BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002A19

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KGN57492.1|  hypothetical protein Csa_3G199050                     65.9    4e-16   Cucumis sativus [cucumbers]
ref|XP_004140811.1|  PREDICTED: alpha-L-fucosidase 2-like             65.5    5e-16   
ref|XP_008456176.1|  PREDICTED: alpha-L-fucosidase 2                  65.1    6e-16   Cucumis melo [Oriental melon]
ref|XP_002527475.1|  conserved hypothetical protein                   60.1    6e-12   
ref|XP_011088198.1|  PREDICTED: alpha-L-fucosidase 2 isoform X2       74.3    1e-11   
ref|XP_007157223.1|  hypothetical protein PHAVU_002G053000g           52.4    5e-11   Phaseolus vulgaris [French bean]
ref|XP_006486970.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  71.6    8e-11   Citrus sinensis [apfelsine]
gb|KDO47950.1|  hypothetical protein CISIN_1g003571mg                 71.2    8e-11   Citrus sinensis [apfelsine]
ref|XP_009592476.1|  PREDICTED: alpha-L-fucosidase 2                  70.5    2e-10   
gb|KDO47957.1|  hypothetical protein CISIN_1g003571mg                 69.7    2e-10   Citrus sinensis [apfelsine]
gb|KDO47956.1|  hypothetical protein CISIN_1g003571mg                 70.1    2e-10   Citrus sinensis [apfelsine]
ref|XP_006422890.1|  hypothetical protein CICLE_v10027838mg           69.7    3e-10   Citrus clementina [clementine]
ref|XP_006589631.1|  PREDICTED: alpha-L-fucosidase 2-like             67.0    3e-10   Glycine max [soybeans]
emb|CDO97236.1|  unnamed protein product                              69.7    3e-10   Coffea canephora [robusta coffee]
ref|XP_011088197.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1       69.3    4e-10   Sesamum indicum [beniseed]
ref|XP_009800211.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1       69.3    4e-10   Nicotiana sylvestris
ref|XP_009800220.1|  PREDICTED: alpha-L-fucosidase 2 isoform X2       69.3    4e-10   Nicotiana sylvestris
ref|XP_011030387.1|  PREDICTED: alpha-L-fucosidase 2-like             68.6    6e-10   Populus euphratica
ref|XP_010028398.1|  PREDICTED: alpha-L-fucosidase 2-like             68.6    6e-10   Eucalyptus grandis [rose gum]
ref|XP_002298754.2|  hypothetical protein POPTR_0001s30620g           67.8    1e-09   
ref|XP_010090595.1|  hypothetical protein L484_002038                 64.7    1e-09   
ref|XP_011457799.1|  PREDICTED: alpha-L-fucosidase 2-like             67.8    1e-09   Fragaria vesca subsp. vesca
ref|XP_007042561.1|  1,2-alpha-L-fucosidases                          67.4    2e-09   
emb|CAN67724.1|  hypothetical protein VITISV_006023                   63.5    2e-09   Vitis vinifera
ref|XP_004292088.2|  PREDICTED: alpha-L-fucosidase 2                  66.6    3e-09   Fragaria vesca subsp. vesca
gb|KJB47348.1|  hypothetical protein B456_008G022200                  66.6    3e-09   Gossypium raimondii
gb|KJB47346.1|  hypothetical protein B456_008G022200                  66.2    3e-09   Gossypium raimondii
gb|KJB47347.1|  hypothetical protein B456_008G022200                  66.2    3e-09   Gossypium raimondii
dbj|BAK06893.1|  predicted protein                                    65.9    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008787125.1|  PREDICTED: alpha-L-fucosidase 2                  65.9    5e-09   Phoenix dactylifera
gb|KHN42345.1|  Alpha-L-fucosidase 2                                  65.9    6e-09   Glycine soja [wild soybean]
ref|XP_010936549.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  65.5    6e-09   
gb|AES92246.2|  alpha-L-fucosidase                                    65.5    6e-09   Medicago truncatula
ref|XP_003610049.1|  Macrophage migration inhibitory factor-like ...  65.5    6e-09   
ref|XP_010936550.1|  PREDICTED: alpha-L-fucosidase 2-like             65.1    8e-09   
ref|XP_003536603.1|  PREDICTED: alpha-L-fucosidase 2-like             65.1    9e-09   Glycine max [soybeans]
ref|XP_010271389.1|  PREDICTED: alpha-L-fucosidase 2                  65.1    9e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010936547.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  65.1    1e-08   Elaeis guineensis
ref|XP_009335951.1|  PREDICTED: alpha-L-fucosidase 2                  64.7    1e-08   Pyrus x bretschneideri [bai li]
gb|KCW55141.1|  hypothetical protein EUGRSUZ_I01092                   64.7    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010936540.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  64.3    2e-08   Elaeis guineensis
dbj|BAF85832.1|  alpha-1,2-fucosidase                                 64.3    2e-08   Lilium longiflorum [Easter lily]
ref|XP_007200942.1|  hypothetical protein PRUPE_ppa001398mg           63.9    2e-08   Prunus persica
ref|XP_010437645.1|  PREDICTED: alpha-L-fucosidase 2-like             63.9    2e-08   Camelina sativa [gold-of-pleasure]
gb|KDP44439.1|  hypothetical protein JCGZ_16272                       63.9    2e-08   Jatropha curcas
ref|XP_008236396.1|  PREDICTED: alpha-L-fucosidase 2                  63.9    2e-08   Prunus mume [ume]
ref|XP_010447114.1|  PREDICTED: alpha-L-fucosidase 2-like             63.9    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006422893.1|  hypothetical protein CICLE_v10027816mg           63.9    2e-08   Citrus clementina [clementine]
ref|XP_010936539.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  63.9    2e-08   Elaeis guineensis
ref|XP_006486972.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  63.9    2e-08   Citrus sinensis [apfelsine]
ref|XP_006849299.1|  hypothetical protein AMTR_s00167p00034910        63.9    2e-08   Amborella trichopoda
ref|XP_006486973.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  63.9    2e-08   
gb|KDO47958.1|  hypothetical protein CISIN_1g003209mg                 63.9    2e-08   Citrus sinensis [apfelsine]
ref|XP_006422892.1|  hypothetical protein CICLE_v10027816mg           63.5    2e-08   Citrus clementina [clementine]
gb|EMS61938.1|  Alpha-L-fucosidase 2                                  63.5    3e-08   Triticum urartu
gb|KEH44060.1|  alpha-L-fucosidase-like protein                       63.5    3e-08   Medicago truncatula
ref|XP_004172907.1|  PREDICTED: alpha-L-fucosidase 2-like             63.5    3e-08   
ref|XP_006829279.1|  hypothetical protein AMTR_s00001p00272880        63.5    3e-08   
ref|XP_006412250.1|  hypothetical protein EUTSA_v10024398mg           63.2    4e-08   Eutrema salsugineum [saltwater cress]
ref|XP_007143071.1|  hypothetical protein PHAVU_007G041400g           63.2    4e-08   Phaseolus vulgaris [French bean]
ref|XP_008338241.1|  PREDICTED: alpha-L-fucosidase 2                  63.2    4e-08   Malus domestica [apple tree]
gb|KCW55138.1|  hypothetical protein EUGRSUZ_I01091                   62.8    5e-08   Eucalyptus grandis [rose gum]
ref|XP_006661702.1|  PREDICTED: alpha-L-fucosidase 2-like             62.8    5e-08   Oryza brachyantha
ref|XP_010647956.1|  PREDICTED: alpha-L-fucosidase 2                  62.8    5e-08   Vitis vinifera
emb|CBI22509.3|  unnamed protein product                              62.8    5e-08   Vitis vinifera
ref|XP_006605983.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  62.8    5e-08   Glycine max [soybeans]
ref|XP_002869161.1|  hypothetical protein ARALYDRAFT_912968           62.8    6e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_006283241.1|  hypothetical protein CARUB_v10004274mg           62.4    6e-08   
ref|XP_010432442.1|  PREDICTED: alpha-L-fucosidase 2                  62.8    6e-08   Camelina sativa [gold-of-pleasure]
gb|KCW55139.1|  hypothetical protein EUGRSUZ_I01092                   62.4    6e-08   Eucalyptus grandis [rose gum]
ref|XP_003555969.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  62.4    6e-08   Glycine max [soybeans]
ref|XP_010028395.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  62.4    6e-08   Eucalyptus grandis [rose gum]
ref|XP_011001337.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  62.4    7e-08   Populus euphratica
ref|XP_010547973.1|  PREDICTED: alpha-L-fucosidase 2                  62.4    7e-08   Tarenaya hassleriana [spider flower]
ref|XP_008338239.1|  PREDICTED: alpha-L-fucosidase 2-like             62.4    7e-08   
ref|XP_009344361.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X3  62.4    7e-08   
ref|XP_006605984.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X3  62.4    7e-08   Glycine max [soybeans]
ref|XP_011001328.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  62.4    8e-08   Populus euphratica
ref|XP_009344358.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  62.4    8e-08   
ref|XP_006605982.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X5  62.0    8e-08   Glycine max [soybeans]
ref|XP_006605979.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  62.4    8e-08   Glycine max [soybeans]
ref|XP_009345064.1|  PREDICTED: alpha-L-fucosidase 2-like             62.4    8e-08   Pyrus x bretschneideri [bai li]
ref|XP_006605981.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X4  62.0    8e-08   Glycine max [soybeans]
gb|KHN42346.1|  Alpha-L-fucosidase 2                                  62.0    9e-08   Glycine soja [wild soybean]
ref|XP_006605980.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X3  62.0    9e-08   Glycine max [soybeans]
ref|XP_003555281.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  62.0    9e-08   Glycine max [soybeans]
gb|KHG11389.1|  hypothetical protein F383_14795                       62.0    1e-07   Gossypium arboreum [tree cotton]
gb|KDP44440.1|  hypothetical protein JCGZ_16273                       61.6    1e-07   Jatropha curcas
ref|XP_002527476.1|  conserved hypothetical protein                   61.6    1e-07   Ricinus communis
ref|XP_009421189.1|  PREDICTED: alpha-L-fucosidase 2-like             61.6    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004496923.1|  PREDICTED: alpha-L-fucosidase 2-like             61.2    2e-07   Cicer arietinum [garbanzo]
gb|KFK30063.1|  hypothetical protein AALP_AA7G211900                  61.2    2e-07   Arabis alpina [alpine rockcress]
ref|XP_002313154.2|  hypothetical protein POPTR_0009s09690g           61.2    2e-07   
ref|XP_010691648.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-L-fuco...  61.2    2e-07   
emb|CAB36703.1|  hypothetical protein                                 61.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69041.1|  BnaC01g04120D                                        60.8    2e-07   
ref|NP_195152.2|  alpha-L-fucosidase 2                                60.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114732.1|  PREDICTED: alpha-L-fucosidase 2                  60.8    2e-07   Brassica rapa
gb|AID60138.1|  altered xyloglucan 8                                  60.8    2e-07   Brassica napus [oilseed rape]
gb|ABG66022.1|  large secreted protein, putative, expressed           60.5    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79728.1|  hypothetical protein OsI_21058                        60.5    3e-07   Oryza sativa Indica Group [Indian rice]
dbj|BAK07299.1|  predicted protein                                    59.3    6e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT05101.1|  Alpha-L-fucosidase 2                                  59.3    7e-07   
ref|XP_002313157.1|  hypothetical protein POPTR_0009s09650g           58.9    1e-06   
ref|XP_010691649.1|  PREDICTED: alpha-L-fucosidase 2-like             58.2    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004983274.1|  PREDICTED: alpha-L-fucosidase 2-like             58.2    2e-06   Setaria italica
ref|XP_011001318.1|  PREDICTED: alpha-L-fucosidase 2-like             58.2    2e-06   Populus euphratica
ref|XP_003560237.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  57.4    3e-06   Brachypodium distachyon [annual false brome]
tpg|DAA46849.1|  TPA: hypothetical protein ZEAMMB73_390456            57.4    3e-06   
tpg|DAA46848.1|  TPA: hypothetical protein ZEAMMB73_390456            57.4    3e-06   
tpg|DAA46850.1|  TPA: hypothetical protein ZEAMMB73_390456            57.4    3e-06   
ref|XP_009421188.1|  PREDICTED: alpha-L-fucosidase 2-like             57.4    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008659917.1|  PREDICTED: alpha-L-fucosidase 2 isoform X2       57.4    3e-06   Zea mays [maize]
ref|XP_008659908.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1       57.4    4e-06   Zea mays [maize]
ref|XP_006662275.1|  PREDICTED: alpha-L-fucosidase 2-like             57.4    4e-06   
gb|EMT23862.1|  Alpha-L-fucosidase 2                                  57.0    4e-06   
gb|EEC66760.1|  hypothetical protein OsI_33136                        57.0    4e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_007042562.1|  1,2-alpha-L-fucosidases                          57.0    4e-06   
gb|ABB47227.1|  large secreted protein, putative, expressed           57.0    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAK98716.1|AC090483_6  Hypothetical protein                        57.0    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010238647.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  56.6    6e-06   Brachypodium distachyon [annual false brome]
gb|KJB47342.1|  hypothetical protein B456_008G022000                  56.6    6e-06   Gossypium raimondii
gb|KJB47344.1|  hypothetical protein B456_008G022000                  56.2    7e-06   Gossypium raimondii
gb|KJB47343.1|  hypothetical protein B456_008G022000                  56.2    7e-06   Gossypium raimondii
ref|XP_010105050.1|  Alpha-L-fucosidase 2                             56.2    8e-06   Morus notabilis
ref|XP_003573887.1|  PREDICTED: alpha-L-fucosidase 2-like             55.8    1e-05   Brachypodium distachyon [annual false brome]
ref|WP_010136352.1|  alpha-L-fucosidase                               39.3    1e-05   Ochrovirga pacifica
gb|EYU37618.1|  hypothetical protein MIMGU_mgv1a001249mg              55.1    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_004983275.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  55.1    2e-05   Setaria italica
dbj|BAJ85441.1|  predicted protein                                    55.1    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95753.1|  predicted protein                                    55.1    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004983276.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  55.1    2e-05   Setaria italica
gb|EMS55421.1|  Alpha-L-fucosidase 2                                  55.1    2e-05   Triticum urartu
ref|WP_028918567.1|  alpha/beta hydrolase                             40.4    3e-05   Pseudoxanthomonas suwonensis
ref|WP_040490657.1|  alpha-L-fucosidase                               38.5    4e-05   Indibacter alkaliphilus
gb|EMT27959.1|  Alpha-L-fucosidase 2                                  54.3    4e-05   
gb|EOZ92828.1|  putative large secreted protein                       38.1    4e-05   Indibacter alkaliphilus LW1
ref|WP_024868166.1|  alpha/beta hydrolase                             40.4    4e-05   Pseudoxanthomonas suwonensis
ref|WP_013225834.1|  large protein                                    39.7    6e-05   Amycolatopsis mediterranei
ref|WP_026461510.1|  alpha-L-fucosidase                               38.9    8e-05   Adhaeribacter aquaticus
ref|XP_002298755.2|  hypothetical protein POPTR_0001s30610g           53.1    9e-05   
ref|XP_011030378.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X1  53.1    1e-04   Populus euphratica
ref|XP_011030379.1|  PREDICTED: alpha-L-fucosidase 2-like isoform X2  53.1    1e-04   Populus euphratica
ref|WP_038555047.1|  alpha-L-fucosidase                               37.7    1e-04   Draconibacterium orientale
ref|WP_035042325.1|  alpha/beta hydrolase                             52.0    2e-04   Caulobacter henricii
ref|WP_036926624.1|  alpha-L-fucosidase                               38.1    2e-04   Prevotella sp. MSX73
gb|EJP32702.1|  hypothetical protein HMPREF1146_1457                  38.1    2e-04   Prevotella sp. MSX73
ref|WP_004345058.1|  possible alpha-L-fucosidase                      38.1    2e-04   Prevotella buccae
ref|WP_004341109.1|  alpha-L-fucosidase 2 (Alpha-L-fucosidefucohy...  38.1    2e-04   Prevotella buccae
ref|WP_008505004.1|  alpha-L-fucosidase                               42.0    3e-04   Mucilaginibacter paludis
ref|WP_009100280.1|  large secreted protein                           51.2    4e-04   
ref|WP_016195425.1|  putative large secreted protein                  35.8    4e-04   Arcticibacter svalbardensis
ref|WP_009099629.1|  large secreted protein                           51.2    4e-04   Rhodopirellula sp. SWK7
ref|WP_039131678.1|  alpha-L-fucosidase                               38.1    4e-04   Flavihumibacter sp. ZG627
dbj|GAM00488.1|  putative alpha-L-fucosidase                          37.0    5e-04   Sphingomonas parapaucimobilis NBRC 15100
ref|WP_042485754.1|  twin-arginine translocation pathway signal p...  37.0    5e-04   
ref|WP_035071140.1|  alpha/beta hydrolase                             50.8    5e-04   Caulobacter henricii
emb|CDA84488.1|  uncharacterized protein BN772_02910                  37.0    6e-04   Bacteroides sp. CAG:754
ref|WP_035089140.1|  alpha/beta hydrolase                             50.8    6e-04   
ref|WP_042162232.1|  alpha-L-fucosidase                               50.4    6e-04   
ref|WP_028040060.1|  alpha/beta hydrolase                             50.4    6e-04   Caulobacter sp. URHA0033
ref|WP_029915324.1|  alpha/beta hydrolase                             50.4    6e-04   Caulobacter sp. UNC358MFTsu5.1
ref|XP_006573903.1|  PREDICTED: alpha-L-fucosidase 2-like             50.4    7e-04   Glycine max [soybeans]
gb|KHN30427.1|  Alpha-L-fucosidase 2                                  50.4    7e-04   Glycine soja [wild soybean]
gb|KJF45155.1|  alpha-L-fucosidase                                    35.0    7e-04   Draconibacterium sediminis
ref|WP_016277426.1|  hypothetical protein                             50.4    8e-04   Bacteroides sartorii
ref|WP_025017572.1|  alpha-L-fucosidase                               50.4    8e-04   Bacteroides sartorii
ref|WP_035657048.1|  alpha-L-fucosidase                               35.4    8e-04   Flavobacterium seoulense
ref|WP_019945641.1|  hypothetical protein                             38.9    9e-04   Dyadobacter beijingensis
ref|WP_026713979.1|  alpha-L-fucosidase                               35.0    0.001   Flavobacterium daejeonense



>gb|KGN57492.1| hypothetical protein Csa_3G199050 [Cucumis sativus]
Length=845

 Score = 65.9 bits (159),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            L ++ DTLWTG P DYT+ DAP+AL +VRKLVDDG+YA+ATE
Sbjct  85   LQLNEDTLWTGTPADYTNPDAPEALREVRKLVDDGKYAEATE  126


 Score = 46.2 bits (108),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGGV +E L LN
Sbjct  62   TDAIPIGNGRLGAMVWGGVDTEILQLN  88



>ref|XP_004140811.1| PREDICTED: alpha-L-fucosidase 2-like [Cucumis sativus]
Length=803

 Score = 65.5 bits (158),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            L ++ DTLWTG P DYT+ DAP+AL +VRKLVDDG+YA+ATE
Sbjct  43   LQLNEDTLWTGTPADYTNPDAPEALREVRKLVDDGKYAEATE  84


 Score = 46.2 bits (108),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGGV +E L LN
Sbjct  20   TDAIPIGNGRLGAMVWGGVDTEILQLN  46



>ref|XP_008456176.1| PREDICTED: alpha-L-fucosidase 2 [Cucumis melo]
Length=845

 Score = 65.1 bits (157),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            L ++ DTLWTG P +YT+ DAP+AL +VRKLVDDG+YA+ATE +
Sbjct  85   LQLNEDTLWTGTPANYTNPDAPQALREVRKLVDDGKYAEATEAA  128


 Score = 45.8 bits (107),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGGV +E L LN
Sbjct  62   TDAIPIGNGRLGAMVWGGVDTEILQLN  88



>ref|XP_002527475.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34873.1| conserved hypothetical protein [Ricinus communis]
Length=840

 Score = 60.1 bits (144),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            + ++ DTLWTG+PG+YT+ +A +AL++VRKLVDDG YA+AT  S
Sbjct  60   IQLNEDTLWTGVPGNYTNPNALEALSEVRKLVDDGLYAEATAAS  103


 Score = 37.7 bits (86),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +D++PIGN R+GAM+ GG+ SE + LN
Sbjct  37   TDSIPIGNGRIGAMISGGMQSEIIQLN  63



>ref|XP_011088198.1| PREDICTED: alpha-L-fucosidase 2 isoform X2 [Sesamum indicum]
Length=806

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 41/61 (67%), Gaps = 11/61 (18%)
 Frame = -3

Query  528  WFGAVLHLRLSISTD-----------TLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQA  382
            WFGAVL  RL ISTD           TLWTG PGDYTD DAP  L+ VRKLVDDGQYA A
Sbjct  13   WFGAVLPTRLLISTDWGFSFSLDAEDTLWTGTPGDYTDPDAPNTLSKVRKLVDDGQYADA  72

Query  381  T  379
            T
Sbjct  73   T  73



>ref|XP_007157223.1| hypothetical protein PHAVU_002G053000g [Phaseolus vulgaris]
 gb|ESW29217.1| hypothetical protein PHAVU_002G053000g [Phaseolus vulgaris]
Length=825

 Score = 52.4 bits (124),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            + ++ DTLWTG P DYT+  AP+AL+ VR LV+  QY QAT
Sbjct  42   IHLNEDTLWTGTPADYTNSKAPQALSRVRNLVNRQQYPQAT  82


 Score = 42.0 bits (97),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -2

Query  580  GSPASDALPIGNDRLGAMVWGGVASETLNLN  488
            G   +DALPIGN RLGAM+ G + SET++LN
Sbjct  15   GKHWTDALPIGNGRLGAMICGHLHSETIHLN  45



>ref|XP_006486970.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Citrus sinensis]
Length=810

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PGDYT+ DAPKAL+DVR LVD GQYA+AT  S
Sbjct  40   WGGVPSETLKLNEDTLWTGVPGDYTNPDAPKALSDVRSLVDSGQYAEATAAS  91



>gb|KDO47950.1| hypothetical protein CISIN_1g003571mg [Citrus sinensis]
Length=810

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PGDYT+ DAPKAL+DVR LVD GQYA+AT  S
Sbjct  40   WGGVPSETLKLNEDTLWTGVPGDYTNPDAPKALSDVRSLVDSGQYAEATAAS  91



>ref|XP_009592476.1| PREDICTED: alpha-L-fucosidase 2 [Nicotiana tomentosiformis]
Length=820

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L+++ DTLWTG PGDYT+ +APK+LA+VRKLVD+GQYA+ATE
Sbjct  61   WGGVSSEILNLNEDTLWTGTPGDYTNPEAPKSLAEVRKLVDNGQYAEATE  110


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAMVWGGV+SE LNLN
Sbjct  46   TDALPIGNGRLGAMVWGGVSSEILNLN  72



>gb|KDO47957.1| hypothetical protein CISIN_1g003571mg [Citrus sinensis]
Length=497

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PGDYT+ DAPKAL+DVR LVD GQYA+AT  S
Sbjct  40   WGGVPSETLKLNEDTLWTGVPGDYTNPDAPKALSDVRSLVDSGQYAEATAAS  91



>gb|KDO47956.1| hypothetical protein CISIN_1g003571mg [Citrus sinensis]
Length=613

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PGDYT+ DAPKAL+DVR LVD GQYA+AT  S
Sbjct  40   WGGVPSETLKLNEDTLWTGVPGDYTNPDAPKALSDVRSLVDSGQYAEATAAS  91



>ref|XP_006422890.1| hypothetical protein CICLE_v10027838mg [Citrus clementina]
 gb|ESR36130.1| hypothetical protein CICLE_v10027838mg [Citrus clementina]
Length=810

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PGDYT+ DAPKAL+DVR LVD GQYA+AT  S
Sbjct  40   WGGVPSETLKLNEDTLWTGVPGDYTNPDAPKALSDVRSLVDSGQYAEATAAS  91



>ref|XP_006589631.1| PREDICTED: alpha-L-fucosidase 2-like [Glycine max]
Length=207

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDY++  AP+ALA+VRKLVDDG++++AT
Sbjct  97   WGAVPSEALQLNEDTLWTGIPGDYSNKSAPQALAEVRKLVDDGKFSEAT  145



>emb|CDO97236.1| unnamed protein product [Coffea canephora]
Length=837

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L+++ DTLWTGIPGDYTD +AP+ALA+VRKLV++GQYA+AT  +
Sbjct  64   WGGVPAEVLNLNEDTLWTGIPGDYTDPNAPEALAEVRKLVNEGQYAEATSAA  115



>ref|XP_011088197.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Sesamum indicum]
Length=859

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V +  ++++ DTLWTG PGDYTD DAP  L+ VRKLVDDGQYA AT
Sbjct  78   WGGVANETINLNEDTLWTGTPGDYTDPDAPNTLSKVRKLVDDGQYADAT  126


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAMVWGGVA+ET+NLN
Sbjct  63   TDALPIGNGRLGAMVWGGVANETINLN  89



>ref|XP_009800211.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Nicotiana sylvestris]
Length=820

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L+++ DTLWTG PGDYT  +APK+LA+VRKLVD+GQYA+ATE
Sbjct  61   WGGVSSEILNLNEDTLWTGTPGDYTKPEAPKSLAEVRKLVDNGQYAEATE  110


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAM+WGGV+SE LNLN
Sbjct  46   TDALPIGNGRLGAMIWGGVSSEILNLN  72



>ref|XP_009800220.1| PREDICTED: alpha-L-fucosidase 2 isoform X2 [Nicotiana sylvestris]
Length=791

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L+++ DTLWTG PGDYT  +APK+LA+VRKLVD+GQYA+ATE
Sbjct  61   WGGVSSEILNLNEDTLWTGTPGDYTKPEAPKSLAEVRKLVDNGQYAEATE  110


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAM+WGGV+SE LNLN
Sbjct  46   TDALPIGNGRLGAMIWGGVSSEILNLN  72



>ref|XP_011030387.1| PREDICTED: alpha-L-fucosidase 2-like [Populus euphratica]
Length=846

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -3

Query  528  WFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            W G  L   L ++ DTLWTGIPGDYT+ +AP AL++VRKLVD+GQYA+AT
Sbjct  61   WGGVALE-TLQLNEDTLWTGIPGDYTNPNAPAALSEVRKLVDNGQYAEAT  109



>ref|XP_010028398.1| PREDICTED: alpha-L-fucosidase 2-like [Eucalyptus grandis]
 gb|KCW55142.1| hypothetical protein EUGRSUZ_I01093 [Eucalyptus grandis]
Length=841

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G+VL   L ++ DTLWTG+PG+Y D +AP+AL+ VRKLVD+GQYA+AT
Sbjct  64   WGSVLSETLQLNEDTLWTGVPGNYADPNAPEALSKVRKLVDEGQYAEAT  112



>ref|XP_002298754.2| hypothetical protein POPTR_0001s30620g [Populus trichocarpa]
 gb|EEE83559.2| hypothetical protein POPTR_0001s30620g [Populus trichocarpa]
Length=815

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -3

Query  528  WFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            W G  L   L ++ DTLWTGIPGDYT+ +AP AL +VRKLVD+GQYA+AT
Sbjct  61   WGGVALE-TLQLNEDTLWTGIPGDYTNPNAPAALLEVRKLVDNGQYAEAT  109



>ref|XP_010090595.1| hypothetical protein L484_002038 [Morus notabilis]
 gb|EXB40023.1| hypothetical protein L484_002038 [Morus notabilis]
Length=175

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  531  PWFGAVLHLR-LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            P+   + +++ L ++ DTLWTGIPG+YT+  AP+ALA+VRKLVD+G+Y +AT+
Sbjct  85   PFKAKICYVKTLDVAEDTLWTGIPGNYTNPKAPEALAEVRKLVDNGEYVEATK  137


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLNGHFVDWNS  464
            +DA+PIGN RLGAMVWGGVASETL LNG   + N 
Sbjct  45   TDAVPIGNGRLGAMVWGGVASETLQLNGEPSNLNC  79



>ref|XP_011457799.1| PREDICTED: alpha-L-fucosidase 2-like [Fragaria vesca subsp. vesca]
Length=875

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PG+YT+ +AP+AL +VRKLVDDG+YA+ATE
Sbjct  59   WGGVASETLQLNEDTLWTGTPGNYTNPNAPQALTEVRKLVDDGKYAEATE  108


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = -2

Query  595  MEPVVGSPA---SDALPIGNDRLGAMVWGGVASETLNLN  488
            ++   G PA   +DA+PIGN RLGAMVWGGVASETL LN
Sbjct  32   LKVTFGGPAKFWTDAIPIGNGRLGAMVWGGVASETLQLN  70



>ref|XP_007042561.1| 1,2-alpha-L-fucosidases [Theobroma cacao]
 gb|EOX98392.1| 1,2-alpha-L-fucosidases [Theobroma cacao]
Length=843

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G +    L ++ DTLWTGIPG+YT+ DAP ALA+VRKLVD G+YA+AT+
Sbjct  59   WGGIASETLQLNEDTLWTGIPGNYTNPDAPAALAEVRKLVDSGEYAEATK  108


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGG+ASETL LN
Sbjct  44   TDAIPIGNGRLGAMVWGGIASETLQLN  70



>emb|CAN67724.1| hypothetical protein VITISV_006023 [Vitis vinifera]
Length=151

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++  TLWTG PG+YT+ DAPKAL++VRKLVD+G Y  ATE
Sbjct  62   WGGVASETLQLNEGTLWTGTPGNYTNPDAPKALSEVRKLVDNGDYVAATE  111


 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAMVWGGVASETL LN
Sbjct  47   TDALPIGNGRLGAMVWGGVASETLQLN  73



>ref|XP_004292088.2| PREDICTED: alpha-L-fucosidase 2 [Fragaria vesca subsp. vesca]
Length=854

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PG+YT+ +AP+AL +VR+LVDDG+YA+ATE
Sbjct  78   WGGVASETLQLNEDTLWTGTPGNYTNTNAPQALTEVRQLVDDGKYAEATE  127


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = -2

Query  595  MEPVVGSPA---SDALPIGNDRLGAMVWGGVASETLNLN  488
            ++   G PA   +DA+PIGN RLGAMVWGGVASETL LN
Sbjct  51   LKVTFGGPAKFWTDAIPIGNGRLGAMVWGGVASETLQLN  89



>gb|KJB47348.1| hypothetical protein B456_008G022200 [Gossypium raimondii]
Length=680

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G +    L ++ DTLWTG+PGDYT+ +AP ALA+VRKLVD+G YA+AT+
Sbjct  59   WGGIASETLQLNEDTLWTGVPGDYTNPEAPAALAEVRKLVDNGDYAEATK  108


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGG+ASETL LN
Sbjct  44   TDAIPIGNGRLGAMVWGGIASETLQLN  70



>gb|KJB47346.1| hypothetical protein B456_008G022200 [Gossypium raimondii]
Length=672

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G +    L ++ DTLWTG+PGDYT+ +AP ALA+VRKLVD+G YA+AT+
Sbjct  59   WGGIASETLQLNEDTLWTGVPGDYTNPEAPAALAEVRKLVDNGDYAEATK  108


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGG+ASETL LN
Sbjct  44   TDAIPIGNGRLGAMVWGGIASETLQLN  70



>gb|KJB47347.1| hypothetical protein B456_008G022200 [Gossypium raimondii]
Length=843

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G +    L ++ DTLWTG+PGDYT+ +AP ALA+VRKLVD+G YA+AT+
Sbjct  59   WGGIASETLQLNEDTLWTGVPGDYTNPEAPAALAEVRKLVDNGDYAEATK  108


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGG+ASETL LN
Sbjct  44   TDAIPIGNGRLGAMVWGGIASETLQLN  70



>dbj|BAK06893.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=815

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V   +L ++ DTLWTG+PGDYTD  AP ALA VRKLVDDG++  AT  +
Sbjct  48   WGGVASDKLQLNLDTLWTGVPGDYTDPKAPAALAAVRKLVDDGRFVDATSAA  99



>ref|XP_008787125.1| PREDICTED: alpha-L-fucosidase 2 [Phoenix dactylifera]
Length=863

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PG+YTD DAP  L+ VR+LVD+GQYA+AT  +
Sbjct  61   WGGVASETLQLNHDTLWTGVPGNYTDPDAPAVLSKVRELVDNGQYAEATSAA  112



>gb|KHN42345.1| Alpha-L-fucosidase 2 [Glycine soja]
Length=871

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDYT+  AP+ALA+VRKLVDD ++++AT
Sbjct  91   WGAVPSEALQLNEDTLWTGIPGDYTNSSAPQALAEVRKLVDDRKFSEAT  139



>ref|XP_010936549.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Elaeis guineensis]
Length=810

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTG+PG+YTD DAP  L+ VR+LVD+GQYA+A+
Sbjct  61   WGGVASETLQLNHDTLWTGVPGNYTDPDAPAVLSKVRELVDNGQYAEAS  109


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA PIGN RLGAMVWGGVASETL LN
Sbjct  46   TDAAPIGNGRLGAMVWGGVASETLQLN  72



>gb|AES92246.2| alpha-L-fucosidase [Medicago truncatula]
Length=853

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G +    L ++ DTLWTGIPG+YTD +AP+ALA+VRKLVDD +Y++AT
Sbjct  61   WGGIQSEVLQLNEDTLWTGIPGNYTDKNAPEALAEVRKLVDDRKYSEAT  109



>ref|XP_003610049.1| Macrophage migration inhibitory factor-like protein [Medicago 
truncatula]
Length=855

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G +    L ++ DTLWTGIPG+YTD +AP+ALA+VRKLVDD +Y++AT
Sbjct  61   WGGIQSEVLQLNEDTLWTGIPGNYTDKNAPEALAEVRKLVDDRKYSEAT  109



>ref|XP_010936550.1| PREDICTED: alpha-L-fucosidase 2-like [Elaeis guineensis]
Length=862

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTG+PG+YTD DAP  L+ VR+LVD+GQYA+A+
Sbjct  60   WGGVASETLQLNHDTLWTGVPGNYTDPDAPAVLSKVRELVDNGQYAEAS  108


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA PIGN RLGAMVWGGVASETL LN
Sbjct  45   TDAAPIGNGRLGAMVWGGVASETLQLN  71



>ref|XP_003536603.1| PREDICTED: alpha-L-fucosidase 2-like [Glycine max]
 gb|KHN06776.1| Alpha-L-fucosidase 2 [Glycine soja]
Length=877

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDYT+  AP+ALA+VRKLV+D ++A+AT
Sbjct  94   WGAVPSEALQLNEDTLWTGIPGDYTNKSAPQALAEVRKLVNDRKFAEAT  142



>ref|XP_010271389.1| PREDICTED: alpha-L-fucosidase 2 [Nelumbo nucifera]
Length=847

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG+PG+YT+ +AP+AL+ VR+LVD GQYA+AT+
Sbjct  59   WGGVASETLQLNDDTLWTGVPGNYTNPNAPQALSQVRELVDKGQYAEATQ  108


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAMVWGGVASETL LN
Sbjct  44   TDALPIGNGRLGAMVWGGVASETLQLN  70



>ref|XP_010936547.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Elaeis guineensis]
Length=863

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTG+PG+YTD DAP  L+ VR+LVD+GQYA+A+
Sbjct  61   WGGVASETLQLNHDTLWTGVPGNYTDPDAPAVLSKVRELVDNGQYAEAS  109



>ref|XP_009335951.1| PREDICTED: alpha-L-fucosidase 2 [Pyrus x bretschneideri]
Length=836

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTGIPG+YT+  AP+ L +VRKLVDDG+Y +ATE
Sbjct  62   WGGVASETLQLNEDTLWTGIPGNYTNPKAPQVLTEVRKLVDDGKYVEATE  111


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGGVASETL LN
Sbjct  47   TDAIPIGNGRLGAMVWGGVASETLQLN  73



>gb|KCW55141.1| hypothetical protein EUGRSUZ_I01092 [Eucalyptus grandis]
Length=716

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTG PG+YTD   P  LADVRKLVDDG+YA AT
Sbjct  128  WGGVASELLQLNEDTLWTGTPGNYTDPRVPAVLADVRKLVDDGEYADAT  176



>ref|XP_010936540.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Elaeis guineensis]
Length=810

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PG+YTD DAP  L+ VR+LVD GQYA+A+  +
Sbjct  61   WGGVASETLQLNHDTLWTGVPGNYTDPDAPPVLSKVRELVDSGQYAEASSAA  112


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA PIGN RLGAMVWGGVASETL LN
Sbjct  46   TDATPIGNGRLGAMVWGGVASETLQLN  72



>dbj|BAF85832.1| alpha-1,2-fucosidase [Lilium longiflorum]
Length=854

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTG+PG+YT+ DAP  L+ VRKLVDDG+YA+A+
Sbjct  60   WGGVPTETLQLNDDTLWTGVPGNYTNPDAPTVLSKVRKLVDDGKYAEAS  108



>ref|XP_007200942.1| hypothetical protein PRUPE_ppa001398mg [Prunus persica]
 gb|EMJ02141.1| hypothetical protein PRUPE_ppa001398mg [Prunus persica]
Length=837

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V   +L ++ DTLWTG PG+YT+  AP+AL +VRKLVD G+Y +ATE
Sbjct  58   WGGVASEKLQLNEDTLWTGTPGNYTNPKAPEALTEVRKLVDSGKYVEATE  107



>ref|XP_010437645.1| PREDICTED: alpha-L-fucosidase 2-like [Camelina sativa]
Length=832

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA+VR+LVDD  YA+AT
Sbjct  68   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAEVRRLVDDRNYAEAT  116



>gb|KDP44439.1| hypothetical protein JCGZ_16272 [Jatropha curcas]
Length=849

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            FG V    + ++ DTLWTGIPG+YT+ D P ALA+VRKLVD G+Y +A++
Sbjct  62   FGGVKSETIRLNEDTLWTGIPGNYTNPDGPAALAEVRKLVDQGKYLEASD  111



>ref|XP_008236396.1| PREDICTED: alpha-L-fucosidase 2 [Prunus mume]
Length=836

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V   +L ++ DTLWTG PG+YT+  AP+AL +VRKLVD G+Y +ATE +
Sbjct  58   WGGVASEKLQLNEDTLWTGTPGNYTNPKAPEALTEVRKLVDSGKYVEATEAA  109



>ref|XP_010447114.1| PREDICTED: alpha-L-fucosidase 2-like [Camelina sativa]
Length=833

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA+VR+LVDD  YA+AT
Sbjct  69   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAEVRRLVDDRNYAEAT  117



>ref|XP_006422893.1| hypothetical protein CICLE_v10027816mg [Citrus clementina]
 gb|ESR36133.1| hypothetical protein CICLE_v10027816mg [Citrus clementina]
Length=713

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PGDYTD  AP+AL +VRKLVD+G+Y  ATE
Sbjct  65   WGGVASEILQLNEDTLWTGTPGDYTDRKAPEALEEVRKLVDNGKYFAATE  114


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 3/45 (7%)
 Frame = -2

Query  613  GSSWAYMEPVVGSPA---SDALPIGNDRLGAMVWGGVASETLNLN  488
            G S   ++   G PA   +DA+PIGN RLGAMVWGGVASE L LN
Sbjct  32   GESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGGVASEILQLN  76



>ref|XP_010936539.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Elaeis guineensis]
Length=863

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PG+YTD DAP  L+ VR+LVD GQYA+A+  +
Sbjct  61   WGGVASETLQLNHDTLWTGVPGNYTDPDAPPVLSKVRELVDSGQYAEASSAA  112



>ref|XP_006486972.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Citrus sinensis]
Length=839

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PG+YTD  AP+ALA+VRKLVD+G+Y  ATE
Sbjct  65   WGGVASEILQLNEDTLWTGTPGNYTDPKAPEALAEVRKLVDNGEYFAATE  114


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 3/45 (7%)
 Frame = -2

Query  613  GSSWAYMEPVVGSPA---SDALPIGNDRLGAMVWGGVASETLNLN  488
            G S   ++   G PA   +DA+PIGN RLGAMVWGGVASE L LN
Sbjct  32   GESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGGVASEILQLN  76



>ref|XP_006849299.1| hypothetical protein AMTR_s00167p00034910 [Amborella trichopoda]
 gb|ERN10880.1| hypothetical protein AMTR_s00167p00034910 [Amborella trichopoda]
Length=869

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+PGDYTD  AP  L+ VR+LVD GQY +AT+ +
Sbjct  73   WGGVQSETLQLNEDTLWTGVPGDYTDSQAPNVLSQVRELVDKGQYPEATKAA  124



>ref|XP_006486973.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Citrus sinensis]
Length=833

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PG+YTD  AP+ALA+VRKLVD+G+Y  ATE
Sbjct  65   WGGVASEILQLNEDTLWTGTPGNYTDPKAPEALAEVRKLVDNGEYFAATE  114


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 3/45 (7%)
 Frame = -2

Query  613  GSSWAYMEPVVGSPA---SDALPIGNDRLGAMVWGGVASETLNLN  488
            G S   ++   G PA   +DA+PIGN RLGAMVWGGVASE L LN
Sbjct  32   GESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGGVASEILQLN  76



>gb|KDO47958.1| hypothetical protein CISIN_1g003209mg [Citrus sinensis]
Length=839

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PGDYTD  AP+AL +VRKLVD+G+Y  ATE
Sbjct  65   WGGVASEILQLNEDTLWTGTPGDYTDRKAPEALEEVRKLVDNGKYFAATE  114


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 3/45 (7%)
 Frame = -2

Query  613  GSSWAYMEPVVGSPA---SDALPIGNDRLGAMVWGGVASETLNLN  488
            G S   ++   G PA   +DA+PIGN RLGAMVWGGVASE L LN
Sbjct  32   GESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGGVASEILQLN  76



>ref|XP_006422892.1| hypothetical protein CICLE_v10027816mg [Citrus clementina]
 gb|ESR36132.1| hypothetical protein CICLE_v10027816mg [Citrus clementina]
Length=839

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PGDYTD  AP+AL +VRKLVD+G+Y  ATE
Sbjct  65   WGGVASEILQLNEDTLWTGTPGDYTDRKAPEALEEVRKLVDNGKYFAATE  114


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 3/45 (7%)
 Frame = -2

Query  613  GSSWAYMEPVVGSPA---SDALPIGNDRLGAMVWGGVASETLNLN  488
            G S   ++   G PA   +DA+PIGN RLGAMVWGGVASE L LN
Sbjct  32   GESSEPLKVTFGGPAKHWTDAIPIGNGRLGAMVWGGVASEILQLN  76



>gb|EMS61938.1| Alpha-L-fucosidase 2 [Triticum urartu]
Length=800

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V   +L ++ DTLW+G+PGDYTD  AP ALA VRKLVD+G++  AT  +
Sbjct  48   WGGVASEKLQLNLDTLWSGVPGDYTDPKAPAALAAVRKLVDEGRFVDATSAA  99



>gb|KEH44060.1| alpha-L-fucosidase-like protein [Medicago truncatula]
Length=902

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -3

Query  528  WFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            W G    L L ++ DTLWTGIPG+YTD +AP+ LA+VRKLVDD +Y +AT
Sbjct  120  WGGVQTEL-LQLNDDTLWTGIPGNYTDKNAPEVLAEVRKLVDDKKYPEAT  168



>ref|XP_004172907.1| PREDICTED: alpha-L-fucosidase 2-like, partial [Cucumis sativus]
Length=764

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  486  DTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            DTLWTG P DYT+ DAP+AL +VRKLVDDG+YA+ATE
Sbjct  8    DTLWTGTPADYTNPDAPEALREVRKLVDDGKYAEATE  44



>ref|XP_006829279.1| hypothetical protein AMTR_s00001p00272880 [Amborella trichopoda]
 gb|ERM96695.1| hypothetical protein AMTR_s00001p00272880 [Amborella trichopoda]
Length=869

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    L ++ DTLWTG+P DYTD  AP  L+ VRKLVD+GQY +AT+ +
Sbjct  73   WGGVESETLQLNEDTLWTGVPSDYTDSQAPNVLSQVRKLVDEGQYPEATKAA  124


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAMVWGGV SETL LN
Sbjct  58   TDALPIGNGRLGAMVWGGVESETLQLN  84



>ref|XP_006412250.1| hypothetical protein EUTSA_v10024398mg [Eutrema salsugineum]
 gb|ESQ53703.1| hypothetical protein EUTSA_v10024398mg [Eutrema salsugineum]
Length=838

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+++ DT+WTG+P DYT+ +AP+ALA VRKLVDD +YA+AT
Sbjct  74   WGGVSSETLNLNEDTIWTGVPADYTNPNAPEALAQVRKLVDDRKYAEAT  122



>ref|XP_007143071.1| hypothetical protein PHAVU_007G041400g [Phaseolus vulgaris]
 gb|ESW15065.1| hypothetical protein PHAVU_007G041400g [Phaseolus vulgaris]
Length=866

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTGIPGDYT+  AP+ALA+VRKLVDD ++ +AT
Sbjct  87   WGGVPSELLQLNEDTLWTGIPGDYTNKSAPQALAEVRKLVDDRKFPEAT  135



>ref|XP_008338241.1| PREDICTED: alpha-L-fucosidase 2 [Malus domestica]
Length=836

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTGIPG+YT+  AP+ L +VRKLVDDG+Y +AT
Sbjct  62   WGGVASETLQLNEDTLWTGIPGNYTNPKAPQVLTEVRKLVDDGKYVEAT  110


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGGVASETL LN
Sbjct  47   TDAIPIGNGRLGAMVWGGVASETLQLN  73



>gb|KCW55138.1| hypothetical protein EUGRSUZ_I01091 [Eucalyptus grandis]
Length=817

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTGIPG+YT+ + P ALA+VRKLVDDG+YA A+
Sbjct  37   WGGVASELLQLNEDTLWTGIPGNYTNPNVPVALAEVRKLVDDGEYADAS  85



>ref|XP_006661702.1| PREDICTED: alpha-L-fucosidase 2-like [Oryza brachyantha]
Length=815

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V   +L ++ DTLWTG+PG+YTD +AP ALA +RKLVD G++  ATE
Sbjct  49   WGGVASEKLQLNHDTLWTGVPGNYTDPNAPYALAVIRKLVDGGKFVDATE  98



>ref|XP_010647956.1| PREDICTED: alpha-L-fucosidase 2 [Vitis vinifera]
Length=840

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++  TLWTG PG+YT+ DAPKAL++VRKLVD+G Y  ATE
Sbjct  62   WGGVASETLQLNEGTLWTGTPGNYTNPDAPKALSEVRKLVDNGDYVAATE  111


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAMVWGGVASETL LN
Sbjct  47   TDALPIGNGRLGAMVWGGVASETLQLN  73



>emb|CBI22509.3| unnamed protein product [Vitis vinifera]
Length=781

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++  TLWTG PG+YT+ DAPKAL++VRKLVD+G Y  ATE
Sbjct  62   WGGVASETLQLNEGTLWTGTPGNYTNPDAPKALSEVRKLVDNGDYVAATE  111


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALPIGN RLGAMVWGGVASETL LN
Sbjct  47   TDALPIGNGRLGAMVWGGVASETLQLN  73



>ref|XP_006605983.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Glycine max]
Length=795

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIP DYT+  AP+ALA+VRKLVDD ++++AT
Sbjct  91   WGAVPSEALQLNEDTLWTGIPRDYTNSSAPQALAEVRKLVDDRKFSEAT  139



>ref|XP_002869161.1| hypothetical protein ARALYDRAFT_912968 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45420.1| hypothetical protein ARALYDRAFT_912968 [Arabidopsis lyrata subsp. 
lyrata]
Length=844

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA+VR+LVD+  YA+AT
Sbjct  78   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAEVRRLVDEKNYAEAT  126



>ref|XP_006283241.1| hypothetical protein CARUB_v10004274mg [Capsella rubella]
 gb|EOA16139.1| hypothetical protein CARUB_v10004274mg [Capsella rubella]
Length=691

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA+VR+LVDD  YA AT
Sbjct  76   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAEVRRLVDDRNYAAAT  124



>ref|XP_010432442.1| PREDICTED: alpha-L-fucosidase 2 [Camelina sativa]
Length=831

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA+VR+LVDD  Y++AT
Sbjct  67   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAEVRRLVDDRNYSEAT  115



>gb|KCW55139.1| hypothetical protein EUGRSUZ_I01092 [Eucalyptus grandis]
Length=893

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTG PG+YTD   P  LADVRKLVDDG+YA AT
Sbjct  128  WGGVASELLQLNEDTLWTGTPGNYTDPRVPAVLADVRKLVDDGEYADAT  176



>ref|XP_003555969.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Glycine max]
Length=874

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIP DYT+  AP+ALA+VRKLVDD ++++AT
Sbjct  91   WGAVPSEALQLNEDTLWTGIPRDYTNSSAPQALAEVRKLVDDRKFSEAT  139



>ref|XP_010028395.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Eucalyptus grandis]
 gb|KCW55140.1| hypothetical protein EUGRSUZ_I01092 [Eucalyptus grandis]
Length=907

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTG PG+YTD   P  LADVRKLVDDG+YA AT
Sbjct  128  WGGVASELLQLNEDTLWTGTPGNYTDPRVPAVLADVRKLVDDGEYADAT  176



>ref|XP_011001337.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Populus euphratica]
Length=772

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  528  WFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            W G  L   L ++ DTLWTG PG+YT+  AP+AL+ VRKLVD+GQYA AT
Sbjct  62   WGGVALE-TLQLNEDTLWTGTPGNYTNPHAPEALSVVRKLVDNGQYADAT  110



>ref|XP_010547973.1| PREDICTED: alpha-L-fucosidase 2 [Tarenaya hassleriana]
Length=846

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+AL++VR LV DG+YA+AT
Sbjct  84   WGGVSSETLNINEDTVWTGVPADYTNPNAPEALSEVRNLVSDGKYAEAT  132



>ref|XP_008338239.1| PREDICTED: alpha-L-fucosidase 2-like [Malus domestica]
Length=825

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PG+YT+  AP+ L +VRKLVDDG+Y +ATE
Sbjct  60   WGGVXSETLQLNEDTLWTGNPGNYTNPKAPEVLTEVRKLVDDGKYVEATE  109



>ref|XP_009344361.1| PREDICTED: alpha-L-fucosidase 2-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009344365.1| PREDICTED: alpha-L-fucosidase 2-like isoform X3 [Pyrus x bretschneideri]
Length=661

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PG+YT+  AP+ L +VRKLVDDG+Y +ATE
Sbjct  61   WGGVASETLQLNEDTLWTGNPGNYTNPKAPEVLTEVRKLVDDGKYVEATE  110


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGGVASETL LN
Sbjct  46   TDAIPIGNGRLGAMVWGGVASETLQLN  72



>ref|XP_006605984.1| PREDICTED: alpha-L-fucosidase 2-like isoform X3 [Glycine max]
Length=786

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIP DYT+  AP+ALA+VRKLVDD ++++AT
Sbjct  91   WGAVPSEALQLNEDTLWTGIPRDYTNSSAPQALAEVRKLVDDRKFSEAT  139



>ref|XP_011001328.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Populus euphratica]
Length=847

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  528  WFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            W G  L   L ++ DTLWTG PG+YT+  AP+AL+ VRKLVD+GQYA AT
Sbjct  62   WGGVALE-TLQLNEDTLWTGTPGNYTNPHAPEALSVVRKLVDNGQYADAT  110



>ref|XP_009344358.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344362.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Pyrus x bretschneideri]
Length=826

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PG+YT+  AP+ L +VRKLVDDG+Y +ATE
Sbjct  61   WGGVASETLQLNEDTLWTGNPGNYTNPKAPEVLTEVRKLVDDGKYVEATE  110


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGGVASETL LN
Sbjct  46   TDAIPIGNGRLGAMVWGGVASETLQLN  72



>ref|XP_006605982.1| PREDICTED: alpha-L-fucosidase 2-like isoform X5 [Glycine max]
Length=699

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDYT+  A +ALA+VRKLVDD ++++AT
Sbjct  93   WGAVPSEALQLNEDTLWTGIPGDYTNKSAQQALAEVRKLVDDRKFSEAT  141



>ref|XP_006605979.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Glycine max]
Length=854

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDYT+  A +ALA+VRKLVDD ++++AT
Sbjct  71   WGAVPSEALQLNEDTLWTGIPGDYTNKSAQQALAEVRKLVDDRKFSEAT  119



>ref|XP_009345064.1| PREDICTED: alpha-L-fucosidase 2-like [Pyrus x bretschneideri]
Length=826

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    L ++ DTLWTG PG+YT+  AP+ L +VRKLVDDG+Y +ATE
Sbjct  61   WGGVASETLQLNEDTLWTGNPGNYTNPKAPEVLTEVRKLVDDGKYVEATE  110


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DA+PIGN RLGAMVWGGVASETL LN
Sbjct  46   TDAIPIGNGRLGAMVWGGVASETLQLN  72



>ref|XP_006605981.1| PREDICTED: alpha-L-fucosidase 2-like isoform X4 [Glycine max]
Length=700

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDYT+  A +ALA+VRKLVDD ++++AT
Sbjct  93   WGAVPSEALQLNEDTLWTGIPGDYTNKSAQQALAEVRKLVDDRKFSEAT  141



>gb|KHN42346.1| Alpha-L-fucosidase 2 [Glycine soja]
Length=835

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDYT+  A +ALA+VRKLVDD ++++AT
Sbjct  52   WGAVPSEALQLNEDTLWTGIPGDYTNKSAQQALAEVRKLVDDRKFSEAT  100



>ref|XP_006605980.1| PREDICTED: alpha-L-fucosidase 2-like isoform X3 [Glycine max]
Length=835

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDYT+  A +ALA+VRKLVDD ++++AT
Sbjct  52   WGAVPSEALQLNEDTLWTGIPGDYTNKSAQQALAEVRKLVDDRKFSEAT  100



>ref|XP_003555281.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Glycine max]
Length=876

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +GAV    L ++ DTLWTGIPGDYT+  A +ALA+VRKLVDD ++++AT
Sbjct  93   WGAVPSEALQLNEDTLWTGIPGDYTNKSAQQALAEVRKLVDDRKFSEAT  141



>gb|KHG11389.1| hypothetical protein F383_14795 [Gossypium arboreum]
Length=884

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    + ++ DTLWTG+PGDYT+ +AP AL+++RKLVD G++A+AT
Sbjct  50   WGGVASELIQLNEDTLWTGVPGDYTNPNAPYALSEIRKLVDSGEFAEAT  98



>gb|KDP44440.1| hypothetical protein JCGZ_16273 [Jatropha curcas]
Length=835

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    + ++ DTLWTG P D+TD DAPKAL++VRKLVD G++A+A+
Sbjct  58   WGGVSSDTIQLNEDTLWTGTPSDFTDPDAPKALSEVRKLVDAGKFAEAS  106



>ref|XP_002527476.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34874.1| conserved hypothetical protein [Ricinus communis]
Length=849

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            FG V    L I+ DTLWTG PG+YT+ +AP+AL  VRKLV D +YA+AT
Sbjct  64   FGGVASETLRINEDTLWTGTPGNYTNPNAPEALTQVRKLVGDRKYAEAT  112



>ref|XP_009421189.1| PREDICTED: alpha-L-fucosidase 2-like [Musa acuminata subsp. malaccensis]
Length=850

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    + ++ DTLWTG+PGDYT+ DAP  LA VRKLVD G YA AT
Sbjct  65   WGGVASETIQLNDDTLWTGVPGDYTNPDAPAVLAKVRKLVDSGDYAAAT  113



>ref|XP_004496923.1| PREDICTED: alpha-L-fucosidase 2-like [Cicer arietinum]
Length=833

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L ++ DTLWTGIP DYTD +AP+ LA VRKLVD+ +YA+AT
Sbjct  62   WGGVQSEVLQLNEDTLWTGIPADYTDKNAPETLAVVRKLVDERKYAEAT  110



>gb|KFK30063.1| hypothetical protein AALP_AA7G211900 [Arabis alpina]
Length=834

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA+VR+LVD  +YA+AT
Sbjct  70   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAEVRRLVDARKYAEAT  118



>ref|XP_002313154.2| hypothetical protein POPTR_0009s09690g [Populus trichocarpa]
 gb|EEE87109.2| hypothetical protein POPTR_0009s09690g [Populus trichocarpa]
Length=825

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  528  WFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            W G  L   L ++ DTLWTG PG+YT+  AP+AL+ VRKLVD+GQYA AT
Sbjct  62   WGGVSLE-TLQLNEDTLWTGTPGNYTNPHAPEALSVVRKLVDNGQYADAT  110



>ref|XP_010691648.1| PREDICTED: LOW QUALITY PROTEIN: alpha-L-fucosidase 2-like [Beta 
vulgaris subsp. vulgaris]
Length=837

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 5/54 (9%)
 Frame = -3

Query  525  FGAVLHLRLS-----ISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            FG ++H  +S     ++ DTLW GIPG+YTD +AP+ LA+VRKLV++G Y++AT
Sbjct  87   FGGMIHGGVSSEIINLNEDTLWRGIPGNYTDPNAPRVLANVRKLVNNGNYSEAT  140



>emb|CAB36703.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80143.1| hypothetical protein [Arabidopsis thaliana]
Length=847

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+  AP+ALA+VR+LVD+  YA+AT
Sbjct  79   WGGVSSEILNINEDTIWTGVPADYTNQKAPEALAEVRRLVDERNYAEAT  127



>emb|CDX69041.1| BnaC01g04120D [Brassica napus]
Length=833

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA VRKLVD+ +Y +AT
Sbjct  74   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAQVRKLVDERKYPEAT  122



>ref|NP_195152.2| alpha-L-fucosidase 2 [Arabidopsis thaliana]
 sp|Q8L7W8.1|FUCO2_ARATH RecName: Full=Alpha-L-fucosidase 2; AltName: Full=Alpha-1,2-fucosidase 
2; AltName: Full=Alpha-L-fucosidase 95A; Short=AtFuc95A; 
AltName: Full=Alpha-L-fucoside fucohydrolase 2; AltName: 
Full=Protein ALTERED XYLOGLUCAN 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM78086.1| AT4g34260/F10M10_30 [Arabidopsis thaliana]
 gb|AAO11638.1| At4g34260/F10M10_30 [Arabidopsis thaliana]
 gb|AEE86349.1| alpha-L-fucosidase 2 [Arabidopsis thaliana]
Length=843

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+  AP+ALA+VR+LVD+  YA+AT
Sbjct  79   WGGVSSEILNINEDTIWTGVPADYTNQKAPEALAEVRRLVDERNYAEAT  127



>ref|XP_009114732.1| PREDICTED: alpha-L-fucosidase 2 [Brassica rapa]
Length=836

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA VRKLVD+ +Y +AT
Sbjct  77   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAQVRKLVDERKYPEAT  125



>gb|AID60138.1| altered xyloglucan 8 [Brassica napus]
 emb|CDX75416.1| BnaA01g02860D [Brassica napus]
Length=836

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V    L+I+ DT+WTG+P DYT+ +AP+ALA VRKLVD+ +Y +AT
Sbjct  77   WGGVSSETLNINEDTIWTGVPADYTNPNAPEALAQVRKLVDERKYPEAT  125



>gb|ABG66022.1| large secreted protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EEE50774.1| hypothetical protein OsJ_31132 [Oryza sativa Japonica Group]
Length=815

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G+V   +L ++ DTLWTG+PG+YTD +AP ALA VRKLVD  ++  ATE
Sbjct  49   WGSVASEKLQLNHDTLWTGVPGNYTDPNAPYALAVVRKLVDGEKFVDATE  98



>gb|EEC79728.1| hypothetical protein OsI_21058 [Oryza sativa Indica Group]
Length=815

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G+V   +L ++ DTLWTG+PG+YTD +AP ALA VRKLVD  ++  ATE
Sbjct  49   WGSVASEKLQLNHDTLWTGVPGNYTDPNAPYALAVVRKLVDGEKFVDATE  98



>dbj|BAK07299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=832

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSR  367
            +G V   +L ++ DTLWTG+PG+YTD  AP  LA+VR LVD G++A AT  ++
Sbjct  62   WGGVSSDKLQLNHDTLWTGVPGNYTDPKAPGVLAEVRGLVDQGRFADATASAK  114



>gb|EMT05101.1| Alpha-L-fucosidase 2 [Aegilops tauschii]
Length=822

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSR  367
            +G V   +L ++ DTLWTG+PG+YTD   P  LA+VR+LVD G++A AT  ++
Sbjct  3    WGGVSSDKLQLNHDTLWTGVPGNYTDPKGPGVLAEVRQLVDQGRFADATASAK  55



>ref|XP_002313157.1| hypothetical protein POPTR_0009s09650g [Populus trichocarpa]
 gb|EEE87112.1| hypothetical protein POPTR_0009s09650g [Populus trichocarpa]
Length=836

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    + ++ DTLWTG P DYT+ DAP+ALA+VR LVD G++A+A++ +
Sbjct  58   WGGVSSELIQLNEDTLWTGTPIDYTNPDAPEALAEVRNLVDSGEFAEASDAA  109



>ref|XP_010691649.1| PREDICTED: alpha-L-fucosidase 2-like [Beta vulgaris subsp. vulgaris]
Length=865

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  522  GAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            G ++   ++++ DTLWTGIP +YT+ ++P+ALA VRKLV++G Y++AT
Sbjct  108  GGIISEIINLNEDTLWTGIPKNYTNPNSPEALATVRKLVNNGNYSEAT  155



>ref|XP_004983274.1| PREDICTED: alpha-L-fucosidase 2-like [Setaria italica]
Length=861

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   RL ++ DTLWTG PG+YT+  AP  L+ VR LVD+G+Y +AT
Sbjct  72   WGGVESERLQLNHDTLWTGGPGNYTNPKAPPVLSKVRNLVDNGKYPEAT  120



>ref|XP_011001318.1| PREDICTED: alpha-L-fucosidase 2-like [Populus euphratica]
Length=837

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    + ++ DTLWTG P DYT+ DAP+ALA+VR LVD G++A+A++
Sbjct  58   WGGVSSELIQLNEDTLWTGTPIDYTNPDAPEALAEVRNLVDSGEFAEASD  107



>ref|XP_003560237.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Brachypodium 
distachyon]
Length=818

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V   +L ++ DTLWTG+PG+YTD   P A+A VRKLV D Q+  AT  +
Sbjct  48   WGGVASEKLQLNLDTLWTGVPGNYTDPSVPSAVAVVRKLVHDRQFVDATNAA  99



>tpg|DAA46849.1| TPA: hypothetical protein ZEAMMB73_390456 [Zea mays]
Length=457

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  522  GAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            G V   RL ++ DTLWTG PG+YT+ +AP  L+ VR LV++G+Y +AT
Sbjct  70   GCVESERLQLNHDTLWTGGPGNYTNPNAPAVLSKVRSLVENGKYPEAT  117



>tpg|DAA46848.1| TPA: hypothetical protein ZEAMMB73_390456 [Zea mays]
Length=567

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   RL ++ DTLWTG PG+YT+ +AP  L+ VR LV++G+Y +AT
Sbjct  69   WGCVESERLQLNHDTLWTGGPGNYTNPNAPAVLSKVRSLVENGKYPEAT  117



>tpg|DAA46850.1| TPA: hypothetical protein ZEAMMB73_390456 [Zea mays]
Length=579

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   RL ++ DTLWTG PG+YT+ +AP  L+ VR LV++G+Y +AT
Sbjct  69   WGCVESERLQLNHDTLWTGGPGNYTNPNAPAVLSKVRSLVENGKYPEAT  117



>ref|XP_009421188.1| PREDICTED: alpha-L-fucosidase 2-like [Musa acuminata subsp. malaccensis]
Length=851

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQY  391
            +G V    + ++ DTLWTG+PGDYT+ DAP  LA VRKLVD G Y
Sbjct  66   WGGVASETIQLNDDTLWTGVPGDYTNPDAPAVLAKVRKLVDSGDY  110



>ref|XP_008659917.1| PREDICTED: alpha-L-fucosidase 2 isoform X2 [Zea mays]
 tpg|DAA46847.1| TPA: hypothetical protein ZEAMMB73_390456 [Zea mays]
Length=727

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   RL ++ DTLWTG PG+YT+ +AP  L+ VR LV++G+Y +AT
Sbjct  69   WGCVESERLQLNHDTLWTGGPGNYTNPNAPAVLSKVRSLVENGKYPEAT  117



>ref|XP_008659908.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Zea mays]
Length=858

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   RL ++ DTLWTG PG+YT+ +AP  L+ VR LV++G+Y +AT
Sbjct  69   WGCVESERLQLNHDTLWTGGPGNYTNPNAPAVLSKVRSLVENGKYPEAT  117



>ref|XP_006662275.1| PREDICTED: alpha-L-fucosidase 2-like, partial [Oryza brachyantha]
Length=806

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   +L ++ DTLWTG PG+YT+  AP  L+ VR LV+ GQYA+AT
Sbjct  17   WGGVASEKLQLNHDTLWTGGPGNYTNPKAPAVLSKVRDLVNRGQYAEAT  65



>gb|EMT23862.1| Alpha-L-fucosidase 2 [Aegilops tauschii]
Length=1100

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = -3

Query  498  SIST---DTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +IST   DTLW+G+PGDYTD  AP ALA VRKLVD+G++  AT 
Sbjct  7    NISTNEVDTLWSGVPGDYTDPKAPAALAAVRKLVDEGRFVDATN  50



>gb|EEC66760.1| hypothetical protein OsI_33136 [Oryza sativa Indica Group]
Length=851

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   +L ++ DTLWTG PG+YT+  AP  L+ VR LV+ GQYA+AT
Sbjct  62   WGGVASEKLQLNHDTLWTGGPGNYTNPKAPAVLSKVRDLVNRGQYAKAT  110



>ref|XP_007042562.1| 1,2-alpha-L-fucosidases [Theobroma cacao]
 gb|EOX98393.1| 1,2-alpha-L-fucosidases [Theobroma cacao]
Length=828

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQY  391
            +G V    L ++ DTLWTG+PG YT+ +AP AL++VR LVD GQY
Sbjct  63   WGGVASELLQLNEDTLWTGVPGTYTNPNAPDALSEVRNLVDSGQY  107



>gb|ABB47227.1| large secreted protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EEE50778.1| hypothetical protein OsJ_31136 [Oryza sativa Japonica Group]
Length=851

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   +L ++ DTLWTG PG+YT+  AP  L+ VR LV+ GQYA+AT
Sbjct  62   WGGVASEKLQLNHDTLWTGGPGNYTNPKAPAVLSKVRDLVNRGQYAKAT  110



>gb|AAK98716.1|AC090483_6 Hypothetical protein [Oryza sativa Japonica Group]
Length=872

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   +L ++ DTLWTG PG+YT+  AP  L+ VR LV+ GQYA+AT
Sbjct  62   WGGVASEKLQLNHDTLWTGGPGNYTNPKAPAVLSKVRDLVNRGQYAKAT  110



>ref|XP_010238647.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Brachypodium 
distachyon]
Length=604

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V   +L ++ DTLWTG+PG+YTD   P A+A VRKLV D Q+  AT 
Sbjct  48   WGGVASEKLQLNLDTLWTGVPGNYTDPSVPSAVAVVRKLVHDRQFVDATN  97



>gb|KJB47342.1| hypothetical protein B456_008G022000 [Gossypium raimondii]
Length=823

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQY  391
            +G V    + ++ DTLWTG+PGDYT+ +AP AL+++RKLVD G++
Sbjct  57   WGGVASELIQLNEDTLWTGVPGDYTNPNAPYALSEIRKLVDSGEF  101



>gb|KJB47344.1| hypothetical protein B456_008G022000 [Gossypium raimondii]
Length=612

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQY  391
            +G V    + ++ DTLWTG+PGDYT+ +AP AL+++RKLVD G++
Sbjct  57   WGGVASELIQLNEDTLWTGVPGDYTNPNAPYALSEIRKLVDSGEF  101



>gb|KJB47343.1| hypothetical protein B456_008G022000 [Gossypium raimondii]
Length=617

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQY  391
            +G V    + ++ DTLWTG+PGDYT+ +AP AL+++RKLVD G++
Sbjct  57   WGGVASELIQLNEDTLWTGVPGDYTNPNAPYALSEIRKLVDSGEF  101



>ref|XP_010105050.1| Alpha-L-fucosidase 2 [Morus notabilis]
 gb|EXC03763.1| Alpha-L-fucosidase 2 [Morus notabilis]
Length=831

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V    + ++ DTLWTG PG+YT+  A +AL +VRKLVD G YA+AT+ +
Sbjct  52   WGGVSSEIIQLNEDTLWTGTPGNYTNPKAQEALKEVRKLVDHGDYAEATKAA  103


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 35/73 (48%), Gaps = 11/73 (15%)
 Frame = -2

Query  706  GDNLWDMLRSQFTNQFDDRRLPELSEVVALSGSSWAYMEPVVGSPASDALPIGNDRLGAM  527
            GD  W +++       DDR    L          W           +DALPIGN RLGAM
Sbjct  2    GDKGWVLVQDPEEKNMDDRSSRPLKVTFKEPAKHW-----------TDALPIGNGRLGAM  50

Query  526  VWGGVASETLNLN  488
            VWGGV+SE + LN
Sbjct  51   VWGGVSSEIIQLN  63



>ref|XP_003573887.1| PREDICTED: alpha-L-fucosidase 2-like [Brachypodium distachyon]
Length=857

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   RL ++ DTLWTG PG+YT+ +AP  L+ VR LV  G YA+AT
Sbjct  68   WGGVASERLQLNHDTLWTGGPGNYTNPNAPTVLSKVRSLVGKGLYAEAT  116



>ref|WP_010136352.1| alpha-L-fucosidase [Flavobacteriaceae bacterium S85]
Length=793

 Score = 39.3 bits (90),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALP+GN RLGAMV+GG   E +  N
Sbjct  42   NDALPVGNGRLGAMVYGGKTKEVIQFN  68


 Score = 36.6 bits (83),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSDELKNTI  343
            +  + +TLW+G P DY +  A K+LA ++  + DG+  +A E +    + N I
Sbjct  65   IQFNEETLWSGQPHDYVNRRAFKSLAKIKNSLWDGKRKEAEEIANKKFMSNPI  117



>gb|EYU37618.1| hypothetical protein MIMGU_mgv1a001249mg [Erythranthe guttata]
Length=853

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            +G V +  ++++ DTLWTG PG+Y+   A  AL++VRKLVD+G YA+AT  +
Sbjct  78   WGGVANDTINLNEDTLWTGTPGEYSGAGALTALSEVRKLVDNGLYAEATSAA  129


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 3/39 (8%)
 Frame = -2

Query  595  MEPVVGSPA---SDALPIGNDRLGAMVWGGVASETLNLN  488
            +E    +PA   +DALPIGN RLGAM+WGGVA++T+NLN
Sbjct  51   LEVRFNAPAKHWTDALPIGNGRLGAMIWGGVANDTINLN  89



>ref|XP_004983275.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Setaria italica]
Length=800

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRS  364
            +G V   +L ++ DTLWTG+PG+Y D     AL  VRKLVD+G++ +AT  + S
Sbjct  37   WGGVASEKLQLNHDTLWTGVPGNYADSKVAAALPVVRKLVDEGRFVEATAAASS  90



>dbj|BAJ85441.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=636

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   +L ++ DTLWTG PG+YT+  AP  L++VR LVD G Y +AT
Sbjct  68   WGGVTSEKLQLNHDTLWTGGPGNYTNPKAPTVLSEVRSLVDKGLYPEAT  116



>dbj|BAJ95753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=857

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   +L ++ DTLWTG PG+YT+  AP  L++VR LVD G Y +AT
Sbjct  68   WGGVTSEKLQLNHDTLWTGGPGNYTNPKAPTVLSEVRSLVDKGLYPEAT  116



>ref|XP_004983276.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Setaria italica]
Length=747

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRS  364
            +G V   +L ++ DTLWTG+PG+Y D     AL  VRKLVD+G++ +AT  + S
Sbjct  37   WGGVASEKLQLNHDTLWTGVPGNYADSKVAAALPVVRKLVDEGRFVEATAAASS  90



>gb|EMS55421.1| Alpha-L-fucosidase 2 [Triticum urartu]
Length=860

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +G V   +L ++ DTLWTG PG+YT+  AP  L++VR LVD G Y +AT
Sbjct  65   WGGVTSEKLQLNHDTLWTGGPGNYTNPKAPTVLSEVRSLVDKGLYPEAT  113



>ref|WP_028918567.1| alpha/beta hydrolase [Pseudoxanthomonas suwonensis]
Length=803

 Score = 40.4 bits (93),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            +ALP+GN RLGAMVWGG  +E L LN
Sbjct  66   EALPLGNGRLGAMVWGGGRTERLQLN  91


 Score = 34.7 bits (78),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQA  382
            RL ++ DTL+ G P D T   A  AL +VR+L+  G+YA A
Sbjct  87   RLQLNEDTLYAGQPYDPTPAGALAALPEVRRLLFAGRYADA  127



>ref|WP_040490657.1| alpha-L-fucosidase [Indibacter alkaliphilus]
Length=823

 Score = 38.5 bits (88),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 15/47 (32%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSD  361
            + ++ +T+W+G P    + DA  AL ++RKL+ DG+Y +A + ++ +
Sbjct  62   IQLNEETVWSGSPNRNDNPDALAALPEIRKLIFDGEYKKAEQLAKEN  108


 Score = 36.2 bits (82),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            +ALPIGN RLGAM++G    E + LN
Sbjct  40   NALPIGNGRLGAMIYGNYPEEIIQLN  65



>gb|EMT27959.1| Alpha-L-fucosidase 2 [Aegilops tauschii]
Length=871

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  516  VLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            +LH++   + DTLWTG PG+YT+  AP  L++VR LVD G Y +AT
Sbjct  54   LLHIKTVDADDTLWTGGPGNYTNPKAPTVLSEVRSLVDKGLYPEAT  99



>gb|EOZ92828.1| putative large secreted protein [Indibacter alkaliphilus LW1]
Length=822

 Score = 38.1 bits (87),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 15/47 (32%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSD  361
            + ++ +T+W+G P    + DA  AL ++RKL+ DG+Y +A + ++ +
Sbjct  61   IQLNEETVWSGSPNRNDNPDALAALPEIRKLIFDGEYKKAEQLAKEN  107


 Score = 36.2 bits (82),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            +ALPIGN RLGAM++G    E + LN
Sbjct  39   NALPIGNGRLGAMIYGNYPEEIIQLN  64



>ref|WP_024868166.1| alpha/beta hydrolase [Pseudoxanthomonas suwonensis]
Length=802

 Score = 40.4 bits (93),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            +ALP+GN RLGAMVWGG  +E L LN
Sbjct  66   EALPLGNGRLGAMVWGGGRTERLQLN  91


 Score = 34.3 bits (77),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQA  382
            RL ++ DTL+ G P D T   A  AL +VR+L+  G+YA A
Sbjct  87   RLQLNEDTLYAGQPYDPTPPGALAALPEVRRLLFAGRYADA  127



>ref|WP_013225834.1| large protein [Amycolatopsis mediterranei]
 ref|YP_003766164.1| large protein [Amycolatopsis mediterranei U32]
 gb|ADJ45762.1| large secreted protein [Amycolatopsis mediterranei U32]
 gb|AEK42542.1| large protein [Amycolatopsis mediterranei S699]
 gb|AFO77473.1| large protein [Amycolatopsis mediterranei S699]
 gb|AGT84601.1| large protein [Amycolatopsis mediterranei RB]
 gb|KDO05298.1| cellulose-binding protein [Amycolatopsis mediterranei]
 gb|KDU88092.1| cellulose-binding protein [Amycolatopsis mediterranei]
Length=949

 Score = 39.7 bits (91),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQA  382
            RL ++ DT+W G P DY++     AL+ +R+LV   Q+ QA
Sbjct  76   RLQLNEDTVWAGGPHDYSNAQGAGALSQIRQLVFANQWTQA  116


 Score = 34.3 bits (77),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -2

Query  562  ALPIGNDRLGAMVWGGVASETLNLN  488
            ALPIGN RLGAMV G   +E L LN
Sbjct  56   ALPIGNGRLGAMVSGNTDTERLQLN  80



>ref|WP_026461510.1| alpha-L-fucosidase [Adhaeribacter aquaticus]
Length=773

 Score = 38.9 bits (89),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 17/52 (33%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSDELKN  349
            R+ ++ +T+W+G   D+ + +A KAL  VR+L+  G+YA+A + ++   + N
Sbjct  67   RIQLNEETVWSGRKEDFVNPEALKALPQVRQLLFAGKYAEAQKLAQEKMMGN  118


 Score = 34.7 bits (78),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 3/32 (9%)
 Frame = -2

Query  574  PAS---DALPIGNDRLGAMVWGGVASETLNLN  488
            PAS   +A+PIGN RLGAM++G   +E + LN
Sbjct  40   PASNWNEAIPIGNGRLGAMIFGNPNAERIQLN  71



>ref|XP_002298755.2| hypothetical protein POPTR_0001s30610g [Populus trichocarpa]
 gb|EEE83560.2| hypothetical protein POPTR_0001s30610g [Populus trichocarpa]
Length=843

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    + ++ DTLWTG P D+TD   P+AL++VR LVD G++++AT+
Sbjct  58   WGGVSSELIQLNEDTLWTGTPTDFTDPAIPQALSEVRNLVDSGKFSEATK  107



>ref|XP_011030378.1| PREDICTED: alpha-L-fucosidase 2-like isoform X1 [Populus euphratica]
Length=845

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    + ++ DTLWTG P D+TD   P+AL++VR LVD G++++AT+
Sbjct  58   WGGVSSELIQLNEDTLWTGTPTDFTDPAIPQALSEVRNLVDSGKFSEATK  107



>ref|XP_011030379.1| PREDICTED: alpha-L-fucosidase 2-like isoform X2 [Populus euphratica]
Length=843

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            +G V    + ++ DTLWTG P D+TD   P+AL++VR LVD G++++AT+
Sbjct  58   WGGVSSELIQLNEDTLWTGTPTDFTDPAIPQALSEVRNLVDSGKFSEATK  107



>ref|WP_038555047.1| alpha-L-fucosidase [Draconibacterium orientale]
 gb|AHW58797.1| alpha-L-fucosidase [Draconibacterium orientale]
Length=815

 Score = 37.7 bits (86),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 0/47 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSD  361
            + ++ +T+W G P    + DA  AL  VRKL+ DG+Y +A +    D
Sbjct  61   IQLNENTIWAGEPNRNDNPDAKAALTKVRKLIFDGKYKEAQDLVNRD  107


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            +ALP+GN RLGAM++G   +E + LN
Sbjct  39   EALPVGNGRLGAMIYGNPENEIIQLN  64



>ref|WP_035042325.1| alpha/beta hydrolase [Caulobacter henricii]
Length=782

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            FG V   RL ++ DTLW G P D  + +A KAL ++R L+D G+YA+ATE
Sbjct  61   FGGVAAERLQLNEDTLWAGGPYDPANPEALKALPEIRALIDAGEYAKATE  110



>ref|WP_036926624.1| alpha-L-fucosidase [Prevotella sp. MSX73]
Length=787

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALP+GN RLGAMV+G  A+E + LN
Sbjct  39   TDALPLGNGRLGAMVYGIPATERIQLN  65


 Score = 33.9 bits (76),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSDELKNT  346
            R+ ++ +T+W G P    +  A KA+  ++ L+  G+Y +A + + SD +  T
Sbjct  61   RIQLNEETIWAGQPNGNANAKALKAIPVIQDLIWKGEYKKAQDLATSDVMSAT  113



>gb|EJP32702.1| hypothetical protein HMPREF1146_1457 [Prevotella sp. MSX73]
Length=785

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALP+GN RLGAMV+G  A+E + LN
Sbjct  37   TDALPLGNGRLGAMVYGIPATERIQLN  63


 Score = 33.9 bits (76),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSDELKNT  346
            R+ ++ +T+W G P    +  A KA+  ++ L+  G+Y +A + + SD +  T
Sbjct  59   RIQLNEETIWAGQPNGNANAKALKAIPVIQDLIWKGEYKKAQDLATSDVMSAT  111



>ref|WP_004345058.1| possible alpha-L-fucosidase [Prevotella buccae]
 gb|EFU31012.1| hypothetical protein HMPREF6485_1071 [Prevotella buccae ATCC 
33574]
Length=787

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALP+GN RLGAMV+G  A+E + LN
Sbjct  39   TDALPLGNGRLGAMVYGIPATERIQLN  65


 Score = 33.9 bits (76),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSDELKNT  346
            R+ ++ +T+W G P    +  A KA+  ++ L+  G+Y +A + + SD +  T
Sbjct  61   RIQLNEETIWAGQPNGNANAKALKAIPVIQDLIWKGEYKKAQDLATSDVMSAT  113



>ref|WP_004341109.1| alpha-L-fucosidase 2 (Alpha-L-fucosidefucohydrolase 2) (Alpha-1,2-fucosidase 
2) [Prevotella buccae]
 gb|EFC76364.1| hypothetical protein HMPREF0649_00694 [Prevotella buccae D17]
Length=787

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            +DALP+GN RLGAMV+G  A+E + LN
Sbjct  39   TDALPLGNGRLGAMVYGIPATERIQLN  65


 Score = 33.9 bits (76),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSDELKNT  346
            R+ ++ +T+W G P    +  A KA+  ++ L+  G+Y +A + + SD +  T
Sbjct  61   RIQLNEETIWAGQPNGNANAKALKAIPVIQDLIWKGEYKKAQDLATSDVMSAT  113



>ref|WP_008505004.1| alpha-L-fucosidase [Mucilaginibacter paludis]
 gb|EHQ25308.1| alpha-L-fucosidase [Mucilaginibacter paludis DSM 18603]
Length=833

 Score = 42.0 bits (97),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLNGH  482
            +ALPIGN RLGAM++G V  ET+ LN H
Sbjct  52   NALPIGNGRLGAMIYGNVGVETIQLNEH  79


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            + ++  TLW+G P    +  A  +LA +RKL+ +G+  QA +
Sbjct  74   IQLNEHTLWSGGPNRNDNPLALDSLAAIRKLIFNGKQKQAEQ  115



>ref|WP_009100280.1| large secreted protein [Rhodopirellula sp. SWK7]
 gb|EMI43331.1| large secreted protein [Rhodopirellula sp. SWK7]
Length=763

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQA  382
            FG +   RL ++ DTLW+G P +Y + DA + LADVR L++ G+YA A
Sbjct  13   FGGIREERLQLNEDTLWSGGPQNYDNPDALEHLADVRALLEKGEYADA  60



>ref|WP_016195425.1| putative large secreted protein [Arcticibacter svalbardensis]
 gb|EOR94593.1| putative large secreted protein [Arcticibacter svalbardensis 
MN12-7]
Length=833

 Score = 35.8 bits (81),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSD  361
            + ++ +TLW G P    +  A ++LA+VRKL+ +G+  +A   + SD
Sbjct  61   IQLNENTLWAGSPNSNDNPKAKESLAEVRKLMFEGKLTEAQSLANSD  107


 Score = 35.4 bits (80),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 3/33 (9%)
 Frame = -2

Query  577  SPASD---ALPIGNDRLGAMVWGGVASETLNLN  488
            +PA+D   ALP+GN RLGAM++G  + E + LN
Sbjct  32   APAADWNGALPLGNGRLGAMIYGIPSKENIQLN  64



>ref|WP_009099629.1| large secreted protein [Rhodopirellula sp. SWK7]
 gb|EMI43423.1| large secreted protein [Rhodopirellula sp. SWK7]
Length=786

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRS  364
            +G +   RL ++ DTLW+G P  Y + +A   LA VRKL+D G+YAQA + +++
Sbjct  48   YGGIQQERLQLNEDTLWSGGPHSYDNPEAYSHLATVRKLLDQGEYAQAEDVAQN  101



>ref|WP_039131678.1| alpha-L-fucosidase [Flavihumibacter sp. ZG627]
 gb|KIC90520.1| alpha-L-fucosidase [Flavihumibacter sp. ZG627]
Length=819

 Score = 38.1 bits (87),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLNGH  482
            +ALPIGN RLGAMV+G    E + LN H
Sbjct  38   NALPIGNGRLGAMVYGNPEEEIIQLNEH  65


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 15/42 (36%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            + ++  TLW+G P    + +A   L  +R+LV DG+Y +A E
Sbjct  60   IQLNEHTLWSGGPNRNDNPEALAMLPKIRQLVFDGRYKEAEE  101



>dbj|GAM00488.1| putative alpha-L-fucosidase [Sphingomonas parapaucimobilis NBRC 
15100]
Length=826

 Score = 37.0 bits (84),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            D LP+GN RLGAMV GG A E ++LN
Sbjct  51   DGLPVGNGRLGAMVRGGPAREIISLN  76


 Score = 33.5 bits (75),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQA  382
            +S++ D+LW+G PG     DA  +LA+VR+    G Y  A
Sbjct  73   ISLNEDSLWSGYPGSDARPDAQGSLAEVRQAALAGDYHAA  112



>ref|WP_042485754.1| twin-arginine translocation pathway signal protein [Sphingomonas 
parapaucimobilis]
Length=800

 Score = 37.0 bits (84),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            D LP+GN RLGAMV GG A E ++LN
Sbjct  25   DGLPVGNGRLGAMVRGGPAREIISLN  50


 Score = 33.5 bits (75),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQA  382
            +S++ D+LW+G PG     DA  +LA+VR+    G Y  A
Sbjct  47   ISLNEDSLWSGYPGSDARPDAQGSLAEVRQAALAGDYHAA  86



>ref|WP_035071140.1| alpha/beta hydrolase [Caulobacter henricii]
Length=783

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            FG V   RL ++ DTLW G P D  + +A KAL ++R L+D G YA+ATE
Sbjct  59   FGGVAAERLQLNEDTLWAGGPYDPANSEALKALPEIRGLIDAGDYAKATE  108



>emb|CDA84488.1| uncharacterized protein BN772_02910 [Bacteroides sp. CAG:754]
Length=790

 Score = 37.0 bits (84),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = -3

Query  495  ISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQAT  379
            ++ +TLW+G P D  +  A + L  VRK VD+G Y +A+
Sbjct  61   LNEETLWSGYPQDCNNPKAAEVLPLVRKAVDEGDYVKAS  99


 Score = 33.9 bits (76),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            +ALP+GN R+GAMV+G    E   LN
Sbjct  37   EALPLGNGRIGAMVYGNPTQEVYQLN  62



>ref|WP_035089140.1| alpha/beta hydrolase [Caulobacter henricii]
Length=783

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            FG V   RL ++ DTLW G P D  + +A KAL ++R L+D G YA+ATE
Sbjct  59   FGGVAAERLQLNEDTLWAGGPYDPANSEALKALPEIRGLIDAGDYAKATE  108



>ref|WP_042162232.1| alpha-L-fucosidase, partial [Paenibacillus sp. G1]
Length=374

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = -3

Query  582  WDRRLPMLCLLETIVSVPWFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVD  403
            W   LP   L    +    FG V   R  ++ DTLW+G+P +  ++ A +AL  VR LV 
Sbjct  12   WTEALP---LGNGRIGAMQFGGVERDRFGLNEDTLWSGMPRETNNVHALEALPLVRSLVK  68

Query  402  DGQYAQATEPSRS  364
            +G+YA+A E S++
Sbjct  69   EGKYAEADEASKA  81



>ref|WP_028040060.1| alpha/beta hydrolase [Caulobacter sp. URHA0033]
Length=784

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            FG V   RL ++ DTLW G P D  + +A KAL ++R L+D G YA+ATE
Sbjct  60   FGGVAAERLQLNEDTLWAGGPYDPANPEALKALPEIRALIDAGDYAKATE  109



>ref|WP_029915324.1| alpha/beta hydrolase [Caulobacter sp. UNC358MFTsu5.1]
Length=782

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -3

Query  525  FGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            FG V   RL ++ DTLW G P D  + +A KAL ++R L+D G YA+ATE
Sbjct  60   FGGVAAERLQLNEDTLWAGGPYDPANPEALKALPEIRALIDAGDYAKATE  109



>ref|XP_006573903.1| PREDICTED: alpha-L-fucosidase 2-like [Glycine max]
Length=821

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  522  GAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            G V    + ++ DTLWTG P DYT+  AP AL+ VR LV    Y QAT  S
Sbjct  38   GHVHSETIHLNEDTLWTGTPADYTNSKAPPALSHVRNLVHRQHYPQATAAS  88



>gb|KHN30427.1| Alpha-L-fucosidase 2 [Glycine soja]
Length=825

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  522  GAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPS  370
            G V    + ++ DTLWTG P DYT+  AP AL+ VR LV    Y QAT  S
Sbjct  38   GHVHSETIHLNEDTLWTGTPADYTNSKAPPALSHVRNLVHRQHYPQATAAS  88



>gb|KJF45155.1| alpha-L-fucosidase [Draconibacterium sp. JN14CK-3]
Length=815

 Score = 35.0 bits (79),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -2

Query  565  DALPIGNDRLGAMVWGGVASETLNLN  488
            +ALP+GN RLGAM++G   +E + LN
Sbjct  39   EALPVGNGRLGAMIYGNPENEIIQLN  64


 Score = 35.0 bits (79),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 15/47 (32%), Positives = 27/47 (57%), Gaps = 0/47 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSD  361
            + ++ +T+W G P    + DA  +L  VR+L+ DG+Y +A +    D
Sbjct  61   IQLNENTIWAGQPNRNDNPDAKASLKKVRQLIFDGKYKEAQDLVNRD  107



>ref|WP_016277426.1| hypothetical protein [Bacteroides massiliensis]
 gb|EOS11385.1| hypothetical protein C802_03099 [Bacteroides massiliensis dnLKV3]
Length=853

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 3/69 (4%)
 Frame = -3

Query  582  WDRRLPMLCLLETIVSVPWFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVD  403
            W+  LP   L    +    FG  L     ++ +TLW+G PGD+ + +  KAL ++RK VD
Sbjct  42   WEEALP---LGNGRIGAMVFGNPLQEVYQLNEETLWSGGPGDWNNQETVKALPEIRKAVD  98

Query  402  DGQYAQATE  376
            +G YA+A E
Sbjct  99   EGDYAKARE  107



>ref|WP_025017572.1| alpha-L-fucosidase [Bacteroides sartorii]
Length=853

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 3/69 (4%)
 Frame = -3

Query  582  WDRRLPMLCLLETIVSVPWFGAVLHLRLSISTDTLWTGIPGDYTDLDAPKALADVRKLVD  403
            W+  LP   L    +    FG  L     ++ +TLW+G PGD+ + +  KAL ++RK VD
Sbjct  42   WEEALP---LGNGRIGAMVFGNPLQEVYQLNEETLWSGGPGDWNNQETVKALPEIRKAVD  98

Query  402  DGQYAQATE  376
            +G YA+A E
Sbjct  99   EGDYAKARE  107



>ref|WP_035657048.1| alpha-L-fucosidase [Flavobacterium sp. EM1321]
 gb|KDN56524.1| hypothetical protein FEM21_00270 [Flavobacterium sp. EM1321]
Length=825

 Score = 35.4 bits (80),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSDELKNT  346
            RL ++ +T+W G P       + +AL  VRKLV +G++ +A + +  D +  T
Sbjct  65   RLQLNEETIWAGSPNTNAHSKSLEALPIVRKLVFEGKFKEAQDMATRDIMSQT  117


 Score = 34.7 bits (78),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            ++ALP+GN RLGAMV+G  + E L LN
Sbjct  43   NEALPLGNGRLGAMVFGDPSIERLQLN  69



>ref|WP_019945641.1| hypothetical protein [Dyadobacter beijingensis]
Length=825

 Score = 38.9 bits (89),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 1/37 (3%)
 Frame = -2

Query  598  YMEPVVGSPASDALPIGNDRLGAMVWGGVASETLNLN  488
            Y +P  G   +DALP+GN RLGAMV+G    E L LN
Sbjct  29   YKKPA-GKTWTDALPVGNGRLGAMVYGNPEREILKLN  64


 Score = 31.2 bits (69),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = -3

Query  501  LSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATE  376
            L ++  T+W G P    + +A  AL +VRKL+ +G++ +A +
Sbjct  61   LKLNESTVWAGGPNRNDNPNALDALPEVRKLIFEGKHNEAAK  102



>ref|WP_026713979.1| alpha-L-fucosidase [Flavobacterium daejeonense]
Length=820

 Score = 35.0 bits (79),  Expect(2) = 0.001, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  568  SDALPIGNDRLGAMVWGGVASETLNLN  488
            ++ALP+GN RLGAMV+G  + E L LN
Sbjct  39   NEALPLGNGRLGAMVFGNPSIERLQLN  65


 Score = 34.7 bits (78),  Expect(2) = 0.001, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = -3

Query  504  RLSISTDTLWTGIPGDYTDLDAPKALADVRKLVDDGQYAQATEPSRSDELKNT  346
            RL ++ +T+W G P       +  AL  VRKL+ + +Y +A   + SD +  T
Sbjct  61   RLQLNEETIWAGSPNSNAHTKSLAALPTVRKLIFERKYDEAQALADSDIMSQT  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350