLIRSRAN  207
            QVELQATDPT M +++ ++R N
Sbjct  129  QVELQATDPTEMSLEVFQTRVN  150



>ref|XP_002271495.1| PREDICTED: actin-depolymerizing factor 10 [Vitis vinifera]
 emb|CAN73839.1| hypothetical protein VITISV_012391 [Vitis vinifera]
Length=139

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHD+CKL+FLEL+AKR HRFIVFKI+E+ +QV+VEK+G P ++YEDFT SL
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSPDETYEDFTNSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDF T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M MD+I+ RA
Sbjct  121  LQATDPSEMSMDIIKGRA  138



>ref|XP_003629907.1| Actin depolymerizing factor-like protein [Medicago truncatula]
 gb|AET04383.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
 gb|AFK43620.1| unknown [Medicago truncatula]
Length=139

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF+EL+AKRTHRFI++KIEEKQKQVIVEK+GEP Q YE+F A L
Sbjct  1    MANAASGMAVHDDCKLRFMELKAKRTHRFIIYKIEEKQKQVIVEKLGEPVQGYEEFAACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+D++F+T  N  KS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVFDYEFMTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+ +SRA+
Sbjct  121  LQATDPTEIGLDVFKSRAS  139



>ref|XP_002877448.1| hypothetical protein ARALYDRAFT_484979 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53707.1| hypothetical protein ARALYDRAFT_484979 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRT R IV+KIE+KQ  VIVEK+GEP QSY+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRY +YDFDFVTAENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PADECRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  119  LQATDPTEMGLDVFKSRTN  137



>ref|XP_002468086.1| hypothetical protein SORBIDRAFT_01g039300 [Sorghum bicolor]
 gb|EER95084.1| hypothetical protein SORBIDRAFT_01g039300 [Sorghum bicolor]
Length=139

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV DDCK +FLEL+AKRT+RF+VFKIEEKQKQV+V+K+GEP  +Y+DF A+L
Sbjct  1    MANAASGMAVDDDCKRKFLELKAKRTYRFVVFKIEEKQKQVVVDKLGEPNLTYDDFAATL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRY VYDFDFVT E CQKSKIFFIAWSPDT+++RSKM+YASSK+RFKRELDGIQVE
Sbjct  61   PADECRYCVYDFDFVTEEGCQKSKIFFIAWSPDTAKIRSKMLYASSKERFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGIDVIRGRAN  139



>ref|XP_002864657.1| hypothetical protein ARALYDRAFT_332260 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40916.1| hypothetical protein ARALYDRAFT_332260 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQVIVEKVGEP  +YEDF ASLPA+ECRY
Sbjct  1    MAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASLPAEECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            A+YDFDFVTAENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             M +D+++SR N
Sbjct  121  EMDLDVLKSRVN  132



>ref|XP_008371032.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANA SGMAVHD+CK++FLEL+AKRT+RFIV+KIEEKQ +VIVEK+G+P  SYEDF+ASL
Sbjct  1    MANARSGMAVHDECKIKFLELKAKRTYRFIVYKIEEKQNEVIVEKLGQPTDSYEDFSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFD+VT ENC+KS+I F+AWSPDT++VRSKMIYASSKD FKRELDGIQ+E
Sbjct  61   PANECRYAVYDFDYVTEENCRKSRIXFVAWSPDTAKVRSKMIYASSKDTFKRELDGIQME  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT +G+D+IRSRAN
Sbjct  121  LQATDPTEVGLDVIRSRAN  139



>ref|XP_008393892.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
 ref|XP_008353979.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKR  RFIVFKIEEK +QVIVEK+G P +SY+DF+AS+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRNFRFIVFKIEEKIQQVIVEKLGGPDESYDDFSASM  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFFIAW+PDTSRVRSKM+YASSKDRFKREL+GIQVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELEGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+I+ RA
Sbjct  121  LQATDPSEMSLDIIKGRA  138



>ref|XP_008387742.1| PREDICTED: actin-depolymerizing factor 2-like [Malus domestica]
Length=158

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT+R IVFKIEEKQKQV+VE VGEPA++YE FT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKQKQVVVEHVGEPAETYEQFTEKL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA++DFDF+T E  QKS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIFDFDFLTPEGVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDPT +G+++I SRA
Sbjct  121  LQATDPTEIGLEVIWSRA  138



>ref|NP_566882.1| actin depolymerizing factor 2 [Arabidopsis thaliana]
 sp|Q39251.1|ADF2_ARATH RecName: Full=Actin-depolymerizing factor 2; Short=ADF-2; Short=AtADF2 
[Arabidopsis thaliana]
 gb|AAK43859.1|AF370482_1 actin depolymerizing factor 2; ADF2 [Arabidopsis thaliana]
 gb|AAK62370.1|AF386925_1 actin depolymerizing factor 2 [Arabidopsis thaliana]
 gb|AAB03697.1| actin depolymerizing factor 2 [Arabidopsis thaliana]
 gb|AAL47369.1| actin depolymerizing factor 2 (ADF2) [Arabidopsis thaliana]
 gb|AAN15696.1| actin depolymerizing factor 2 [Arabidopsis thaliana]
 gb|AEE78099.1| actin depolymerizing factor 2 [Arabidopsis thaliana]
Length=137

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRT R IV+KIE+KQ  VIVEK+GEP QSY+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PAD+CRY +YDFDFVTAENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PADDCRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  119  LQATDPTEMGLDVFKSRTN  137



>ref|NP_851227.1| actin depolymerizing factor 3 [Arabidopsis thaliana]
 sp|Q9ZSK4.1|ADF3_ARATH RecName: Full=Actin-depolymerizing factor 3; Short=ADF-3; Short=AtADF3 
[Arabidopsis thaliana]
 gb|AAK25879.1|AF360169_1 putative actin depolymerizing factor 3 [Arabidopsis thaliana]
 gb|AAD09109.1| actin depolymerizing factor 3 [Arabidopsis thaliana]
 dbj|BAB08356.1| actin depolymerizing factor 3 [Arabidopsis thaliana]
 gb|AAK91351.1| AT5g59880/mmn10_100 [Arabidopsis thaliana]
 gb|AAL07194.1| putative actin depolymerizing factor 3 [Arabidopsis thaliana]
 gb|AAM16189.1| AT5g59880/mmn10_100 [Arabidopsis thaliana]
 gb|AAM63276.1| actin depolymerizing factor 3-like protein [Arabidopsis thaliana]
 gb|AED97245.1| actin depolymerizing factor 3 [Arabidopsis thaliana]
Length=139

 Score =   243 bits (619),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+ KRTHRFI++KIEE QKQVIVEK+GEP Q++ED  ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRTHRFIIYKIEELQKQVIVEKIGEPGQTHEDLAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA++DFDFV++E   +S+IFF+AWSPDT+RVRSKMIYASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAIFDFDFVSSEGVPRSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRAN
Sbjct  121  LQATDPTEMDLDVFKSRAN  139



>ref|XP_010503214.1| PREDICTED: actin-depolymerizing factor 2 [Camelina sativa]
Length=137

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRT R IV+KIE++Q  VIVEK+GEP Q+Y+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDRQ--VIVEKLGEPEQTYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRY +YDFDFVTAENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PADECRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  119  LQATDPTEMGLDVFKSRTN  137



>emb|CDX71067.1| BnaC03g11510D [Brassica napus]
Length=132

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKLRFLEL+AKRTHRFIV+KIEEKQKQV+VEKVGEP  SYEDF ASLPA+ECRY
Sbjct  1    MAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEPVLSYEDFAASLPAEECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            A+YDFDFVT ENCQKSKIFFIAW PD ++VRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AIYDFDFVTTENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             M +D+ +SR N
Sbjct  121  EMDLDVFKSRVN  132



>gb|KFK33962.1| hypothetical protein AALP_AA5G084200 [Arabis alpina]
Length=137

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FL+L+AKRT RFIV+KIE+KQ  VIV+K+GEP +SYEDF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLDLKAKRTFRFIVYKIEDKQ--VIVDKLGEPDKSYEDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYA+YDFDFVT ENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTAKVRMKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR  
Sbjct  119  LQATDPTEMGLDVFKSRTT  137



>ref|XP_010534301.1| PREDICTED: actin-depolymerizing factor 1-like [Tarenaya hassleriana]
Length=139

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASG+AVHDDCKLRFL+L+AKRT+R++V+KIE  QKQV+VEK+GEP +SYE F ASL
Sbjct  1    MANAASGVAVHDDCKLRFLDLKAKRTYRYVVYKIEMDQKQVVVEKLGEPTESYEAFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFD+VT ENCQKS+I F+AWSPD S+VR+KMIYASSKDRFKREL+GIQ+E
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFVAWSPDESKVRNKMIYASSKDRFKRELEGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IRSR+ 
Sbjct  121  LQATDPTEMGLDVIRSRST  139



>ref|XP_009150048.1| PREDICTED: actin-depolymerizing factor 2 [Brassica rapa]
Length=137

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT R IV+KIE+KQ  VIVEK+GEP QSY+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYA+YDFDFVT ENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PENECRYAIYDFDFVTEENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  119  LQATDPTEMGLDVFKSRTN  137



>ref|XP_006843593.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
 gb|ERN05268.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
Length=139

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHD+CKLRFLEL+ KR+HRFIVFKI+EK +QV+VEK+G+P  +Y+DF ASL
Sbjct  1    MANSASGMAVHDNCKLRFLELKTKRSHRFIVFKIDEKIQQVMVEKLGQPNDTYDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAV+DFDFVT ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQ+E
Sbjct  61   PPDECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQLE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ + MD+I+ RA
Sbjct  121  LQATDPSELSMDIIKGRA  138



>ref|XP_008457551.1| PREDICTED: actin-depolymerizing factor 2 [Cucumis melo]
 gb|ADN34239.1| actin depolymerizing factor-like protein [Cucumis melo subsp. 
melo]
Length=139

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+ KRT+RFIV+KIEEKQKQV VEKVGEP QSYEDFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTYRFIVYKIEEKQKQVTVEKVGEPGQSYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+F+T  N  KS+IFFIAWSPDTS+VRSKMIYASSKD+F+RELDGIQ+E
Sbjct  61   PADECRYAVYDFEFLTEGNVPKSRIFFIAWSPDTSKVRSKMIYASSKDKFRRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+ +SRA
Sbjct  121  LQATDPSEMDLDVFKSRA  138



>ref|XP_006292028.1| hypothetical protein CARUB_v10018217mg [Capsella rubella]
 gb|EOA24926.1| hypothetical protein CARUB_v10018217mg [Capsella rubella]
Length=137

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRT R IV+KIE+KQ  VIVEK+GEP QSY+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRY +YD+DFVTAENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PAEECRYCIYDYDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  119  LQATDPTEMGLDVFKSRTN  137



>gb|AFK39900.1| unknown [Lotus japonicus]
 gb|AFK46679.1| unknown [Lotus japonicus]
Length=137

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF+EL+ KRT+RFIV+KIE+KQ  VIVEK+GEP Q YEDFTA+L
Sbjct  1    MANAASGMAVHDDCKLRFMELKTKRTYRFIVYKIEDKQ--VIVEKLGEPGQGYEDFTANL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+++T  N  KS+IFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  59   PADECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  119  LQATDPTEMGLDVFKSRAN  137



>ref|XP_004504229.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=146

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 7/146 (5%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTA--  450
            MANAASGMAVHDDCKLRFLEL+AKRTHRFI++KIEE QKQVIVEK+GEP Q YEDF A  
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIIYKIEENQKQVIVEKLGEPIQGYEDFAACL  60

Query  449  -----SLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRE  285
                 +LPADECRYAVYDF+F+T  N  KS+IFFIAWSPDTSRVR+KMIYASSKDRFKRE
Sbjct  61   PAFPANLPADECRYAVYDFEFLTEGNVPKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRE  120

Query  284  LDGIQVELQATDPTGMGMDLIRSRAN  207
            LDGIQ+ELQATDPT +G+D+ ++RAN
Sbjct  121  LDGIQIELQATDPTEIGLDVFKTRAN  146



>ref|XP_010455704.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
 ref|XP_010443774.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
 ref|XP_010483636.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
Length=139

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+ KRT+RFIV+KIEE+QKQV+VEK+GEP QS+ED  ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRTYRFIVYKIEEQQKQVMVEKIGEPNQSHEDLAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDF+TAE+  KS+IFF+AWSPDT+RVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PADECRYAVFDFDFLTAEDVPKSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D  +SRA 
Sbjct  121  LQATDPTEMDLDTFKSRAT  139



>gb|AAR23800.1| putative actin-depolymerizing factor 2 [Helianthus annuus]
Length=139

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHD+CKL+F++L+AKRTHRFI++KIEEKQKQV+VEKVGEPAQ+Y++F A L
Sbjct  1    MANAASGMAVHDECKLKFMDLKAKRTHRFIIYKIEEKQKQVMVEKVGEPAQTYDEFAACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAV+D+DF+T E  QKS+IFFIAWSPDT+RVR+KMIYASSKDRFKRELDGIQVE
Sbjct  61   PENECRYAVFDYDFLTPEGVQKSRIFFIAWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATD + MG+D+I+SRAN
Sbjct  121  LQATDASEMGLDVIQSRAN  139



>emb|CBI40336.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  626  KMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTAS  447
             MAN+ASGMAVHD+CKL+FLEL+AKR HRFIVFKI+E+ +QV+VEK+G P ++YEDFT S
Sbjct  117  NMANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSPDETYEDFTNS  176

Query  446  LPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQV  267
            LPADECRYAV+DFDF T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQV
Sbjct  177  LPADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQV  236

Query  266  ELQATDPTGMGMDLIRSRA  210
            ELQATDP+ M MD+I+ RA
Sbjct  237  ELQATDPSEMSMDIIKGRA  255



>ref|XP_010514925.1| PREDICTED: actin-depolymerizing factor 2-like [Camelina sativa]
Length=137

 Score =   241 bits (614),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRT R IV+KIE++Q  V+VEK+GEP QSY+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDRQ--VVVEKLGEPEQSYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRY +YDFDFVTAENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PEDECRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  119  LQATDPTEMGLDVFKSRTN  137



>ref|XP_010662752.1| PREDICTED: actin-depolymerizing factor 1 [Vitis vinifera]
Length=139

 Score =   241 bits (614),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAV+D+CKL+FLEL+AKR HRFIVFKIEEK +QV+VEK+G P +SY+ FT+SL
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIEEKIQQVVVEKLGSPDESYDAFTSSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAV+DFDF T ENCQKSKIFFIAW+PDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVFDFDFTTDENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+++SRA
Sbjct  121  LQATDPSEMSLDIVKSRA  138



>emb|CDX99133.1| BnaA06g18240D [Brassica napus]
Length=167

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = -1

Query  635  STAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDF  456
            S + +ANAASGMAVHDDCKL+FLEL+AKRT R IV+KIE+KQ  VIVEK+GEP QSY+DF
Sbjct  27   SESVLANAASGMAVHDDCKLKFLELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDF  84

Query  455  TASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDG  276
             ASLP +ECRYA+YDFDFVT ENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDG
Sbjct  85   AASLPDNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDG  144

Query  275  IQVELQATDPTGMGMDLIRSRAN  207
            IQVELQATDPT MG+D+ +SR N
Sbjct  145  IQVELQATDPTEMGLDVFKSRTN  167



>gb|KDO76170.1| hypothetical protein CISIN_1g046281mg, partial [Citrus sinensis]
Length=133

 Score =   240 bits (613),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN++SGMAVHD+CKL+FLEL+AKR++RFIVFKIEEK +QV VEK+GEP +SYEDFTASL
Sbjct  1    MANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFF+AWSPDTSR+RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVE  120

Query  263  LQATDPTGMGMDL  225
            LQATDP+ M +D+
Sbjct  121  LQATDPSEMSLDI  133



>gb|KCW50264.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=132

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKL+FLEL+AKRT+RFIV+KIEEKQKQVIVEK+GEPA SYEDFTASLPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPANSYEDFTASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AVYDFDF+T EN  KS+I FIAWSPDTS+VR+KMIYASSKDRFKRELDGIQ+ELQATDPT
Sbjct  61   AVYDFDFMTEENVPKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQIELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D+I+SR+ 
Sbjct  121  EMGLDVIKSRST  132



>ref|XP_010426027.1| PREDICTED: actin-depolymerizing factor 2-like [Camelina sativa]
Length=137

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKRT R IV+KIE++Q  VIVEK+GEP Q+Y+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDRQ--VIVEKLGEPEQTYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRY +YDFDFVTAENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PEDECRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  119  LQATDPTEMGLDVFKSRTN  137



>ref|XP_010249803.1| PREDICTED: actin-depolymerizing factor [Nelumbo nucifera]
Length=139

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAV+DDCKL+FLEL+AKR +RFIVFKI+EK +QV+VE++G P +SYEDFTA L
Sbjct  1    MANSASGMAVNDDCKLKFLELKAKRNYRFIVFKIDEKIQQVMVERLGNPEESYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAV+DFDF T ENCQKSKIFFIAWSPDTS+VRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M MD+I+ RA
Sbjct  121  LQATDPSEMSMDIIKGRA  138



>ref|XP_006281290.1| hypothetical protein CARUB_v10027340mg [Capsella rubella]
 gb|EOA14188.1| hypothetical protein CARUB_v10027340mg [Capsella rubella]
Length=139

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+ KR++R+IV+KIEE+QKQVIVEK+GEPA+++ED  ASL
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRSYRYIVYKIEEQQKQVIVEKIGEPAETHEDLAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA ECRYAV+DFDF+TAE+  KS+IFF+AWSPDT+RVRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PAHECRYAVFDFDFLTAEDVPKSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRAN
Sbjct  121  LQATDPTEMDLDVFKSRAN  139



>emb|CDY31586.1| BnaA10g12850D [Brassica napus]
Length=132

 Score =   240 bits (612),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKL+FLEL+AKRT RFIV+KIEE+QKQV+VEK+GEP QS++DF ASLPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AV+DFDFVTAE+CQKSKIFF+AWSPDT+RVRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             M +D+ +SRAN
Sbjct  121  EMDLDVFKSRAN  132



>ref|XP_004149045.1| PREDICTED: actin-depolymerizing factor 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004149046.1| PREDICTED: actin-depolymerizing factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004171741.1| PREDICTED: actin-depolymerizing factor 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004171742.1| PREDICTED: actin-depolymerizing factor 2-like isoform 2 [Cucumis 
sativus]
 gb|KGN65663.1| hypothetical protein Csa_1G480180 [Cucumis sativus]
Length=139

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+ KRT+R+IV+KIEEKQKQV VEK+GEP QSYEDFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTYRYIVYKIEEKQKQVTVEKLGEPGQSYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDF+F+T  N  KS+IFFIAWSPDTS+VRSKMIYASSKD+F+RELDGIQ+E
Sbjct  61   PADECRYAVYDFEFLTEGNVPKSRIFFIAWSPDTSKVRSKMIYASSKDKFRRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+ +SRA
Sbjct  121  LQATDPSEMDLDVFKSRA  138



>ref|XP_004953378.1| PREDICTED: actin-depolymerizing factor 1-like [Setaria italica]
Length=139

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            M+N+ASGMAV D+CKL+FLEL+AKR+ RFIVFKI EK +QV+V+++GEP +SYEDFTA L
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGEPGESYEDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDFVT ENCQKSKIFFI+W+PDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M MD+I+SRA
Sbjct  121  LQATDPSEMSMDIIKSRA  138



>ref|XP_006418977.1| hypothetical protein EUTSA_v10002714mg [Eutrema salsugineum]
 gb|ESQ37413.1| hypothetical protein EUTSA_v10002714mg [Eutrema salsugineum]
Length=137

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKRT R IV+KIE+KQ  VIVEK+GEP QSY+DF ASL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRY +YDFDFVT ENCQKSKIFFIAWSPDT++VR KMIYASSKDRFKRELDGIQVE
Sbjct  59   PDNECRYCIYDFDFVTEENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SR N
Sbjct  119  LQATDPTEMGLDVFKSRTN  137



>ref|XP_004984753.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Setaria 
italica]
Length=139

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV DDCK RFLEL+AKRT+RF+VF+I+E+QKQV+VEK+GEP  +Y+ F A L
Sbjct  1    MANAASGMAVDDDCKRRFLELKAKRTYRFVVFRIDEEQKQVVVEKLGEPNLTYDVFAAIL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRY +YDFDFVT E CQKSKIFFIAWSPDT+++RSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYCIYDFDFVTEEGCQKSKIFFIAWSPDTAKIRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+IR RAN
Sbjct  121  LQATDPTEMGLDVIRGRAN  139



>ref|XP_006367965.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum]
Length=136

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKL+FLEL+AKRT+RFI++KIEEKQKQV+VEK+GEP +S+EDF A LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVVVEKLGEPTESHEDFAAGLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AVYDFDF+T ENCQKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDG QVELQATDPT
Sbjct  61   AVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             MG+D+ RSRA 
Sbjct  121  EMGLDVFRSRAG  132



>emb|CDX86048.1| BnaC03g55630D [Brassica napus]
Length=167

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = -1

Query  635  STAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDF  456
            S + +ANAASGMAVHDDCKL+FLEL+AKRT R IV+KIE+KQ  VIVEK+GEP QSY+DF
Sbjct  27   SESVLANAASGMAVHDDCKLKFLELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDF  84

Query  455  TASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDG  276
             ASLP +ECRYA+YDFDFVT ENCQKSKIFFIAWSPDT++VR KMIYASSKDRFK+ELDG
Sbjct  85   AASLPDNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKKELDG  144

Query  275  IQVELQATDPTGMGMDLIRSRAN  207
            IQVELQATDPT MG+D+ +SR N
Sbjct  145  IQVELQATDPTEMGLDVFKSRTN  167



>ref|XP_011080987.1| PREDICTED: actin-depolymerizing factor-like [Sesamum indicum]
Length=139

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGM+VHD+CKLRFL+L+AKR +RFI+FKIEEK +QV+VEK+G+P + YEDF++SL
Sbjct  1    MANSASGMSVHDECKLRFLDLKAKRNYRFIIFKIEEKIQQVVVEKLGQPEEGYEDFSSSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P +ECRYAVYDFDF+T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDG QVE
Sbjct  61   PDNECRYAVYDFDFITDENCQKSKIFFIAWSPDTSRVRSKMVYASSKDRFKRELDGTQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQAT+P+ M +D+++SRA
Sbjct  121  LQATEPSEMSIDIVKSRA  138



>ref|XP_008438059.1| PREDICTED: actin-depolymerizing factor 7-like [Cucumis melo]
Length=139

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN++SGMAVHD+CKL+FL+L+AKR +RFIVFKIEEK +QV VEKVG P ++Y+DFTAS+
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVEKVGGPDETYDDFTASI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDF T ENCQKSKI+FIAWSPD+SR+RSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDFDFTTEENCQKSKIYFIAWSPDSSRIRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M  D+I+SRA
Sbjct  121  LQATDPSEMSFDIIKSRA  138



>ref|XP_010053689.1| PREDICTED: actin-depolymerizing factor [Eucalyptus grandis]
 gb|KCW78051.1| hypothetical protein EUGRSUZ_D02275 [Eucalyptus grandis]
Length=139

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAV+D+CKL+FLEL+AKR HRFIVFKI+EK +QV VEKVG P ++Y+DFTA +
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIDEKIQQVSVEKVGSPEETYDDFTACM  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAV+DFDF+T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVFDFDFITDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+I+ RA
Sbjct  121  LQATDPSEMSIDIIKGRA  138



>ref|XP_002439159.1| hypothetical protein SORBIDRAFT_09g001500 [Sorghum bicolor]
 gb|EES17589.1| hypothetical protein SORBIDRAFT_09g001500 [Sorghum bicolor]
Length=139

 Score =   238 bits (608),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV DDCK RFLEL+AKRTHRFI++KI+EK+K V+VE+VGEP  +Y+DF ASL
Sbjct  1    MANAASGMAVDDDCKRRFLELKAKRTHRFIIYKIDEKKKMVVVEQVGEPVLNYDDFAASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYA++D+DFVT ENCQKSKIFFIAWSPDT+RVRSKMIYASSK+RFKRELDGIQVE
Sbjct  61   PANECRYAIFDYDFVTEENCQKSKIFFIAWSPDTARVRSKMIYASSKERFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATD   +G+D+I+ RAN
Sbjct  121  LQATDSAEVGLDVIQGRAN  139



>ref|XP_003524462.1| PREDICTED: actin-depolymerizing factor 7-like [Glycine max]
 gb|KHN23656.1| Actin-depolymerizing factor 7 [Glycine soja]
Length=169

 Score =   239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 8/159 (5%)
 Frame = -1

Query  668  LVGKVSLGS*FS------TAKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQK  507
            L+  +SL S F+        KMANAASGMAVHDDCKLRF EL++KR++RFIVFKIEE+Q 
Sbjct  12   LLPWLSLHSHFAGRFFLIAGKMANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ-  70

Query  506  QVIVEKVGEPAQSYEDFTASLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRS  327
             V+VEK+G+P +SYEDF AS PA+ECRYAVYDFDF TAENCQKSKIFF+AWSPDTS+VR 
Sbjct  71   -VVVEKLGDPTESYEDFMASFPANECRYAVYDFDFTTAENCQKSKIFFVAWSPDTSKVRM  129

Query  326  KMIYASSKDRFKRELDGIQVELQATDPTGMGMDLIRSRA  210
            KM+YASSKDRFKRELDGIQV++QATDP+ M +DL+++RA
Sbjct  130  KMVYASSKDRFKRELDGIQVDMQATDPSEMSLDLVKARA  168



>ref|XP_011029243.1| PREDICTED: actin-depolymerizing factor isoform X2 [Populus euphratica]
Length=139

 Score =   238 bits (608),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAV D+CKLRF+EL+AKR+HRFIVFKIEEK +QV+VE +GEP QSY+DFTASL
Sbjct  1    MANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDF T EN QKSKIFF+AWSPDTS++RSKM+YASS+DRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSKMLYASSRDRFRRELDGVQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+++ RA
Sbjct  121  LQATDPSEMSLDIVKERA  138



>gb|AET05009.2| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=137

 Score =   238 bits (607),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 127/138 (92%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF EL++KR++RFIVFKIEE+Q  V+VEK+GEP+ SY+DF AS 
Sbjct  1    MANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ--VVVEKLGEPSDSYDDFMASF  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKI+F+AWSPDTSRVR KM+YASSKDRFKRELDGIQVE
Sbjct  59   PADECRYAVYDFDFTTNENCQKSKIYFVAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D++++RA
Sbjct  119  LQATDPSEMSLDIVKARA  136



>gb|KDP25456.1| hypothetical protein JCGZ_20612 [Jatropha curcas]
Length=139

 Score =   238 bits (606),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHDDCKL+F EL+AKR++RFIVFKIEE  +QV VEK+G+P QSYEDFTASL
Sbjct  1    MANSASGMAVHDDCKLKFQELKAKRSYRFIVFKIEEGIQQVTVEKLGKPQQSYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAV+DFDF T EN QKSKIFFIAWSPDTSRVRSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDFDFTTNENVQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ M  D+++ RA+
Sbjct  121  LQATDPSEMSFDIVQGRAH  139



>emb|CDP00056.1| unnamed protein product [Coffea canephora]
Length=135

 Score =   237 bits (605),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  602  MAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLPADECRY  423
            MAVHDDCKL+FLEL+AKRT+RFI++KIEEKQKQVIVEK+GEPA  YE+FTA+LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVIVEKLGEPANGYEEFTANLPADECRY  60

Query  422  AVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPT  243
            AVYD+DF+T EN  KS+IFFIAWSPDTS+VRSKMIYASSKDRFKRELDGIQVELQATDPT
Sbjct  61   AVYDYDFMTEENVPKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVELQATDPT  120

Query  242  GMGMDLIRSRAN  207
             +G+D+I+SRA 
Sbjct  121  EIGLDVIKSRAG  132



>ref|XP_008794195.1| PREDICTED: actin-depolymerizing factor-like [Phoenix dactylifera]
Length=139

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAV+D+CKL+FLEL+ KR  RFI+FKI+EK +QV VEK+G+P +SY+DFTASL
Sbjct  1    MANSASGMAVNDECKLKFLELKTKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDFVT ENCQKSKIFFI+WSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+++ RA
Sbjct  121  LQATDPSEMSLDIVKGRA  138



>ref|XP_004240732.1| PREDICTED: actin-depolymerizing factor 7 [Solanum lycopersicum]
Length=137

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 127/138 (92%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+AKR +RFI+FKI+   +QV+VEK+G P +SYEDFT +L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRIYRFIIFKID--AQQVVVEKLGNPEESYEDFTNAL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDFVT ENCQKSKIFFIAWSP+TS+VR KM+YASSKDRFKRE+DGIQVE
Sbjct  59   PADECRYAVFDFDFVTNENCQKSKIFFIAWSPETSKVRMKMVYASSKDRFKREIDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDPT M +D+I+SRA
Sbjct  119  LQATDPTEMSLDIIKSRA  136



>ref|XP_004503768.1| PREDICTED: actin-depolymerizing factor 7-like [Cicer arietinum]
Length=137

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF EL++KR++RFIVFKIEE+Q  V+VEK+GEP++SY+DF AS 
Sbjct  1    MANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ--VVVEKLGEPSESYDDFMASF  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFF AWSPDTSRVR KM+YASSKDRFKRELDGIQVE
Sbjct  59   PADECRYAVYDFDFTTDENCQKSKIFFYAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+++ RA
Sbjct  119  LQATDPSEMSLDIVKGRA  136



>ref|XP_002303579.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011022717.1| PREDICTED: actin-depolymerizing factor 1-like [Populus euphratica]
 gb|EEE78558.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAV+D CKLRFLEL+AKR+HRFIVFKIEEK +QV+VE +GEP QSY+DFTASL
Sbjct  1    MANSASGMAVNDGCKLRFLELKAKRSHRFIVFKIEEKTQQVVVETLGEPQQSYDDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAVYDFDF T EN QKSKIFF+AWSPD S++RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PIDECRYAVYDFDFTTDENVQKSKIFFVAWSPDASKIRSKMLYASSKDRFRRELDGVQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ + +D+++ RA
Sbjct  121  LQATDPSEISLDIVKERA  138



>ref|XP_004240356.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum lycopersicum]
 ref|XP_006367788.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum]
Length=137

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 125/139 (90%), Gaps = 2/139 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+ KR  RFIVFKIEEKQ  +IVEK+GEPA+SYEDF   L
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRAFRFIVFKIEEKQ--IIVEKLGEPAESYEDFCTHL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T E+  KS+IFFIAW PDTS+VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  59   PADECRYAVYDFDFLTKESVPKSRIFFIAWCPDTSKVRSKMIYASSKDRFKRELDGIQIE  118

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT MG+D+ +SRAN
Sbjct  119  LQATDPTEMGLDVFKSRAN  137



>ref|NP_001047657.1| Os02g0663800 [Oryza sativa Japonica Group]
 sp|Q6EUH7.1|ADF1_ORYSJ RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=OsADF1 
[Oryza sativa Japonica Group]
 dbj|BAD27692.1| putative actin-depolymerizing factor [Oryza sativa Japonica Group]
 dbj|BAF09571.1| Os02g0663800 [Oryza sativa Japonica Group]
 dbj|BAG91513.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            M+N+ASGMAV D+CKL+FLEL+AKR+ RFIVFKI EK +QV+V+++G+P +SY+DFTA L
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFTACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDFVT ENCQKSKIFFI+W+PDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M MD+++SRA
Sbjct  121  LQATDPSEMSMDIVKSRA  138



>ref|XP_004984752.1| PREDICTED: actin-depolymerizing factor 7-like isoform X1 [Setaria 
italica]
Length=155

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAV DDCK RFLEL+AKRT+RF+VF+I+E+QKQV+VEK+GEP  +Y+ F A LP
Sbjct  18   ANAASGMAVDDDCKRRFLELKAKRTYRFVVFRIDEEQKQVVVEKLGEPNLTYDVFAAILP  77

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            ADECRY +YDFDFVT E CQKSKIFFIAWSPDT+++RSKM+YASSKDRFKRELDGIQVEL
Sbjct  78   ADECRYCIYDFDFVTEEGCQKSKIFFIAWSPDTAKIRSKMLYASSKDRFKRELDGIQVEL  137

Query  260  QATDPTGMGMDLIRSRAN  207
            QATDPT MG+D+IR RAN
Sbjct  138  QATDPTEMGLDVIRGRAN  155



>ref|XP_002298043.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011029242.1| PREDICTED: actin-depolymerizing factor isoform X1 [Populus euphratica]
 gb|EEE82848.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=141

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            AN+ASGMAV D+CKLRF+EL+AKR+HRFIVFKIEEK +QV+VE +GEP QSY+DFTASLP
Sbjct  4    ANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASLP  63

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            A+ECRYAVYDFDF T EN QKSKIFF+AWSPDTS++RSKM+YASS+DRF+RELDG+QVEL
Sbjct  64   ANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSKMLYASSRDRFRRELDGVQVEL  123

Query  260  QATDPTGMGMDLIRSRA  210
            QATDP+ M +D+++ RA
Sbjct  124  QATDPSEMSLDIVKERA  140



>ref|XP_004302775.1| PREDICTED: actin-depolymerizing factor 3-like [Fragaria vesca 
subsp. vesca]
Length=139

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+FLEL+ KRT+R IVFKIEEKQKQVIVE  G+PAQ+YE FT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTYRSIVFKIEEKQKQVIVEATGDPAQTYEAFTDSL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAV+DFDF+T E   KS+IFFIAWSPDTSRVR+KMIYASSKDRFKRELDGIQ+E
Sbjct  61   PTDECRYAVFDFDFLTPEGVPKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATD + +G+D+I+SRA+
Sbjct  121  LQATDSSEIGLDVIKSRAS  139



>ref|XP_008392560.1| PREDICTED: actin-depolymerizing factor 7-like [Malus domestica]
Length=137

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRFLEL+AKR++RFI++KIE  Q+Q++++K+GEP +SYEDFTAS 
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSYRFILYKIE--QQQIVIDKLGEPNESYEDFTASF  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFFIAWSPDTS+VR KM+YASSKDRFKRELDGI  E
Sbjct  59   PADECRYAVYDFDFTTEENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKRELDGISFE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+++ RA
Sbjct  119  LQATDPSEMSLDIVKGRA  136



>ref|XP_002509779.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF51166.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   236 bits (601),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN++SGMAV+D+CKL+FLEL+AKR++RFIVFKIEEK +QV VEK+G+P +SYEDFTASL
Sbjct  1    MANSSSGMAVNDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGQPQESYEDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYD DF T EN QKSKIFF+AWSPDTS+VRSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDLDFTTNENVQKSKIFFVAWSPDTSKVRSKMLYASSKDRFRRELDGVQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M  D++++RA
Sbjct  121  LQATDPSEMSFDIVKARA  138



>ref|XP_002864656.1| hypothetical protein ARALYDRAFT_496124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40915.1| hypothetical protein ARALYDRAFT_496124 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score =   236 bits (601),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF+EL+ KRT+RFIV+KIEE+QKQV+VEK+GEPA+++E   A L
Sbjct  1    MANAASGMAVHDDCKLRFMELKTKRTYRFIVYKIEEQQKQVVVEKIGEPAETHEALAACL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P+DECRYAV+DFDF+TAE+  KS+IFF+AWSPDT++VRSKMIYASSKDRFKRELDGIQ+E
Sbjct  61   PSDECRYAVFDFDFLTAEDVPKSRIFFVAWSPDTAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDPT M +D+ +SRA 
Sbjct  121  LQATDPTEMDLDVFKSRAT  139



>gb|KHN16833.1| Actin-depolymerizing factor 7, partial [Glycine soja]
Length=169

 Score =   236 bits (603),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 128/140 (91%), Gaps = 2/140 (1%)
 Frame = -1

Query  629  AKMANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTA  450
             KMAN ASGMAVHDDCKLRF EL++KR++RFIVFKIEE+Q  V+VEK+G+P +SYEDF A
Sbjct  31   GKMANVASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ--VVVEKLGDPTESYEDFMA  88

Query  449  SLPADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQ  270
            S PA+ECRYAVYDFDF T+ENCQKSKIFF+AWSPDTS+VR KM+YASSKDRFKRELDGIQ
Sbjct  89   SFPANECRYAVYDFDFTTSENCQKSKIFFVAWSPDTSKVRMKMVYASSKDRFKRELDGIQ  148

Query  269  VELQATDPTGMGMDLIRSRA  210
            V++QATDP+ M +DL+++RA
Sbjct  149  VDMQATDPSEMSLDLVKARA  168



>ref|XP_002892045.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68304.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGM V DDCKL+FLEL+AKR +RFIVFKI+EK +QV+++K+G P ++Y+DFT S+
Sbjct  1    MANSASGMHVSDDCKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAVYDFDF T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ M +D+I+ R N
Sbjct  121  LQATDPSEMSLDIIKGRVN  139



>ref|XP_010672167.1| PREDICTED: actin-depolymerizing factor 10 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   235 bits (600),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAV+D+CKL+F+EL+AKR HRFIVFKIEEKQ+QV+VEK+G P ++YEDF  +L
Sbjct  1    MANAASGMAVNDECKLKFMELKAKRNHRFIVFKIEEKQQQVMVEKIGNPDETYEDFANAL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYD+DF T +NCQKSKIFF AWSPD SRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDYDFTTKDNCQKSKIFFFAWSPDASRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSR  213
            LQATDP+ M  D+++ R
Sbjct  121  LQATDPSEMSFDIVKGR  137



>gb|KGN56524.1| hypothetical protein Csa_3G122480 [Cucumis sativus]
Length=139

 Score =   235 bits (600),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN++SGMAVHD+CKL+FL+L+AKR +RFIVFKIEEK +QV V+KVG P ++Y+DFTAS+
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVDKVGGPDETYDDFTASI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYD++F T ENCQKSKI+FIAWSPD+SR+RSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVYDYNFTTNENCQKSKIYFIAWSPDSSRIRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M  D+I+SRA
Sbjct  121  LQATDPSEMSFDIIKSRA  138



>ref|XP_003630533.1| Actin depolymerizing factor [Medicago truncatula]
Length=143

 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 126/137 (92%), Gaps = 2/137 (1%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAVHDDCKLRF EL++KR++RFIVFKIEE+Q  V+VEK+GEP+ SY+DF AS P
Sbjct  8    ANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ--VVVEKLGEPSDSYDDFMASFP  65

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            ADECRYAVYDFDF T ENCQKSKI+F+AWSPDTSRVR KM+YASSKDRFKRELDGIQVEL
Sbjct  66   ADECRYAVYDFDFTTNENCQKSKIYFVAWSPDTSRVRMKMVYASSKDRFKRELDGIQVEL  125

Query  260  QATDPTGMGMDLIRSRA  210
            QATDP+ M +D++++RA
Sbjct  126  QATDPSEMSLDIVKARA  142



>gb|KJB33315.1| hypothetical protein B456_006G198000, partial [Gossypium raimondii]
Length=136

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 126/137 (92%), Gaps = 2/137 (1%)
 Frame = -1

Query  620  ANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASLP  441
            ANAASGMAV D+CKL+FLEL+AKR +RFIVFKI+E+Q  V+VEKVG P ++YEDFTA+LP
Sbjct  1    ANAASGMAVDDECKLKFLELKAKRNYRFIVFKIQEQQ--VVVEKVGSPQETYEDFTAALP  58

Query  440  ADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  261
            ADECRYAV+DFDF T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVEL
Sbjct  59   ADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMVYASSKDRFKRELDGIQVEL  118

Query  260  QATDPTGMGMDLIRSRA  210
            QATDP+ M  D+I++RA
Sbjct  119  QATDPSEMSFDIIKARA  135



>ref|XP_003532683.1| PREDICTED: actin-depolymerizing factor 7-like [Glycine max]
Length=137

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 127/138 (92%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN ASGMAVHDDCKLRF EL++KR++RFIVFKIEE+Q  V+VEK+G+P +SYEDF AS 
Sbjct  1    MANVASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ--VVVEKLGDPTESYEDFMASF  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDF T+ENCQKSKIFF+AWSPDTS+VR KM+YASSKDRFKRELDGIQV+
Sbjct  59   PANECRYAVYDFDFTTSENCQKSKIFFVAWSPDTSKVRMKMVYASSKDRFKRELDGIQVD  118

Query  263  LQATDPTGMGMDLIRSRA  210
            +QATDP+ M +DL+++RA
Sbjct  119  MQATDPSEMSLDLVKARA  136



>ref|XP_008804935.1| PREDICTED: actin-depolymerizing factor isoform X2 [Phoenix dactylifera]
Length=139

 Score =   235 bits (599),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAV+D+CKL+FLEL+AKR  RFI+FKI+EK +QV VEK+G+P +SY+DFTASL
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAV+DFDFVT ENCQKSKI FI+WSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIIFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+++ RA
Sbjct  121  LQATDPSEMSLDIVKGRA  138



>ref|XP_007038697.1| Actin depolymerizing factor 7 [Theobroma cacao]
 gb|EOY23198.1| Actin depolymerizing factor 7 [Theobroma cacao]
Length=137

 Score =   235 bits (599),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 128/138 (93%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHD+CKL+FLEL+AKR +RFIVFKI+++Q  V+V+KVG P ++Y+DF ASL
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNYRFIVFKIQDQQ--VVVDKVGSPQETYDDFQASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDF+T+ENCQKSKIFFIAWSPDTS+VRSKM+YASSKDRFKRELDGIQVE
Sbjct  59   PADECRYAVFDFDFITSENCQKSKIFFIAWSPDTSKVRSKMVYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M  D+I+ RA
Sbjct  119  LQATDPSEMSFDIIKGRA  136



>gb|KDP22276.1| hypothetical protein JCGZ_26107 [Jatropha curcas]
Length=137

 Score =   235 bits (599),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAVHDDCKL+FLEL+AKR +RFI FKIE++Q  VI++K+G P Q+Y+DFTASL
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNYRFITFKIEDQQ--VIIDKLGTPQQTYDDFTASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAV+DFDF T ENCQKSKIFFIAWSPDTSRVR KM+YASSKDRFKRELDGIQVE
Sbjct  59   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+I+ RA
Sbjct  119  LQATDPSEMSLDIIKGRA  136



>ref|NP_171680.1| actin depolymerizing factor 11 [Arabidopsis thaliana]
 sp|Q9LQ81.1|ADF10_ARATH RecName: Full=Actin-depolymerizing factor 10; Short=ADF-10; Short=AtADF10 
[Arabidopsis thaliana]
 gb|AAF78408.1|AC009273_14 Contains similarity to actin depolymerizing factor 4 from Arabidopsis 
thaliana gb|AF102822. It contains cofilin/tropomyosin-type 
actin-binding proteins PF|00241. EST gb|AA720247 comes 
from this gene [Arabidopsis thaliana]
 gb|AAL62402.1| actin depolymerizing factor, putative [Arabidopsis thaliana]
 gb|AAM65844.1| Actin-depolymerizing factor like At1g01750 (ADF-like) [Arabidopsis 
thaliana]
 gb|AAN65137.1| actin depolymerizing factor, putative [Arabidopsis thaliana]
 gb|AEE27331.1| actin depolymerizing factor 11 [Arabidopsis thaliana]
Length=140

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGM V D+CKL+FLEL+AKR +RFIVFKI+EK +QV+++K+G P ++YEDFT S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYEDFTRSI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAVYD+DF T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PEDECRYAVYDYDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ M +D+I+ R N
Sbjct  121  LQATDPSEMSLDIIKGRVN  139



>ref|XP_003538360.1| PREDICTED: actin-depolymerizing factor 7-like isoform X1 [Glycine 
max]
Length=137

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 125/138 (91%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKLRF EL+AKR +RFI FKIE  Q+QV+V+K+GE  +SY+DF ASL
Sbjct  1    MANAASGMAVHDDCKLRFQELKAKRVYRFITFKIE--QQQVVVDKIGESTESYDDFQASL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF T ENCQKSKIFFIAWSPDTS+VR KM+YASSKDRFKRELDGIQV+
Sbjct  59   PADECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKRELDGIQVD  118

Query  263  LQATDPTGMGMDLIRSRA  210
            +QATDP+ M +DL+++RA
Sbjct  119  MQATDPSEMSLDLVKARA  136



>ref|XP_006304638.1| hypothetical protein CARUB_v10011760mg [Capsella rubella]
 gb|EOA37536.1| hypothetical protein CARUB_v10011760mg [Capsella rubella]
Length=140

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGM V D+CKL+FLEL+AKR +RFIVFKI+EK +QV+++K+G P ++Y+DFT S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            P DECRYAVYDFDF T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRFKRELDGIQVE
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  263  LQATDPTGMGMDLIRSRAN  207
            LQATDP+ M +D+I+ R N
Sbjct  121  LQATDPSEMSLDIIKGRVN  139



>ref|XP_006490391.1| PREDICTED: actin-depolymerizing factor 7-like [Citrus sinensis]
Length=137

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F+EL+AKR +RFI+FKI+   +QV+VEK+G P  SY+DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRNYRFIIFKID--NQQVVVEKLGSPGDSYDDFTTSL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAVYDFDF+T ENCQKSKIFFIAWSPD S+VRSKM+YASSKDRFKRELDGIQ E
Sbjct  59   PADECRYAVYDFDFITHENCQKSKIFFIAWSPDPSKVRSKMVYASSKDRFKRELDGIQFE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+I+ RA
Sbjct  119  LQATDPSEMSLDIIKERA  136



>ref|XP_007040194.1| Actin depolymerizing factor 8 [Theobroma cacao]
 gb|EOY24695.1| Actin depolymerizing factor 8 [Theobroma cacao]
Length=139

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN+ASGMAV+D+CK +FLEL+AKR++RFIVFKIEEK +QV+VEK+G P+ SY+D +ASL
Sbjct  1    MANSASGMAVNDECKRKFLELKAKRSYRFIVFKIEEKIQQVVVEKLGGPSDSYDDLSASL  60

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDF T ENCQKSKIFFIAWSPDTSRVRSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M  D+++ RA
Sbjct  121  LQATDPSEMSFDIVKGRA  138



>ref|XP_004511586.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Cicer 
arietinum]
Length=137

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHDDCKL+F EL+AKR++RFIVFKIE  Q+QV+++K+GEP ++YEDF A L
Sbjct  1    MANAASGMAVHDDCKLKFQELKAKRSYRFIVFKIE--QQQVVIDKIGEPTETYEDFQACL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDF TAENCQKSKI+FIAWSP+ SRVR KM+YASSKDRFKRELDGIQVE
Sbjct  59   PADECRYAVFDFDFTTAENCQKSKIYFIAWSPEISRVRMKMVYASSKDRFKRELDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+++ RA
Sbjct  119  LQATDPSEMSLDIVKGRA  136



>ref|XP_006363318.1| PREDICTED: actin-depolymerizing factor 7-like [Solanum tuberosum]
Length=137

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 127/138 (92%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MANAASGMAVHD+CKL+FLEL+AKR +RFI+FKI+   +QV+VEK+G P ++YEDFT +L
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRIYRFIIFKID--AQQVVVEKLGNPEETYEDFTNAL  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PADECRYAV+DFDFVT ENCQKSKIFFIAWSPDTS+VR KM+YASSKDRFKRE+DGIQVE
Sbjct  59   PADECRYAVFDFDFVTNENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKREIDGIQVE  118

Query  263  LQATDPTGMGMDLIRSRA  210
            LQATDP+ M +D+I++RA
Sbjct  119  LQATDPSEMSLDIIKARA  136



>gb|ACU23570.1| unknown [Glycine max]
Length=137

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -1

Query  623  MANAASGMAVHDDCKLRFLELRAKRTHRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  444
            MAN ASGMAVHDDCKLRF EL++KR++RFIVFKIEE+Q  V+VEK+G+P +SYEDF AS 
Sbjct  1    MANVASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ--VVVEKLGDPTESYEDFMASF  58

Query  443  PADECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  264
            PA+ECRYAVYDFDF T+ENCQKSKIFF+AWSPDTS+VR KM+YASSKDRFKRELDGIQV+
Sbjct  59   PANECRYAVYDFDFTTSENCQKSKIFFVAWSPDTSKVRMKMVYASSKDRFKRELDGIQVD  118

Query  263  LQATDPTGMGMDLIRSRA  210
            +QATDP+ M  DL+++RA
Sbjct  119  MQATDPSEMSSDLVKARA  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395