BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF002A17

Length=724
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFU34347.1|  70-kDa heat shock protein                               295   1e-91   Ipomoea batatas [batate]
gb|AAK59628.2|  putative dnaK-type molecular chaperone hsc70.1 pr...    280   2e-91   Arabidopsis thaliana [mouse-ear cress]
emb|CCJ09763.1|  putative heat shock protein-70kDa                      277   5e-90   Hirudo medicinalis
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       290   5e-90   Glycine soja [wild soybean]
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     290   6e-90   Glycine max [soybeans]
gb|ACU17965.1|  unknown                                                 277   7e-90   Glycine max [soybeans]
emb|CAA67588.1|  70 kD heatshockprotein                                 276   9e-90   Medicago sativa [alfalfa]
gb|EAY81899.1|  hypothetical protein OsI_37065                          282   3e-89   Oryza sativa Indica Group [Indian rice]
gb|KJB16979.1|  hypothetical protein B456_002G258500                    288   3e-89   Gossypium raimondii
gb|AEO13403.1|  heat shock 70                                           286   3e-89   Glycine max [soybeans]
gb|KDO67650.1|  hypothetical protein CISIN_1g0212722mg                  274   4e-89   Citrus sinensis [apfelsine]
dbj|BAA34919.1|  heat shock protein 70 cognate                          281   4e-89   Salix gilgiana
gb|ACJ11741.1|  heat shock protein 70                                   287   8e-89   Gossypium hirsutum [American cotton]
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         286   1e-88   Jatropha curcas
gb|KDO36486.1|  hypothetical protein CISIN_1g020168mg                   277   2e-88   Citrus sinensis [apfelsine]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    286   2e-88   Nicotiana tomentosiformis
gb|KJB46580.1|  hypothetical protein B456_007G375600                    286   2e-88   Gossypium raimondii
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    282   3e-88   Populus euphratica
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     286   3e-88   
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    286   3e-88   Nelumbo nucifera [Indian lotus]
gb|AAP04522.1|  heat shock protein 70                                   286   3e-88   Nicotiana tabacum [American tobacco]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    286   3e-88   Cicer arietinum [garbanzo]
gb|AAR17080.1|  heat shock protein 70-3                                 285   3e-88   Nicotiana tabacum [American tobacco]
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    285   4e-88   Nicotiana tomentosiformis
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    285   5e-88   Phoenix dactylifera
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...    282   6e-88   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     285   6e-88   Elaeis guineensis
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    285   8e-88   Nicotiana tomentosiformis
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     275   1e-87   Sandersonia aurantiaca [Chinese-lantern lily]
gb|ACJ11740.1|  heat shock protein 70                                   284   1e-87   Gossypium hirsutum [American cotton]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    284   2e-87   Tarenaya hassleriana [spider flower]
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     284   2e-87   Nelumbo nucifera [Indian lotus]
ref|XP_002316294.1|  heat shock protein 70                              283   2e-87   Populus trichocarpa [western balsam poplar]
gb|AAB65162.1|  heat shock cognate protein                              275   2e-87   Solanum commersonii
gb|ACJ11745.1|  heat shock protein 70                                   283   2e-87   Gossypium hirsutum [American cotton]
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    283   2e-87   Nicotiana sylvestris
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    282   2e-87   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    283   2e-87   Populus euphratica
ref|XP_002527736.1|  heat shock protein, putative                       283   2e-87   Ricinus communis
ref|XP_002805956.1|  PREDICTED: heat shock cognate 70 kDa protein...    270   3e-87   
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         283   3e-87   Jatropha curcas
gb|ABP01597.1|  heat shock protein 70                                   273   3e-87   Ageratina adenophora
gb|AAA82974.1|  HSP70b                                                  267   3e-87   Pisum sativum [garden pea]
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        283   4e-87   Morus notabilis
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       283   5e-87   Medicago truncatula
gb|EAZ19310.1|  hypothetical protein OsJ_34853                          282   6e-87   Oryza sativa Japonica Group [Japonica rice]
gb|AEP40944.1|  heat shock protein 70 family protein                    268   6e-87   Posidonia oceanica
ref|NP_001068540.1|  Os11g0703900                                       282   6e-87   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    282   6e-87   Oryza brachyantha
ref|XP_002312090.1|  heat shock protein 70 cognate                      282   7e-87   Populus trichocarpa [western balsam poplar]
ref|XP_007009369.1|  Heat shock protein 70                              282   7e-87   
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   7e-87   Glycine max [soybeans]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       280   7e-87   Medicago truncatula
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             282   8e-87   Capsella rubella
emb|CAA54419.1|  heat shock cognate 70-1                                281   8e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             282   8e-87   Eutrema salsugineum [saltwater cress]
ref|NP_195870.1|  heat shock cognate protein 70-1                       282   8e-87   Arabidopsis thaliana [mouse-ear cress]
gb|AAP42157.1|AF509339_1  heat shock protein 70                         276   9e-87   Saussurea medusa
emb|CAA52684.1|  heat shock protein 70 cognate                          282   9e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    282   1e-86   Camelina sativa [gold-of-pleasure]
gb|ACJ11742.1|  heat shock protein 70                                   281   1e-86   Gossypium hirsutum [American cotton]
gb|ACA23466.1|  heat shock protein 70                                   266   1e-86   Arachis diogoi
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     281   1e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     281   1e-86   
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     281   1e-86   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    281   2e-86   Solanum tuberosum [potatoes]
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    281   2e-86   Solanum lycopersicum
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       279   2e-86   Gossypium arboreum [tree cotton]
emb|CAA55184.1|  heat shock protein 70 kDa                              268   2e-86   Zea mays [maize]
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    281   2e-86   Nicotiana sylvestris
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    281   2e-86   
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       281   2e-86   Medicago truncatula
ref|XP_004142750.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   2e-86   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    281   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    281   3e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         280   3e-86   Jatropha curcas
ref|XP_001783063.1|  predicted protein                                  267   3e-86   
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    280   3e-86   Tarenaya hassleriana [spider flower]
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     280   3e-86   Nicotiana sylvestris
ref|XP_002311161.1|  heat shock protein 70                              280   3e-86   Populus trichocarpa [western balsam poplar]
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     280   3e-86   Glycine soja [wild soybean]
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   3e-86   Tarenaya hassleriana [spider flower]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   3e-86   Glycine max [soybeans]
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                       279   3e-86   Glycine soja [wild soybean]
gb|AEX55235.1|  heat shock protein 70                                   272   4e-86   Allium sativum
emb|CAA47948.2|  heat shock protein 70                                  280   4e-86   Oryza sativa Indica Group [Indian rice]
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          280   4e-86   
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   4e-86   Populus euphratica
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       280   4e-86   Cucurbita maxima [Boston marrow]
ref|XP_002528432.1|  heat shock protein, putative                       280   4e-86   Ricinus communis
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   4e-86   Cucumis sativus [cucumbers]
ref|XP_006378714.1|  heat shock protein 70 cognate                      280   4e-86   Populus trichocarpa [western balsam poplar]
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   4e-86   Solanum tuberosum [potatoes]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             280   4e-86   Prunus persica
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   4e-86   Populus euphratica
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       280   5e-86   Phaseolus vulgaris [French bean]
gb|KJB55903.1|  hypothetical protein B456_009G100400                    280   5e-86   Gossypium raimondii
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    280   5e-86   Glycine max [soybeans]
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   5e-86   Populus euphratica
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     280   5e-86   Glycine soja [wild soybean]
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    280   5e-86   Camelina sativa [gold-of-pleasure]
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     280   5e-86   Prunus mume [ume]
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    280   5e-86   Arabis alpina [alpine rockcress]
gb|AAX07349.1|  heat shock protein 70                                   272   5e-86   Zea mays [maize]
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     280   6e-86   Vigna radiata [mung bean]
gb|ABR13285.1|  putative dnaK-type molecular chaperone hsc70.1          265   6e-86   Prunus dulcis [sweet almond]
gb|ADZ46371.1|  HSP70                                                   280   6e-86   Malus hupehensis
gb|EAY98319.1|  hypothetical protein OsI_20227                          273   6e-86   Oryza sativa Indica Group [Indian rice]
ref|XP_002873056.1|  HSC70-1                                            280   6e-86   Arabidopsis lyrata subsp. lyrata
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   7e-86   
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     280   7e-86   Nicotiana tomentosiformis
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    280   7e-86   Arabis alpina [alpine rockcress]
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...    276   7e-86   
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             279   7e-86   Citrus clementina [clementine]
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    280   8e-86   
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     279   8e-86   Sesamum indicum [beniseed]
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    279   9e-86   Tarenaya hassleriana [spider flower]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    279   9e-86   Solanum lycopersicum
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    279   1e-85   Pyrus x bretschneideri [bai li]
emb|CCA29121.1|  heat shock protein 70 isoform 2                        279   1e-85   Solanum lycopersicum
gb|EEC71767.1|  hypothetical protein OsI_04375                          273   1e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    279   1e-85   Solanum lycopersicum
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    279   1e-85   Sesamum indicum [beniseed]
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    279   1e-85   Solanum tuberosum [potatoes]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    279   1e-85   Eucalyptus grandis [rose gum]
gb|AAB97316.1|  cytosolic heat shock 70 protein                         279   1e-85   Spinacia oleracea
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           279   1e-85   Cucurbita maxima [Boston marrow]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             279   1e-85   Phaseolus vulgaris [French bean]
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             279   1e-85   Phaseolus vulgaris [French bean]
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                279   1e-85   Erythranthe guttata [common monkey flower]
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    279   1e-85   Fragaria vesca subsp. vesca
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                279   1e-85   Erythranthe guttata [common monkey flower]
ref|XP_002532297.1|  heat shock protein, putative                       279   1e-85   Ricinus communis
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             279   1e-85   Populus trichocarpa [western balsam poplar]
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     279   1e-85   Vigna radiata [mung bean]
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    279   2e-85   Tarenaya hassleriana [spider flower]
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...    272   2e-85   Eucalyptus grandis [rose gum]
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    279   2e-85   Pyrus x bretschneideri [bai li]
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         278   2e-85   Jatropha curcas
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    278   2e-85   Prunus mume [ume]
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             278   2e-85   Prunus persica
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    278   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     278   2e-85   Vitis vinifera
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     278   2e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006407675.1|  hypothetical protein EUTSA_v10020258mg             276   2e-85   
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like           271   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    277   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     278   2e-85   Populus euphratica
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     278   3e-85   Triticum urartu
gb|ADB85350.1|  putative heat shock cognate                             278   3e-85   Phyllostachys edulis [kikko-chiku]
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    278   3e-85   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    278   3e-85   Camelina sativa [gold-of-pleasure]
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                278   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_010452091.1|  PREDICTED: probable mediator of RNA polymera...    269   3e-85   Camelina sativa [gold-of-pleasure]
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     278   3e-85   
ref|WP_039310754.1|  molecular chaperone DnaK                           278   3e-85   Paenibacillus sp. IHB B 3415
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     278   3e-85   
emb|CAB72130.1|  heat shock protein 70                                  278   3e-85   Cucumis sativus [cucumbers]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     278   3e-85   
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    278   4e-85   
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    278   4e-85   
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     278   4e-85   Vigna radiata [mung bean]
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     277   4e-85   Cucumis melo [Oriental melon]
ref|XP_003621886.1|  Heat shock protein                                 278   4e-85   Medicago truncatula
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             278   4e-85   Capsella rubella
gb|ADD71975.1|  heat shock protein 70                                   278   4e-85   Rhododendron calophytum
gb|AAV98051.1|  heat shock protein 70                                   277   4e-85   Medicago sativa [alfalfa]
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    278   4e-85   Solanum lycopersicum
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       277   4e-85   Cucumis melo [Oriental melon]
gb|AAB42159.1|  Hsc70                                                   277   4e-85   Solanum lycopersicum
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    277   4e-85   Solanum lycopersicum
gb|AEO22185.1|  CytHSP70                                                275   4e-85   Triticum aestivum [Canadian hard winter wheat]
gb|AHW48175.1|  heat shock protein 70                                   275   5e-85   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                277   5e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    276   5e-85   Camelina sativa [gold-of-pleasure]
emb|CDP09040.1|  unnamed protein product                                277   5e-85   Coffea canephora [robusta coffee]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    277   5e-85   Elaeis guineensis
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             277   5e-85   Citrus clementina [clementine]
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             277   6e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     277   6e-85   Vitis vinifera
gb|ACD93209.1|  heat shock protein 70                                   278   6e-85   Camellia sinensis [black tea]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             277   6e-85   Phaseolus vulgaris [French bean]
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    277   6e-85   Phoenix dactylifera
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    277   6e-85   Citrus sinensis [apfelsine]
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    277   6e-85   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM48131.1|AF509336_1  heat shock protein 70                         277   7e-85   Saussurea medusa
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             277   7e-85   Capsella rubella
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    277   7e-85   Populus euphratica
gb|ADN03965.1|  heat shock cognate 70 kDa protein                       275   7e-85   Phytolacca acinosa [food pokeberry]
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             277   7e-85   Citrus clementina [clementine]
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    277   8e-85   Nicotiana sylvestris
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     276   8e-85   Brachypodium distachyon [annual false brome]
ref|XP_002312089.1|  heat shock protein 70 cognate                      276   9e-85   
gb|ACB70177.1|  70 kDa heat shock protein                               276   9e-85   Capparis spinosa [caper]
gb|AGR45355.1|  HSP70                                                   276   1e-84   Dendrobium officinale
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       276   1e-84   Glycine soja [wild soybean]
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    276   1e-84   
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             276   1e-84   Phaseolus vulgaris [French bean]
emb|CDY40362.1|  BnaA10g27060D                                          271   1e-84   Brassica napus [oilseed rape]
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             276   1e-84   Eutrema salsugineum [saltwater cress]
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             276   1e-84   
emb|CDP00073.1|  unnamed protein product                                276   1e-84   Coffea canephora [robusta coffee]
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    276   1e-84   Tarenaya hassleriana [spider flower]
gb|ACJ85522.1|  unknown                                                 276   2e-84   Medicago truncatula
dbj|BAJ34054.1|  unnamed protein product                                276   2e-84   Eutrema halophilum
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    276   2e-84   
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    276   2e-84   Phoenix dactylifera
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             275   2e-84   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             276   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    276   2e-84   Nicotiana tomentosiformis
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     276   2e-84   Eucalyptus grandis [rose gum]
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             276   2e-84   Citrus clementina [clementine]
emb|CDY50531.1|  BnaA01g30490D                                          276   2e-84   Brassica napus [oilseed rape]
tpg|DAA55190.1|  TPA: heat shock protein70-4                            272   2e-84   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    276   2e-84   Cicer arietinum [garbanzo]
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     278   2e-84   Triticum urartu
emb|CDY52661.1|  BnaC01g38510D                                          275   2e-84   Brassica napus [oilseed rape]
dbj|BAJ91305.1|  predicted protein                                      275   2e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    275   2e-84   Brassica rapa
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    277   2e-84   
gb|EEC76425.1|  hypothetical protein OsI_14101                          270   2e-84   Oryza sativa Indica Group [Indian rice]
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        275   2e-84   Camelina sativa [gold-of-pleasure]
gb|ABD32895.1|  Heat shock protein Hsp70                                275   3e-84   Medicago truncatula
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    275   3e-84   Glycine max [soybeans]
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    275   3e-84   Prunus mume [ume]
gb|AAV97978.1|  heat shock protein hsp70                                275   3e-84   Saussurea medusa
ref|XP_003621869.1|  Heat shock protein                                 275   3e-84   Medicago truncatula
ref|XP_004156719.1|  PREDICTED: heat shock cognate 70 kDa protein...    272   3e-84   
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                275   4e-84   
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    275   5e-84   Phoenix dactylifera
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     275   5e-84   Vitis vinifera
emb|CDX73815.1|  BnaA03g32320D                                          275   5e-84   
ref|XP_010911697.1|  PREDICTED: probable mediator of RNA polymera...    262   5e-84   Elaeis guineensis
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     276   6e-84   Eucalyptus grandis [rose gum]
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    275   6e-84   Cicer arietinum [garbanzo]
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    275   6e-84   Brassica rapa
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             275   6e-84   Phaseolus vulgaris [French bean]
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    275   6e-84   Camelina sativa [gold-of-pleasure]
ref|NP_187555.1|  heat shock protein 70-3                               275   6e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAA62445.1|  heat shock protein                                      274   6e-84   Spinacia oleracea
gb|KJB73858.1|  hypothetical protein B456_011G256600                    275   6e-84   Gossypium raimondii
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          275   6e-84   Amborella trichopoda
ref|XP_002873055.1|  predicted protein                                  275   6e-84   Arabidopsis lyrata subsp. lyrata
dbj|BAJ86014.1|  predicted protein                                      274   6e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIZ68155.1|  heat shock protein 70                                   274   7e-84   Ornithogalum longebracteatum [sea-onion]
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     276   7e-84   Triticum urartu
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    274   7e-84   Solanum tuberosum [potatoes]
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    274   7e-84   Oryza brachyantha
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    274   7e-84   Zea mays [maize]
gb|AGL07711.1|  heat shock protein 70                                   274   8e-84   Ziziphus jujuba [Chinese jujube]
ref|NP_187864.1|  heat shock protein 70-4                               274   8e-84   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                274   8e-84   Erythranthe guttata [common monkey flower]
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             274   8e-84   Eutrema salsugineum [saltwater cress]
dbj|BAP90755.1|  heat shock protein 70                                  274   9e-84   Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CDY00784.1|  BnaC03g37680D                                          274   9e-84   
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     276   9e-84   Eucalyptus grandis [rose gum]
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    274   9e-84   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA05547.1|  heat shock protein 70                                  274   9e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    274   1e-83   Elaeis guineensis
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    274   1e-83   Pyrus x bretschneideri [bai li]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    273   1e-83   Solanum tuberosum [potatoes]
gb|AFA51946.1|  heat shock protein 70                                   273   1e-83   Paeonia suffruticosa [moutan peony]
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    273   1e-83   Camelina sativa [gold-of-pleasure]
gb|ABX76301.1|  heat shock protein 70                                   273   1e-83   Ageratina adenophora
gb|KJB20110.1|  hypothetical protein B456_003G133400                    273   1e-83   Gossypium raimondii
gb|AAB88009.1|  heat shock cognate protein HSC70                        273   1e-83   Brassica napus [oilseed rape]
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    274   1e-83   
ref|NP_001044757.1|  Os01g0840100                                       273   1e-83   
ref|NP_001055754.1|  Os05g0460000                                       273   2e-83   
gb|AIU34470.1|  putative heat shock protein                             273   2e-83   Taraxacum brevicorniculatum
ref|NP_195869.1|  heat shock protein 70                                 273   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    273   2e-83   Setaria italica
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    271   2e-83   
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    273   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    273   2e-83   Fragaria vesca subsp. vesca
gb|AEK70336.1|  heat shock protein 70                                   273   2e-83   Paeonia lactiflora [common garden peony]
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    273   2e-83   
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    273   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    273   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    273   2e-83   
gb|AII99890.1|  heat shock protein                                      277   2e-83   
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    273   2e-83   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    273   3e-83   
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          273   3e-83   
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    273   3e-83   
emb|CCA29120.1|  heat shock protein 70 isoform 1                        273   3e-83   
gb|EAY89450.1|  hypothetical protein OsI_10982                          267   3e-83   
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    272   4e-83   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        272   4e-83   
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    272   4e-83   
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    272   4e-83   
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    272   4e-83   
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     272   4e-83   
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        272   4e-83   
emb|CAA83548.1|  PsHSC71.0                                              272   4e-83   
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    272   4e-83   
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    272   5e-83   
gb|AAS09825.1|  heat shock cognate protein 70                           272   5e-83   
emb|CAB72129.1|  heat shock protein 70                                  272   6e-83   
gb|AIA22210.1|  heat shock protein 70                                   272   6e-83   
ref|XP_003625487.1|  Heat shock protein                                 273   7e-83   
gb|ABP35942.1|  heat shock protein 70                                   271   8e-83   
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    272   8e-83   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    271   8e-83   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             271   8e-83   
emb|CAA55183.1|  heat shock protein 70 kDa                              258   8e-83   
dbj|BAK00257.1|  predicted protein                                      271   1e-82   
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    271   1e-82   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    271   1e-82   
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     271   1e-82   
ref|XP_001767839.1|  predicted protein                                  271   2e-82   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    271   2e-82   
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    271   2e-82   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    277   2e-82   
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    270   2e-82   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    270   2e-82   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          270   2e-82   
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     270   3e-82   
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     270   3e-82   
ref|XP_001785822.1|  predicted protein                                  270   3e-82   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       271   3e-82   
gb|ACR38891.1|  heat shock protein 70                                   270   3e-82   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    270   3e-82   
ref|NP_001051724.1|  Os03g0821100                                       270   4e-82   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    279   4e-82   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             270   4e-82   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             270   4e-82   
ref|XP_001783048.1|  predicted protein                                  269   5e-82   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    270   5e-82   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       269   6e-82   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  269   6e-82   
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       269   8e-82   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    269   8e-82   
gb|ACM42161.1|  heat shock protein 70.58                                269   9e-82   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    273   1e-81   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             268   1e-81   
ref|XP_001751923.1|  predicted protein                                  268   2e-81   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    268   2e-81   
gb|AAB99745.1|  HSP70                                                   268   2e-81   
emb|CDP09035.1|  unnamed protein product                                267   3e-81   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    267   3e-81   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       267   5e-81   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    266   5e-81   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     275   6e-81   
gb|EPS60056.1|  heat shock protein 70                                   266   6e-81   
ref|NP_001049712.1|  Os03g0276500                                       266   8e-81   
dbj|BAK02194.1|  predicted protein                                      266   1e-80   
ref|NP_001049719.2|  Os03g0277300                                       259   1e-80   
gb|EAY89457.1|  hypothetical protein OsI_10990                          259   1e-80   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       266   1e-80   
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    265   2e-80   
tpg|DAA44672.1|  TPA: hsp70 protein                                     263   2e-80   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     266   7e-80   
gb|KJB36734.1|  hypothetical protein B456_006G174000                    263   9e-80   
emb|CDX93666.1|  BnaA06g03820D                                          251   1e-79   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    263   1e-79   
gb|EPS68565.1|  hypothetical protein M569_06198                         263   1e-79   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                263   2e-79   
ref|XP_001759874.1|  predicted protein                                  263   2e-79   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                262   2e-79   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          262   3e-79   
ref|NP_001140835.1|  uncharacterized protein LOC100272911               260   3e-79   
gb|KFK33437.1|  hypothetical protein AALP_AA5G013700                    263   3e-79   
gb|ACH61066.1|  heat shock protein 70 kDa                               249   4e-79   
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       261   8e-79   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       261   9e-79   
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   9e-79   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       261   1e-78   
gb|KHN17505.1|  Heat shock 70 kDa protein                               257   1e-78   
gb|ACH61090.1|  heat shock protein 70 kDa                               247   2e-78   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    260   2e-78   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    260   2e-78   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       260   2e-78   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    259   3e-78   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    259   3e-78   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    259   3e-78   
gb|ACJ54890.1|  heat shock protein 70                                   259   3e-78   
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    259   6e-78   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          258   7e-78   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    261   7e-78   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    258   8e-78   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    258   2e-77   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               257   2e-77   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       258   2e-77   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       257   2e-77   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    257   3e-77   
gb|EPS64948.1|  hypothetical protein M569_09829                         256   3e-77   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          256   4e-77   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        256   5e-77   
gb|ACD45076.1|  heat-shock protein 70                                   256   7e-77   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             256   7e-77   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   8e-77   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    255   1e-76   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          254   2e-76   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    254   3e-76   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          254   4e-76   
ref|XP_003610287.1|  Heat-shock protein                                 254   5e-76   
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400          252   6e-76   
gb|KHN14134.1|  Heat shock 70 kDa protein                               253   7e-76   
emb|CAA27330.1|  heat shock protein 70                                  251   1e-75   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    251   2e-75   
gb|AIU40169.1|  heat shock protein 70                                   251   3e-75   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   251   3e-75   
gb|AAA82975.1|  PsHSP71.2                                               251   4e-75   
sp|P16121.2|HSP70_LUPPO  RecName: Full=Heat shock 70 kDa protein        240   5e-75   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        251   6e-75   
gb|ABR18415.1|  unknown                                                 251   7e-75   
prf||1205208A  heat shock protein hsp70                                 251   7e-75
ref|XP_002502667.1|  heat shock 70 kDa protein                          251   7e-75   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               251   8e-75   
ref|XP_003064239.1|  heat shock protein 70kDa                           249   3e-74   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         248   6e-74   
emb|CDY49668.1|  BnaC06g01970D                                          244   6e-74   
emb|CEG00633.1|  Heat shock protein 70 family                           248   7e-74   
ref|XP_002512741.1|  heat shock protein, putative                       248   1e-73   
gb|AGT97046.1|  heat shock protein 70                                   247   2e-73   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             247   2e-73   
ref|NP_173055.1|  heat shock protein 70B                                246   2e-73   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               246   3e-73   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          246   3e-73   
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        246   3e-73   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         246   4e-73   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    246   5e-73   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          246   6e-73   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             245   7e-73   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             245   7e-73   
ref|XP_002512742.1|  heat shock protein, putative                       245   9e-73   
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        244   1e-72   
emb|CDX96825.1|  BnaA08g23680D                                          244   1e-72   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               244   1e-72   
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        244   1e-72   
emb|CDY33359.1|  BnaC05g12240D                                          241   1e-72   
ref|XP_007023492.1|  Heat shock protein 70B                             244   2e-72   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   244   2e-72   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               244   2e-72   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    244   2e-72   
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    244   2e-72   
emb|CAA44820.1|  heat shock protein 70                                  242   3e-72   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    243   3e-72   
emb|CDO98244.1|  unnamed protein product                                243   4e-72   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               243   4e-72   
ref|XP_002892893.1|  HSP70B                                             243   6e-72   
emb|CDY35063.1|  BnaA06g10730D                                          240   6e-72   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             243   7e-72   
dbj|BAJ34597.1|  unnamed protein product                                243   7e-72   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    243   8e-72   
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             243   8e-72   
gb|ABK25453.1|  unknown                                                 242   9e-72   
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               242   1e-71   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          242   1e-71   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             242   2e-71   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               241   2e-71   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             241   3e-71   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               241   3e-71   
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          241   3e-71   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          241   3e-71   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          241   3e-71   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   241   4e-71   
emb|CDX83960.1|  BnaC08g16850D                                          241   4e-71   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             241   4e-71   
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     241   4e-71   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          241   4e-71   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          241   4e-71   
ref|XP_007512662.1|  Heat Shock Protein 70, cytosolic                   241   5e-71   
gb|ACC93947.1|  heat-shock protein 70                                   240   5e-71   
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          240   6e-71   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          240   7e-71   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             240   8e-71   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          240   1e-70   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     241   1e-70   
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             239   1e-70   
ref|XP_001767221.1|  predicted protein                                  239   2e-70   
ref|XP_006368489.1|  heat shock protein 70 cognate                      239   2e-70   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    238   2e-70   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          238   3e-70   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    238   3e-70   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    238   3e-70   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               238   3e-70   
emb|CCD74508.1|  early-responsive to dehydration 2                      238   3e-70   
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          238   3e-70   
ref|XP_001781229.1|  predicted protein                                  238   3e-70   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               238   5e-70   
gb|KDP44977.1|  hypothetical protein JCGZ_01477                         236   5e-70   
emb|CDP02832.1|  unnamed protein product                                238   5e-70   
ref|XP_006408646.1|  hypothetical protein EUTSA_v10002169mg             235   8e-70   
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                237   8e-70   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               237   9e-70   
ref|XP_007013854.1|  Heat shock protein 70B                             237   9e-70   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          237   1e-69   
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          236   2e-69   
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     236   2e-69   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    236   2e-69   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          236   3e-69   
ref|XP_010537859.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    235   4e-69   
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          235   5e-69   
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like          235   5e-69   
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          235   6e-69   
emb|CDY40360.1|  BnaA10g27080D                                          224   7e-69   
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    235   7e-69   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    234   8e-69   



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDa-phaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELESICNPIIAKMYQGAGGDMGGAMDEDA       +GA AGPKIEEVD
Sbjct  593  GEADEFEDKMKELESICNPIIAKMYQGAGGDMGGAMDEDAPHAGGSSAGASAGPKIEEVD  652



>gb|AAK59628.2| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
Length=215

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  37   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  96

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  97   SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  156

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  157  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  215



>emb|CCJ09763.1| putative heat shock protein-70kDa, partial [Hirudo medicinalis]
Length=229

 Score =   277 bits (709),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  55   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  114

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLS+ DKKKIED+IE AIQWLEGNQL
Sbjct  115  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSAADKKKIEDSIESAIQWLEGNQL  174

Query  363  AESDEFEDKMKELESICNPIIAKMY  289
            AE+DEFEDKMKELESICNPIIAKMY
Sbjct  175  AEADEFEDKMKELESICNPIIAKMY  199



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  470  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  529

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLSSDDKKKIEDAIEQAIQWL+GNQL
Sbjct  530  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQL  589

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  590  AEADEFEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  646



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLSSDDKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  649



>gb|ACU17965.1| unknown [Glycine max]
Length=233

 Score =   277 bits (708),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 157/179 (88%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  58   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  117

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENY+YNMRNT+KDEKIG KL   DKKKIEDAIEQAIQWL+ NQL
Sbjct  118  SEDEEHKKKVEAKNALENYSYNMRNTIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQL  177

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELESICNPIIAKMYQG  G   G   +D       +G+GAGPKIEEVD
Sbjct  178  GEADEFEDKMKELESICNPIIAKMYQGGAGPDVGGAMDD---DVPAAGSGAGPKIEEVD  233



>emb|CAA67588.1| 70 kD heatshockprotein [Medicago sativa]
Length=214

 Score =   276 bits (706),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  38   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  97

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SE+ +HKKKVE KNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIE AIQWL+GNQL
Sbjct  98   SEETEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQL  157

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELE ICNPII KMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  158  GEADEFEDKMKELEGICNPIIGKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  214



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  258  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  317

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  318  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQL  377

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  378  AEADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  434



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNTVKDEKIGSKLS DDKKKIEDAIE+AIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTVKDEKIGSKLSPDDKKKIEDAIEEAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQGAGGDMGG+MDED   A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESVCNPIIAKMYQGAGGDMGGSMDED---APPSGGSGAGPKIEEVD  648



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  384  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  443

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KN LENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIEQAIQWL+GNQL
Sbjct  444  AEDEEHKKKVEAKNTLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQL  503

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  504  AEADEFEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  560



>gb|KDO67650.1| hypothetical protein CISIN_1g0212722mg, partial [Citrus sinensis]
Length=206

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  26   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  85

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD++IGSKLS+ DKK+IED IE+A+QWL+ NQL
Sbjct  86   SEDEEHKKKVEAKNALENYAYNMRNTIKDDQIGSKLSAADKKRIEDTIEEAMQWLDSNQL  145

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  146  AEADEFEDKMKELESICNPIIAKMYQ  171



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score =   281 bits (718),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  233  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  292

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNTVKDEKI SKL +DDKKKIEDAI+QAIQWL+ NQL
Sbjct  293  SEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQL  352

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMGG M++D   A     +GAGPKIEEVD
Sbjct  353  AEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMEDD---APPSGSSGAGPKIEEVD  408



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   287 bits (734),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 169/179 (94%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIGSKLS DDKK+IEDAIE+AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSPDDKKRIEDAIEEAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQGAGGDMGG+MDED   A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESVCNPIIAKMYQGAGGDMGGSMDED---APPSGGSGAGPKIEEVD  648



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLATDDKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG D+GG+MD+D        G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGADVGGSMDDD---VPPAGGSGAGPKIEEVD  648



>gb|KDO36486.1| hypothetical protein CISIN_1g020168mg [Citrus sinensis]
Length=330

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  154  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  213

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +ED++HKKKVE KNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AIQWL+GNQL
Sbjct  214  AEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQL  273

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQG G D G +MDED    + G+G+GAGPKIEEVD
Sbjct  274  AEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDED--GPSAGAGSGAGPKIEEVD  330



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 164/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KDEKIGSKLS DDKKKIEDAI++AI WL+GNQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDEAISWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DM G MDED         +GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGPDMAGGMDED---GPSAGASGAGPKIEEVD  648



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 166/179 (93%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG+KL + DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGAKLPAADKKKIEDAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AESDEFEDKMKELESICNPIIAKMYQGAGGDMGG MDED        G+GAGPKIEEVD
Sbjct  593  AESDEFEDKMKELESICNPIIAKMYQGAGGDMGGGMDED----VTAGGSGAGPKIEEVD  647



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  340  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  399

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNTVKDEKI SKL +DDKKKIEDAI+QAIQWL+ NQL
Sbjct  400  SEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQL  459

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMGG M+ED   A      GAGPKIEEVD
Sbjct  460  AEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMEED---APPAGSGGAGPKIEEVD  515



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KN LENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIEQAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNTLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  649



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 163/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNTVKDEKIG+KL+  DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTVKDEKIGAKLAPADKKKIEDAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG D G  MDED        G GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGPDAGAGMDED---GPSVGGTGAGPKIEEVD  648



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KDEKIGSKLSSDDKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ G  MD+D   A    G+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGAPMDDD---APPAGGSSAGPKIEEVD  648



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSTDDKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIA+MYQGAGGD GGAMDED      GSG+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIARMYQGAGGDAGGAMDED--GPTTGSGSGAGPKIEEVD  649



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KDEKIGSKLSSDDKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ G  MD+D   A    G+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGAPMDDD---APPAGGSSAGPKIEEVD  648



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KDEKIGSKLSSDDKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ G  MD+D   A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGAPMDDD---APPAGGSGAGPKIEEVD  648



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAIEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQGAG DM   M++D   A    G+G+GPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQGAGPDMADGMNDD---APAAGGSGSGPKIEEVD  648



>gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=544

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  368  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  427

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  428  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQL  487

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  488  AEADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  544



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKD+KI SKL+++DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDDKISSKLTAEDKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMG  M++D   A    G+G+GPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGADMGAGMNDD---APSAGGSGSGPKIEEVD  648



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDEDHKKKVE KNALENYAYNMRNTVKDEKIGSKLS DDKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEDHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSVDDKKKIEDAIDQAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQGAGGD G  MD+D         + AGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQGAGGDAGAPMDDD---VPPAGASSAGPKIEEVD  648



>gb|AAL85887.1|AF479058_1 70 kDa heat shock protein [Sandersonia aurantiaca]
Length=336

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  161  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  220

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAIQWL+ NQL
Sbjct  221  SEDEEHKKKVESKNALENYAYNMRNTIKDDKIASKLPAADKKKIEDAIDQAIQWLDNNQL  280

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELESICNPIIAKMYQ   G   G ++ED   AA G  +GAGPKIEEVD
Sbjct  281  AEADEFDDKMKELESICNPIIAKMYQ---GAGAGGVEEDDVPAAAGGSSGAGPKIEEVD  336



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 166/179 (93%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG+KL + DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGAKLPAADKKKIEDAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGGDMGG MDED        G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGDMGGGMDED----VPAGGSGAGPKIEEVD  647



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNTVKDEKIG KL + DKKKIEDAIEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTVKDEKIGEKLPAADKKKIEDAIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNTVKDEKIG+KL+  DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTVKDEKIGAKLAPADKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELESICNPIIAKMYQGAG DMGG MD++        G+GAGPKIEEVD
Sbjct  593  AEADEFDDKMKELESICNPIIAKMYQGAGPDMGGGMDDE---GPSVGGSGAGPKIEEVD  648



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIGS+LS  DKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELESICNPIIAKMYQGAG DMGG+MDED        G+GAGPKIEEVD
Sbjct  593  AEVDEFEDKMKELESICNPIIAKMYQGAGPDMGGSMDED---IPSTGGSGAGPKIEEVD  648



>gb|AAB65162.1| heat shock cognate protein [Solanum commersonii]
Length=339

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK
Sbjct  163  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYK  222

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL ++DKKKIEDAI+QAI WL+ NQL
Sbjct  223  AEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLGAEDKKKIEDAIDQAISWLDSNQL  282

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQGAGG+ G  MD+D   A      GAGPKIEEVD
Sbjct  283  AEADEFEDKMKELESLCNPIIAKMYQGAGGEAGAPMDDD--DAPPAGSTGAGPKIEEVD  339



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 164/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIGSKL   DKKKIEDAI+ AIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMGG MDED   A    G+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMDED---APPTGGSSAGPKIEEVD  648



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KDEKIGSKLS DDKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ G  MD+D   A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGAPMDDD---APPAGGSGAGPKIEEVD  648



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  426  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  485

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  486  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQL  545

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  546  AEADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  602



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIGS+LS  DKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELESICNPIIAKMYQGAG DMGG+MDED        G+GAGPKIEEVD
Sbjct  593  AEVDEFEDKMKELESICNPIIAKMYQGAGPDMGGSMDED---IPSTGGSGAGPKIEEVD  648



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 165/179 (92%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG+KLS  DKKKIEDAIE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGAKLSPADKKKIEDAIESAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+MG  MDED    A   G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEMGAGMDED----APAGGSGAGPKIEEVD  647



>ref|XP_002805956.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Macaca mulatta]
Length=224

 Score =   270 bits (690),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  45   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  104

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HK+KVE+KN+LENYAYNMRNT+KDEKI +K+   DKKKI+DAIEQAIQWL+ NQL
Sbjct  105  SEDEEHKRKVESKNSLENYAYNMRNTIKDEKIAAKVDPSDKKKIDDAIEQAIQWLDNNQL  164

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELESICNPIIAKMYQ
Sbjct  165  AEADEFDDKMKELESICNPIIAKMYQ  190



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 164/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNTVKDEKI SKL++DDKKKIEDAIEQAI WL+ NQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTVKDEKISSKLAADDKKKIEDAIEQAIHWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG+G DM G MDED   A    G+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGSGPDMAGGMDED---APPAGGSSAGPKIEEVD  648



>gb|ABP01597.1| heat shock protein 70 [Ageratina adenophora]
Length=301

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 158/179 (88%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  125  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  184

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQL
Sbjct  185  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDANQL  244

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE++CNPIIAKMYQG  GD  GA   D       SG GAGPKIEEVD
Sbjct  245  AEADEFEDKMKELENVCNPIIAKMYQGGAGDAAGAGGMD--EEPAPSGGGAGPKIEEVD  301



>gb|AAA82974.1| HSP70b, partial [Pisum sativum]
Length=161

 Score =   267 bits (683),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKMV+EAEKYK
Sbjct  4    APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVEEAEKYK  63

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+ DEKIGSKLS +DKKKI+DAIE AIQWL+ NQL
Sbjct  64   AEDEEHKKKVDAKNALENYAYNMRNTINDEKIGSKLSPEDKKKIDDAIEAAIQWLDSNQL  123

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIAKMYQ
Sbjct  124  AEADEFEDKMKELESLCNPIIAKMYQ  149



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNTVKDEKI SKLS  DKKKIEDAI+ AIQWL+GNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTVKDEKISSKLSPSDKKKIEDAIDGAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG   G    D        G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGPDVGGAGMDEDDVPPAGGSGAGPKIEEVD  651



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 167/179 (93%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIE AIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELE ICNPIIA+MYQGAGGD GGAMDED      GSG+GAGPKIEEVD
Sbjct  593  GEADEFEDKMKELEGICNPIIARMYQGAGGDAGGAMDED--GPTAGSGSGAGPKIEEVD  649



>gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group]
Length=632

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  456  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  515

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  516  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQL  575

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  576  AEADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  632



>gb|AEP40944.1| heat shock protein 70 family protein [Posidonia oceanica]
Length=200

 Score =   268 bits (686),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 163/179 (91%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  26   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  85

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKK+E+KNALENYAYNMRNT++DEKI  KL++ DKKKIEDAI++AIQWL+ NQL
Sbjct  86   SEDEEHKKKIESKNALENYAYNMRNTIRDEKISEKLAAADKKKIEDAIDEAIQWLDNNQL  145

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEF+DKMKELE++CNPIIAKMYQGAGGD+ G MDED       + +G GPKIEEVD
Sbjct  146  GEADEFDDKMKELENVCNPIIAKMYQGAGGDVDGGMDED----GLSAPSGPGPKIEEVD  200



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  593  AEADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  649



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  593  AEADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  649



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   282 bits (722),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNTVKDEKI SKL +DDKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDTNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMGG M+ED   A      GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMEED---APPAGSGGAGPKIEEVD  648



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   282 bits (721),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKK E KN+LENYAYNMRNTVKDEKIGSKLS DDKKKIEDAI+ A+QWL+GNQL
Sbjct  533  AEDEEHKKKAEAKNSLENYAYNMRNTVKDEKIGSKLSPDDKKKIEDAIDGAVQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMGGA   D        G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGPDMGGAGMAD--DIPPAGGSGAGPKIEEVD  649



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  410  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  469

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+GNQL
Sbjct  470  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQL  529

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES CNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  530  AEADEFEDKMKELESTCNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  586



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  402  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  461

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HK+KVE KNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIE AIQWL+GNQL
Sbjct  462  SEDEEHKRKVEAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQL  521

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELE ICNPIIA+MYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  522  GEADEFEDKMKELEGICNPIIARMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  578



>ref|XP_006287234.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
 gb|EOA20132.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
Length=651

 Score =   282 bits (721),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGAGGMDDDAPPASGGAGPKIEEVD  651



>emb|CAA54419.1| heat shock cognate 70-1 [Arabidopsis thaliana]
Length=637

 Score =   281 bits (720),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNK+TITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  459  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKVTITNDKGRLSKDEIEKMVQEAEKYK  518

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  519  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  578

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  579  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  637



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   282 bits (721),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG         A  S  GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGAAGMDDDAPPSSGGAGPKIEEVD  651



>ref|NP_195870.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 sp|P22953.3|MD37E_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37e; AltName: Full=Heat shock 70 kDa protein 1; 
AltName: Full=Heat shock cognate 70 kDa protein 1; AltName: 
Full=Heat shock cognate protein 70-1; Short=AtHsc70-1; AltName: 
Full=Heat shock protein 70-1; Short=AtHsp70-1; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 2 [Arabidopsis 
thaliana]
 emb|CAB85987.1| dnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAL09715.1| AT5g02500/T22P11_90 [Arabidopsis thaliana]
 gb|AAM53305.1| DnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAO22583.1| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
 gb|AED90480.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=651

 Score =   282 bits (721),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  651



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score =   276 bits (705),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 161/179 (90%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  253  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  312

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQL
Sbjct  313  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQL  372

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE++CNPIIAKMYQG  GD  G MDED    A  SG GAGPKIEEVD
Sbjct  373  AEADEFEDKMKELENVCNPIIAKMYQGGAGDAAGGMDED----AAPSGGGAGPKIEEVD  427



>emb|CAA52684.1| heat shock protein 70 cognate [Arabidopsis thaliana]
Length=651

 Score =   282 bits (721),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKIEEVD  651



>ref|XP_010452093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Camelina sativa]
 ref|XP_010452094.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Camelina sativa]
 ref|XP_010490701.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGAAGMDDDAPPASGGAGPKIEEVD  651



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN+LENYAYNMRNT+KDEKIGSKL   DKKKIEDAI+ AIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNSLENYAYNMRNTIKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMGG MDED   A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMDED---APPTGGSGAGPKIEEVD  648



>gb|ACA23466.1| heat shock protein 70 [Arachis diogoi]
Length=172

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 154/177 (87%), Gaps = 6/177 (3%)
 Frame = -2

Query  717  RGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSE  538
            RGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSE
Sbjct  2    RGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSE  61

Query  537  DEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLAE  358
            DE+HKKKVE KN LENYAYNMRNT+KD+KI SKLS  DK KI+DAIEQAIQWL+ NQLAE
Sbjct  62   DEEHKKKVEAKNTLENYAYNMRNTIKDDKISSKLSPADKTKIDDAIEQAIQWLDANQLAE  121

Query  357  SDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            +DEFEDKMKELESICNPIIAKMYQ      GGA  E    A    G+GAGPKIEEVD
Sbjct  122  ADEFEDKMKELESICNPIIAKMYQ------GGAGGEVDDDAPPAGGSGAGPKIEEVD  172



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+ D+KI SKL++ DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTINDDKIASKLAAADKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELESICNPIIAKMYQGAG DM G MD+D   A    G+GAGPKIEEVD
Sbjct  593  AEADEFDDKMKELESICNPIIAKMYQGAGADMAGGMDDD---APPAGGSGAGPKIEEVD  648



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 166/179 (93%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKIG+KL+  DKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLTPADKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMGG M++D       SG+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGPDMGGPMEDD---VPPASGSGAGPKIEEVD  648



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKLS+DD+ KIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE++EFEDKMKELES+CNPIIAKMYQ
Sbjct  593  AEAEEFEDKMKELESLCNPIIAKMYQ  618



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNT+KDEKI SKL   D+KKIE+AIEQAIQWL+ NQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AESDEFEDKMKELESICNPIIAKMYQGAGGDMG  M +D    A   G+GAGPKIEEVD
Sbjct  593  AESDEFEDKMKELESICNPIIAKMYQGAGGDMGADMGDD--GPAPSGGSGAGPKIEEVD  649



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNT+KDEKI SKL   D+KKIE+AIEQAIQWL+ NQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AESDEFEDKMKELESICNPIIAKMYQGAGGDMG  M +D    A   G+GAGPKIEEVD
Sbjct  593  AESDEFEDKMKELESICNPIIAKMYQGAGGDMGADMGDD--GPAPSGGSGAGPKIEEVD  649



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  393  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  452

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN LENYAYNMRNT+KDEKI SKL + DKKKIEDAIEQAIQWL+GNQL
Sbjct  453  SEDEEHKKKVEAKNGLENYAYNMRNTIKDEKISSKLPAADKKKIEDAIEQAIQWLDGNQL  512

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQGAGGDMG    +D    + G G+GAGPKIEEVD
Sbjct  513  AEADEFEDKMKELEGICNPIIAKMYQGAGGDMGAGPMDD-DGPSVGGGSGAGPKIEEVD  570



>emb|CAA55184.1| heat shock protein 70 kDa [Zea mays]
Length=219

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  43   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  102

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+ AI WL+ NQL
Sbjct  103  SEDEEHKKKVESKNSLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDAAISWLDANQL  162

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELES+ NPIIAKMYQ
Sbjct  163  AEADEFDDKMKELESLSNPIIAKMYQ  188



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            +PRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  SPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KDEKIGSKLS DDKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQ  G     A   D         +GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQDGGAGPDMAGGMD-EDGPSAGASGAGPKIEEVD  650



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  474  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  533

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDEDHKKKVE KNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AI WL+GNQL
Sbjct  534  AEDEDHKKKVEAKNALENYAYNMRNTIKDEKIAAKLPAADKKKIEDAIEKAISWLDGNQL  593

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQGAG DM G MDED        G+ AGPKIEEVD
Sbjct  594  AEADEFEDKMKELEGICNPIIAKMYQGAGADMAGGMDED---GPTTGGSSAGPKIEEVD  649



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HK+KVE KNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAIE AIQWL+GNQL
Sbjct  533  SEDEEHKRKVEAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELE ICNPIIA+MYQGAGGD GGAMDED    A GSG+GAGPKIEEVD
Sbjct  593  GEADEFEDKMKELEGICNPIIARMYQGAGGDAGGAMDED--GPAAGSGSGAGPKIEEVD  649



>ref|XP_004142750.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156713.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=613

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK+VQEAEK+K
Sbjct  438  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFK  497

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE+KNALENYAYNMRNT++DEKIG KL+  DKKKIEDA+EQAIQWL+ NQL
Sbjct  498  AEDEEHKKKVESKNALENYAYNMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQL  557

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AESDEFEDKMKELESICNPIIAKMYQG     G AM++D   A    G+GAGPKIEEVD
Sbjct  558  AESDEFEDKMKELESICNPIIAKMYQGGADMGGAAMNDD---APPSGGSGAGPKIEEVD  613



>ref|XP_010423853.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL   DKKKIED+IEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPVADKKKIEDSIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG         A  +  GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGAAGMDDDAPPASGGAGPKIEEVD  651



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL++ D+KKIEDAIEQAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLAAADRKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DM G MD+D        G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGADMAGEMDDD---VPAAGGSGAGPKIEEVD  648



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  442  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  501

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKL++ DKKKIEDAI+QAIQWL+ NQL
Sbjct  502  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLAAADKKKIEDAIDQAIQWLDSNQL  561

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG DMGG M++D        G+GAGPKIEEVD
Sbjct  562  AEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMEDD---VPPAGGSGAGPKIEEVD  617



>ref|XP_001783063.1| predicted protein [Physcomitrella patens]
 gb|EDQ52132.1| predicted protein, partial [Physcomitrella patens]
Length=220

 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  43   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  102

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKK+E KN+LENYAYNMRNT++D+KI + L + DKKKIEDA+E AIQWL+ NQL
Sbjct  103  SEDEDHKKKIEAKNSLENYAYNMRNTIRDDKIAANLDAADKKKIEDAVEAAIQWLDHNQL  162

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AESDEFEDKMKELES+CNPIIA+MYQ
Sbjct  163  AESDEFEDKMKELESVCNPIIARMYQ  188



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 159/181 (88%), Gaps = 2/181 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT++DEKIGSKL  +DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGSKLKPEDKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmg--gamDEDaphaaggsgagaGPKIEEV  190
            AE+DEFEDKMKELESICNPIIA+MYQG  G         +D    + G G GAGPKIEEV
Sbjct  593  AEADEFEDKMKELESICNPIIAQMYQGGAGADMDGAGGMDDDCAPSAGGGRGAGPKIEEV  652

Query  189  D  187
            D
Sbjct  653  D  653



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENY+YNMRNTVKDEKI SKLS++DKKKIEDAIE+AIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYSYNMRNTVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE ICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQ  618



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIGSKL+  DKKKIEDAI+QAI WL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLNPADKKKIEDAIDQAIHWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG G DMGG MDED   A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGDGADMGGRMDED---APSTGGSGAGPKIEEVD  648



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+GNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES CNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESTCNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  649



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT++DEKIGSKLS DDKKKIED I++AIQWL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGSKLSPDDKKKIEDTIDEAIQWLDNNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG+     G  D D   A    G+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGSAASTEGNADVD-ADAPPSGGSTAGPKIEEVD  650



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+GNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  649



>gb|KHN48981.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=585

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 157/179 (88%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  410  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  469

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENY+YNMRNT+KDEKIG KL   DKKKIEDAIEQAIQWL+ NQL
Sbjct  470  SEDEEHKKKVEAKNALENYSYNMRNTIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQL  529

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELESICNPIIAKMYQG  G   G   +D       +G+GAGPKIEEVD
Sbjct  530  GEADEFEDKMKELESICNPIIAKMYQGGAGPDVGGAMDD---DVPAAGSGAGPKIEEVD  585



>gb|AEX55235.1| heat shock protein 70 [Allium sativum]
Length=367

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  192  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  251

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN LENYAYNMRNT+KD+KI SKLS +DKKKIEDAI++AIQWL+ NQL
Sbjct  252  SEDEEHKKKVESKNTLENYAYNMRNTIKDDKIASKLSGEDKKKIEDAIDEAIQWLDSNQL  311

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELES+CNPIIAKMYQ
Sbjct  312  AEADEFDDKMKELESLCNPIIAKMYQ  337



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   280 bits (717),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 164/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ AEKYK
Sbjct  472  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQGAEKYK  531

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  532  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQL  591

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG DM G MDED   A    G+GAGPKIEEVD
Sbjct  592  AEADEFDDKMKELEGICNPIIAKMYQGAGADMAGGMDED--DAPPAGGSGAGPKIEEVD  648



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG+KL   DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGAKLPPADKKKIEDAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNTVKDEKI SKL++DDKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELESICNPIIAKMYQGAG DMGG MD+D   A    G+GAGPKIEEVD
Sbjct  593  AEADEFDDKMKELESICNPIIAKMYQGAGPDMGGGMDDD---APPAGGSGAGPKIEEVD  648



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTV DEKIG+KLS  DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVNDEKIGAKLSQADKKKIEDAIEQAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKK++ KNALENYAYNMRNTVKDEKI SKLS DDKKKIEDAIEQAIQWL+ NQL
Sbjct  533  AEDEEHKKKIDAKNALENYAYNMRNTVKDEKISSKLSPDDKKKIEDAIEQAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK+VQEAEK+K
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE+KNALENYAYNMRNT++DEKIG KL+  DKKKIEDA+EQAIQWL+ NQL
Sbjct  533  AEDEEHKKKVESKNALENYAYNMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AESDEFEDKMKELESICNPIIAKMYQG     G AM++D   A    G+GAGPKIEEVD
Sbjct  593  AESDEFEDKMKELESICNPIIAKMYQGGADMGGAAMNDD---APPSGGSGAGPKIEEVD  648



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNTVKDEKI SKL++DDKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNSLENYAYNMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELESICNPIIAKMYQGAG DMGG MD+D   A    G+GAGPKIEEVD
Sbjct  593  AEADEFDDKMKELESICNPIIAKMYQGAGPDMGGGMDDD---APPSGGSGAGPKIEEVD  648



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKLS+DDK KI+DAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDKTKIDDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE++EFEDKMKELES+CNPIIAKMYQ
Sbjct  593  AEAEEFEDKMKELESLCNPIIAKMYQ  618



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG   G   ++        G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGPDVGGGMDE--DVPPAGGSGAGPKIEEVD  649



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKD+KI SKL++DDKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG KL   DKKKIEDAIEQ+IQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG  G   G             G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGGAGPDMGGAPPADTEYTPSGGSGAGPKIEEVD  651



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKINSKLPAADKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQGAGGDMG    +D    + G G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQGAGGDMGAGPMDD-DGPSVGGGSGAGPKIEEVD  650



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 158/181 (87%), Gaps = 2/181 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKD+KIG KL   DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDDKIGEKLDPADKKKIEDAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgagg--dmggamDEDaphaaggsgagaGPKIEEV  190
            AE+DEFEDKMKELESICNPIIAKMYQG  G    G    ED   A    G+GAGPKIEEV
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGGAGPDVGGAGAAEDEYAAPPSGGSGAGPKIEEV  652

Query  189  D  187
            D
Sbjct  653  D  653



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVETKNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVETKNALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+GNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  649



>ref|XP_010484430.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  474  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  533

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  534  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  593

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  594  AETDEFEDKMKELESICNPIIAKMYQ  619



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   280 bits (716),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNT++DEKIG KL++DDKKKIED+IE AI+WLEGNQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEGAIEWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AECDEFEDKMKELESICNPIIAKMYQ  618



>gb|AAX07349.1| heat shock protein 70 [Zea mays]
Length=373

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  197  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  256

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+ AI WL+ NQL
Sbjct  257  SEDEEHKKKVESKNSLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDAAISWLDANQL  316

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELES+CNPIIAKMYQ
Sbjct  317  AEADEFDDKMKELESLCNPIIAKMYQ  342



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KN+LENYAYNMRNT+KDEKI SKL +DDKKKIEDAI+QAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNSLENYAYNMRNTIKDEKIASKLPADDKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELESICNPIIAKMYQGAGGD GGAMDED    A  SG+GAGPKIEEVD
Sbjct  593  GEADEFEDKMKELESICNPIIAKMYQGAGGDAGGAMDED--GPAPASGSGAGPKIEEVD  649



>gb|ABR13285.1| putative dnaK-type molecular chaperone hsc70.1 [Prunus dulcis]
Length=179

 Score =   265 bits (677),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  36   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  95

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV  KNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQL
Sbjct  96   SEDEEHKKKVGAKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQL  155

Query  363  AESDEFEDKMKELESICNPIIAKM  292
            AE+DEFEDKMKELESICNPIIAKM
Sbjct  156  AEADEFEDKMKELESICNPIIAKM  179



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG  G        D        G+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGGAGGPDVGGGMD-EDVPPAGGSSAGPKIEEVD  650



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  236  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  295

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKL++DDKK+IEDAI+ AI WL+ NQL
Sbjct  296  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQL  355

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQG G DM G MDED    A   G+GAGPKIEEVD
Sbjct  356  AEADEFEDKMKELEGICNPIIAKMYQGPGADMAGGMDED----APAGGSGAGPKIEEVD  410



>ref|XP_002873056.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49315.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
Length=650

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_009357719.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=649

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  472  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  531

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  532  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQL  591

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG  G        D        G+GAGPKIEEVD
Sbjct  592  AEADEFEDKMKELESICNPIIAKMYQGGAGGPDVGGGMD-EDVPPAGGSGAGPKIEEVD  649



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENY+YNMRNTVKDEKI SKLS++DKKKIEDAIE+AIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYSYNMRNTVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE +CNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELEGLCNPIIAKMYQ  618



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_004492129.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=542

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  368  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  427

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KN+LENYAYNMRNT+KD+KI SKLS  DKK IEDAIEQAIQWL+ NQL
Sbjct  428  SEDEDHKKKVEAKNSLENYAYNMRNTIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQL  487

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE+ICNPIIAKMYQ
Sbjct  488  AEADEFEDKMKELETICNPIIAKMYQ  513



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   279 bits (714),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIGSKL+  DKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLAPADKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   280 bits (715),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG  G        D        G+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGGAGGPDVGGGMD-EDVPPAGGSSAGPKIEEVD  650



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   279 bits (714),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKI SKL + DKKKIEDAIE +IQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIASKLPAADKKKIEDAIESSIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT++DEKIG KL + DKKKIEDAIE+AIQWLEGNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIRDEKIGEKLQAADKKKIEDAIEEAIQWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANG LNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGTLNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKLS+DD+ KIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE++EFEDKMKELES+CNPIIAKMYQ
Sbjct  593  AEAEEFEDKMKELESLCNPIIAKMYQ  618



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG  G        D        G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGGAGGPDVGGGMD-EDVPPAGGSGAGPKIEEVD  650



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKI ITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKIPITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKLS+DD+ KIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE++EFEDKMKELES+CNPIIAKMYQ
Sbjct  593  AEAEEFEDKMKELESLCNPIIAKMYQ  618



>gb|EEC71767.1| hypothetical protein OsI_04375 [Oryza sativa Indica Group]
Length=423

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  247  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  306

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAI+ AI WL+ NQL
Sbjct  307  AEDEEHKKKVDAKNALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQL  366

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  367  AEADEFEDKMKELESICNPIIAKMYQ  392



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLS+DDKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLSADDKKKIEDAIDQAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQGAGG+ G  MD+D   A      GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESLCNPIIAKMYQGAGGEAGAPMDDD--DAPPAGSTGAGPKIEEVD  649



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIE +IQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIESSIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 162/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+ KKKVE KN+LENYAYNMRNTVKDEKIGSKLSSDDKKKIEDA++QAI WLE NQL
Sbjct  533  AEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELE ICNPIIAKMYQGAGGD G  MD+D   A    G+ AGPKIEEVD
Sbjct  593  AEVDEFEDKMKELEGICNPIIAKMYQGAGGDAGVPMDDD---APPSGGSSAGPKIEEVD  648



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNT+KDEKI +KLS  DKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTIKDEKISAKLSDGDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNTVKDEKI SK+S  DKKKIE++I+ AI WLE NQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTVKDEKISSKISEADKKKIEESIDNAINWLESNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG+ GG   +D    + G+ +G GPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGEAGGVPMDDDEVPSAGASSGPGPKIEEVD  651



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTV DEKIG+KLS  DKKKIEDAIEQ+IQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIEDAIEQSIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG KL   DKKKIEDAIEQ+IQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG  G   G             G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGGAGPDMGGAPPADTEYTPSGGSGAGPKIEEVD  651



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 155/179 (87%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNTVKDEKIG KL   DKKKIEDA+EQ IQWL+ NQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDTNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELES+CNPIIAKMYQG  G   G   +D        G+GAGPKIEEVD
Sbjct  593  GEADEFEDKMKELESLCNPIIAKMYQGGAGPDMGGAMDD---DVPAGGSGAGPKIEEVD  648



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDLDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL +DDKKK+EDAIE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLGADDKKKVEDAIEGAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggd-mggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELE ICNPIIAKMYQG+GG  M G MDED P +A G  +G GPKIEEVD
Sbjct  593  GEADEFEDKMKELEGICNPIIAKMYQGSGGPDMAGGMDEDGPPSAAGGSSGPGPKIEEVD  652



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Fragaria vesca subsp. vesca]
Length=647

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 158/179 (88%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKIG KL   DKKKIEDAIE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGEKLPGADKKKIEDAIEAAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG+G D  G +D+D          GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGSGPDGAGPVDDD----VPAGSGGAGPKIEEVD  647



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 158/179 (88%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIE +IQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIEASIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AESDEFEDKMKELESICNPIIAKMYQ   G  G A  +D   A    G+ AGPKIEEVD
Sbjct  593  AESDEFEDKMKELESICNPIIAKMYQ---GAGGEAPMDDDEAAPSHGGSTAGPKIEEVD  648



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNTVKDEKI SKL + DKK+IEDAI+ AIQWL+GNQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTVKDEKISSKLDAADKKRIEDAIDGAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESVCNPIIAKMYQ  618



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKD+KI SKL++DDKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  472  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  531

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKD+KIG KL   DKKKIEDAIEQAIQWL+ NQL
Sbjct  532  SEDEEHKKKVEAKNALENYAYNMRNTVKDDKIGGKLDPADKKKIEDAIEQAIQWLDSNQL  591

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQG  G   G             G+GAGPKIEEVD
Sbjct  592  AEADEFEDKMKELESVCNPIIAKMYQGGAGPDMGGAPPADDEYTPSGGSGAGPKIEEVD  650



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYK
Sbjct  474  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYK  533

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+ KKKVE KNALENYAYNMRNT++DEKIG KL  +DKKKIE+AIEQAIQWLEGNQL
Sbjct  534  SEDEELKKKVEAKNALENYAYNMRNTIRDEKIGEKLGPEDKKKIEEAIEQAIQWLEGNQL  593

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DE EDKMKELESICNPIIAKMYQG+ G    A   D  H    SG+GAGPKIEEVD
Sbjct  594  AEVDELEDKMKELESICNPIIAKMYQGSAGAPDMAGGMDDDHVPPSSGSGAGPKIEEVD  652



>ref|XP_010042813.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Eucalyptus grandis]
Length=415

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 162/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  240  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  299

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AI WL+GNQL
Sbjct  300  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKISAKLPAADKKKIEDAIEEAIHWLDGNQL  359

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQGAG DMGG MDED        G+GAGPKIEEVD
Sbjct  360  AEADEFEDKMKELEGICNPIIAKMYQGAGPDMGGGMDED---VPPAGGSGAGPKIEEVD  415



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 163/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  481  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  540

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQL
Sbjct  541  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQL  600

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGGD  G +D+D    A  S +G GPKIEEVD
Sbjct  601  AEADEFEDKMKELESICNPIIAKMYQGAGGDGAGPVDDD---DAPPSASGPGPKIEEVD  656



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENY+YNMRNTVKDEKIG+KLS  DKKKIEDAIE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYSYNMRNTVKDEKIGAKLSPADKKKIEDAIEAAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNTV+DEKIGSKL+  DKKKIED++E AIQWL+GNQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELE++CNPIIAKMYQGAG + GG   +D    A  + +GAGPKIEEVD
Sbjct  593  AECDEFEDKMKELENLCNPIIAKMYQGAGAEAGGGGVDD---DAPPAASGAGPKIEEVD  648



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNTV+DEKIGSKL+  DKKKIED++E AIQWL+GNQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTVRDEKIGSKLNPADKKKIEDSVEDAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELE++CNPIIAKMYQGAG + GG   +D   A   + +GAGPKIEEVD
Sbjct  593  AECDEFEDKMKELENLCNPIIAKMYQGAGAEAGGGGVDD--DAPPPAASGAGPKIEEVD  649



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 162/179 (91%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGGD  G +D+D    A  S +G GPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGDGAGPVDDD----APPSASGPGPKIEEVD  647



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNTVKDEKIG+KL   DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVDAKNALENYAYNMRNTVKDEKIGAKLPPADKKKIEDAIEQAIQWLDNNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 158/179 (88%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKI SKLS  DKKKIEDAIEQA+QWL+GNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIKDEKISSKLSEADKKKIEDAIEQAVQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQG+    G     D    A G  +GAGPKIEEVD
Sbjct  593  AEADEFDDKMKELEGICNPIIAKMYQGSADMGGQM---DEDGPAPGGASGAGPKIEEVD  648



>ref|XP_006407675.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49128.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=561

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  384  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  443

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNT++DEKIG KL++DDKKKIED+IE AI+WL+ NQL
Sbjct  444  SEDEDHKKKVEAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQL  503

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE DEFEDKMKELESICNPIIAKMYQ
Sbjct  504  AECDEFEDKMKELESICNPIIAKMYQ  529



>dbj|BAD94888.1| dnaK-type molecular chaperone hsc70.1 - like [Arabidopsis thaliana]
Length=404

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTG+KNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  224  APRGVPQITVCFDIDANGILNVSAEDKTTGKKNKITITNDKGRLSKEDIEKMVQEAEKYK  283

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKK+ED+IE+AIQWL+GNQL
Sbjct  284  SEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQL  343

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
             E+DEFEDKMKELES+CNPII KMYQ
Sbjct  344  GEADEFEDKMKELESVCNPIIGKMYQ  369



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  444  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  503

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNTV+DEKI SKL++ DKKKIEDAIEQAIQWL+ NQL
Sbjct  504  SEDEEHKKKVESKNALENYAYNMRNTVRDEKIASKLAAADKKKIEDAIEQAIQWLDSNQL  563

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELESICNPIIAKMYQ
Sbjct  564  AEADEFDDKMKELESICNPIIAKMYQ  589



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGGDMGG +D+    A   SG+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGDMGGGVDD---DAPPASGSAAGPKIEEVD  648



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE++CNPIIAKMYQGAG DM G MD+D       +  GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEALCNPIIAKMYQGAGADMEGGMDDD----TPAASGGAGPKIEEVD  647



>gb|ADB85350.1| putative heat shock cognate [Phyllostachys edulis]
Length=674

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  54   APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  113

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN LENYAYNMRNT+KDEKI SKL + DKKKIEDA+E AIQWL+GNQL
Sbjct  114  SEDEEHKKKVEAKNTLENYAYNMRNTIKDEKIASKLPAADKKKIEDAVEGAIQWLDGNQL  173

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIAKMYQ
Sbjct  174  AEADEFEDKMKELESLCNPIIAKMYQ  199



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 162/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG   G +D+D    A  S +G GPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGXGAGPVDDD---DAPPSASGPGPKIEEVD  648



>ref|XP_010423858.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  474  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  533

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  534  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  593

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAK+YQ
Sbjct  594  AETDEFEDKMKELESICNPIIAKIYQ  619



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 162/181 (90%), Gaps = 2/181 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAERYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT++DEKI SKL++D+KK+IEDAIE AIQWL+GNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIRDEKIASKLAADEKKRIEDAIESAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamD--EDaphaaggsgagaGPKIEEV  190
            AE+DEF+DKMKELE ICNPIIAKMYQ  G   G A    ED P   GG G GAGPKIEEV
Sbjct  593  AEADEFDDKMKELEGICNPIIAKMYQAGGAGGGMAGGMDEDGPSVGGGGGGGAGPKIEEV  652

Query  189  D  187
            D
Sbjct  653  D  653



>ref|XP_010452091.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=340

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAED+TTGQK+KITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  161  APRGVPQITVCFDIDANGILNVSAEDETTGQKSKITITNDKGRLSKDEIEKMVQEAEKYK  220

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYN+RNT++DEKIG KL + DKKKIED+I +AIQWLEGNQL
Sbjct  221  SEDEEHKKKVEAKNALENYAYNLRNTIRDEKIGEKLPAADKKKIEDSIGEAIQWLEGNQL  280

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE +CNPIIAKMYQ
Sbjct  281  AEADEFEDKMKELEGVCNPIIAKMYQ  306



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIKDDKIASKLAADDKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELE +CNPIIAKMYQ
Sbjct  593  AEADEFDDKMKELEGLCNPIIAKMYQ  618



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN LENYAYNMRNTVKDEKIG KL + DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNTLENYAYNMRNTVKDEKIGEKLPAADKKKIEDAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE++CNPIIAKMYQGAG DM G MD+D       +  G GPKIEEVD
Sbjct  593  AEADEFEDKMKELEALCNPIIAKMYQGAGADMEGGMDDD----TPAASGGPGPKIEEVD  647



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTV DEKIG+KLS  DKKKI+DAIEQ+IQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIED I+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLDAADKKKIEDTIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQGAGG   G   +D        G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQGAGGPDVGGXMDD--DVPXAGGSGAGPKIEEVD  649



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLPAADKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTV DEKIG+KLS  DKKKI+DAIEQ+IQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 155/179 (87%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG KL   DKKKIEDA+EQ IQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELESICNPIIAKMYQG  G   G   +D        G+GAGPKIEEVD
Sbjct  593  GEADEFEDKMKELESICNPIIAKMYQGGAGPDMGGGMDD---DVPAGGSGAGPKIEEVD  648



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTV DEKIG+KLS  DKKKI+DAIEQ+IQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN+LENYAYNMRNT+KDEKI SKLS  DKK+IEDAIE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE+ICNPIIAKMYQ  GG   G   +D          GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELETICNPIIAKMYQ--GGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNT++DEKIG KL++DDKKKIEDAIE AI+WLEGNQL
Sbjct  533  SEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDAIEAAIEWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELES+CNPIIAKMYQG       A   D       S  GAGPKIEEVD
Sbjct  593  AECDEFEDKMKELESLCNPIIAKMYQGGEAGGPAAAGMD--EDVPPSAGGAGPKIEEVD  649



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HK+KVE KNALENYAYNMRNTVKDEKIGSKL   DKKKIEDAI+ AI WL+ NQL
Sbjct  533  SEDEEHKRKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDGAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAGG   G    D   A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGGADMGGAGMDDDDAPPAGGSGAGPKIEEVD  651



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN+LENYAYNMRNT+KDEKI SKLS  DKK+IEDAIE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE+ICNPIIAKMYQ  GG   G   +D          GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELETICNPIIAKMYQ--GGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLS D+KKKIED++EQAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG  G       ++   +AG S AGAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGGAGPDMAGGMDEDGPSAGASSAGAGPKIEEVD  651



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 160/179 (89%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEK+VQEAEK+K
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE+KNALENYAYNMRNT++DEKI  KL+  DKKKIEDA+EQAIQWL+ NQL
Sbjct  533  AEDEEHKKKVESKNALENYAYNMRNTIRDEKISGKLAPADKKKIEDAVEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AESDEFEDKMKELESICNPIIAKMYQG       AM++D   A    G+GAGPKIEEVD
Sbjct  593  AESDEFEDKMKELESICNPIIAKMYQGGADMGSAAMNDD---APPSGGSGAGPKIEEVD  648



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLS D+KKKIED++EQAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQG  G       ++   +AG S AGAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGRAGPDMAGGMDEDGPSAGASSAGAGPKIEEVD  651



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLS D+KKKIED++EQAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AEO22185.1| CytHSP70 [Triticum aestivum]
Length=540

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  362  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  421

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV++KNALENYAYNMRNT+KD+KI SKL   DKKKIEDAIE AI WL+ NQL
Sbjct  422  AEDEEHKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQL  481

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG +M G MDEDAP +A G  +G GPKIEEVD
Sbjct  482  AEADEFDDKMKELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  540



>gb|AHW48175.1| heat shock protein 70, partial [Triticum aestivum]
Length=539

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  361  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  420

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV++KNALENYAYNMRNT+KD+KI SKL   DKKKIEDAIE AI WL+ NQL
Sbjct  421  AEDEEHKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQL  480

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG +M G MDEDAP +A G  +G GPKIEEVD
Sbjct  481  AEADEFDDKMKELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  539



>ref|XP_002884737.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60996.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  474  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  533

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNT++DEKIG KL++DDKKKIED+IE AI+WLEGNQL
Sbjct  534  SEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLEGNQL  593

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELESICNPIIAKMYQG       A   D       S  GAGPKIEEVD
Sbjct  594  AECDEFEDKMKELESICNPIIAKMYQGGEAGGPAAGGMD--EDVPPSAGGAGPKIEEVD  650



>ref|XP_010495044.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=611

 Score =   276 bits (707),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  433  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  492

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT +DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  493  SEDEEHKKKVEAKNALENYAYNMRNTFQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  552

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAK+YQ
Sbjct  553  AETDEFEDKMKELESICNPIIAKIYQ  578



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNTVKDEKIGSKLS  DKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLSPADKKKIEDAIDQAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDNNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIA+MYQGAG D+ G M +D   +    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIARMYQGAGADVAGGMGDD---SPPAGGSGAGPKIEEVD  648



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +ED++HKKKVE KNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AIQWL+GNQL
Sbjct  533  AEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQG G D G +MDED    + G+G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDED--GPSAGAGSGAGPKIEEVD  649



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIA+MYQGAG DMGGA   D   A      GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIARMYQGAGPDMGGAAGMD-DDAPASGSGGAGPKIEEVD  650



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKIG+KL  +DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPEDKKKIEDAIEQAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESLCNPIIAKMYQ  618



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN LENYAYNMRNTVKDEKIG KL + DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNTLENYAYNMRNTVKDEKIGEKLPAADKKKIEDAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFD+DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDMDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KN+LENYAYNMRNT+KDEKI SKL ++DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNSLENYAYNMRNTIKDEKIASKLPAEDKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELES+CNPIIAKMYQGAGG+ GGAMDED    A GSG+ AGPKIEEVD
Sbjct  593  GEADEFEDKMKELESLCNPIIAKMYQGAGGEAGGAMDED--GPASGSGSTAGPKIEEVD  649



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  472  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  531

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT++DEKI +KL   DKKKIEDAIEQAI WL+GNQL
Sbjct  532  AEDEEHKKKVEAKNALENYAYNMRNTIRDEKIAAKLPQADKKKIEDAIEQAINWLDGNQL  591

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG  M G MDED    A G  +GAGPKIEEVD
Sbjct  592  AEADEFEDKMKELESICNPIIAKMYQGAGAGMAGGMDED--IPAAGGSSGAGPKIEEVD  648



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +ED++HKKKVE KNALENYAYNMRNT+KDEKI +KL + DKKKIEDAIE+AIQWL+GNQL
Sbjct  533  AEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQG G D G +MDED    + G+G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDED--GPSAGAGSGAGPKIEEVD  649



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENY+YNMRNT+KD+KI SKL++ DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYSYNMRNTIKDDKIASKLAAADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 161/179 (90%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE++CNPIIAKMYQG  GD  G MDED    A  SG GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELENVCNPIIAKMYQGGAGDAAGGMDED----AAPSGGGAGPKIEEVD  647



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKL +DDKKKIEDAI+QAI+WL+GNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDADDKKKIEDAIDQAIEWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIA+MYQ
Sbjct  593  AEADEFEDKMKELESLCNPIIARMYQ  618



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 164/179 (92%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIGSKL+  +KKKIEDAI+QAI WL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLNPAEKKKIEDAIDQAIHWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKE+ESICNPIIAK+YQG G DMGG MDED   A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKEVESICNPIIAKIYQGDGADMGGRMDED---APSTGGSGAGPKIEEVD  648



>gb|ADN03965.1| heat shock cognate 70 kDa protein [Phytolacca acinosa]
Length=588

 Score =   275 bits (704),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK
Sbjct  410  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAERYK  469

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN LENYAYNMRNT+KD+KI +KL +D+KKKIEDAI+QAIQWL+GNQL
Sbjct  470  SEDEEHKKKVEAKNGLENYAYNMRNTIKDDKISAKLPADEKKKIEDAIDQAIQWLDGNQL  529

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELES+CNPIIAKMYQG  G        D    + G   GAGPKIEEVD
Sbjct  530  AEVDEFEDKMKELESVCNPIIAKMYQGGAGGGDMGGHMDDDGPSAGGANGAGPKIEEVD  588



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNTVKDEKIGSKL   DKKKIEDAI+QAIQWL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKI SKL   DKKKIEDAIE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIASKLPEADKKKIEDAIEAAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AESDEFEDKMKELES+CNPIIAKMYQ
Sbjct  593  AESDEFEDKMKELESVCNPIIAKMYQ  618



>ref|XP_003578898.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Brachypodium 
distachyon]
Length=648

 Score =   276 bits (707),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQGAG DM G+  ++       +  G GPKIEEVD
Sbjct  593  AEADEFEDKMKELESLCNPIIAKMYQGAGADMEGSGMDE---DTPAASGGPGPKIEEVD  648



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENY+YNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYSYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKIGSKL   DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLDPADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELESICNPIIA+MYQ
Sbjct  593  AEADEFKDKMKELESICNPIIARMYQ  618



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN LENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+QAIQWLE NQL
Sbjct  533  SEDEEHKKKVESKNTLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDQAIQWLESNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELE ICNPIIAKMYQ
Sbjct  593  AEADEFDDKMKELEGICNPIIAKMYQ  618



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKD+KIG KL   DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDDKIGEKLDPTDKKKIEDAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KN+LENYAYNMRNT+KD+KI SKLS  DKK IEDAIEQAIQWL+ NQL
Sbjct  533  SEDEDHKKKVEAKNSLENYAYNMRNTIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE+ICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELETICNPIIAKMYQ  618



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKLS DDKKKIEDAIE AIQWL+ NQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDTNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELESICNPIIAKMYQGAG        ++          GAGPKIEEVD
Sbjct  593  GEADEFEDKMKELESICNPIIAKMYQGAGAPDMAGGMDE--DVPPSGSGGAGPKIEEVD  649



>emb|CDY40362.1| BnaA10g27060D [Brassica napus]
Length=454

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 160/179 (89%), Gaps = 5/179 (3%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK++IEKMVQEAEKYK
Sbjct  281  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYK  340

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIE++IEQAIQWLE NQL
Sbjct  341  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEESIEQAIQWLENNQL  400

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
             E+DEFEDKMKELESICNPIIAKMYQGAGG+  G  D+     A  +  GAGPKIEEVD
Sbjct  401  GEADEFEDKMKELESICNPIIAKMYQGAGGEAAGMDDD-----APPASGGAGPKIEEVD  454



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNT++DEKIG KL++DDKKKIED+IE AI+WL+ NQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AECDEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_006392363.1| hypothetical protein EUTSA_v10023343mg [Eutrema salsugineum]
 gb|ESQ29649.1| hypothetical protein EUTSA_v10023343mg [Eutrema salsugineum]
Length=633

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQIT+CFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  455  APRGVPQITICFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  514

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IE+ IQWL+GNQL
Sbjct  515  SEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGEKLPAADKKKIEDSIEEVIQWLDGNQL  574

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQGAGG+ GG         A  S  GAGPKIEEVD
Sbjct  575  AEADEFEDKMKELESVCNPIIAKMYQGAGGEPGGPAAGMDDDEAPPSSGGAGPKIEEVD  633



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAIE AIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDEKISSKLPAADKKKIEDAIEGAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENYAYNMRNT+KDEKIG+KL   DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  AEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLDPADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE ICNPIIA+MYQ
Sbjct  593  AEADEFEDKMKELEGICNPIIARMYQ  618



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN+LENYAYNMRNT+KDEKI SKLS  DKK+IEDAIE A QWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAFQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE+ICNPIIAKMYQ  GG   G   +D          GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELETICNPIIAKMYQ--GGAGEGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDEDHKKKVE KNALENYAYNMRNT++DEKIG KL++DDKKKIED+IE AI+WL+ NQL
Sbjct  533  SEDEDHKKKVEAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AECDEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010423825.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37c [Camelina sativa]
Length=658

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  474  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  533

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  534  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  593

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE +CNPIIAK+YQ
Sbjct  594  AETDEFEDKMKELEGVCNPIIAKIYQ  619



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQ+AEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQDAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIEDAIEQAIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE  CNPIIAKMYQGAG  M G M +D   +  G  +GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGTCNPIIAKMYQGAGAGMAGGMGDD---SPSGGDSGAGPKIEEVD  648



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 160/179 (89%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  461  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  520

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQL
Sbjct  521  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQL  580

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG D  G +D++    A    +G GPKIEEVD
Sbjct  581  AEADEFEDKMKELESICNPIIAKMYQGAGADGAGPVDDE----APAGASGPGPKIEEVD  635



>ref|XP_010464591.1| PREDICTED: heat shock 70 kDa protein 3 [Camelina sativa]
Length=649

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNT++DEKIG KL++DDKKKIED+IE AI+WLEGNQL
Sbjct  533  SEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELES+CNPIIAKMYQG       A   D       +  GAGPKIEEVD
Sbjct  593  AECDEFEDKMKELESLCNPIIAKMYQGGEAGGPAAGGMD--EDVPPAAGGAGPKIEEVD  649



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKI SKL   DKKKIE+AIE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIASKLPEADKKKIEEAIESAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AESDEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AESDEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNT+KDEKI +KLS  DKKKIEDAI+QAIQWL+ NQL
Sbjct  533  SEDEEHKKKVDAKNALENYAYNMRNTIKDEKISAKLSEGDKKKIEDAIDQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD++IGSKLS+ DKK+IED IE+A+QWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDQIGSKLSAADKKRIEDTIEEAMQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WLEGNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIA+MYQ
Sbjct  593  AEADEFEDKMKELESLCNPIIARMYQ  618



>tpg|DAA55190.1| TPA: heat shock protein70-4 [Zea mays]
Length=521

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  345  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  404

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KN+LENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AI WL+ NQL
Sbjct  405  SEDEEHKKKVEAKNSLENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAISWLDANQL  464

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQGAG DMGGA   D    A     G GPKIEEVD
Sbjct  465  AEADEFEDKMKELESLCNPIIAKMYQGAGEDMGGAGGMD--EDAPAGSGGPGPKIEEVD  521



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI  KL S DKKKIED+IEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIAGKLDSADKKKIEDSIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQG  G   G    D    A   G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESVCNPIIAKMYQGGAGPDMGGAAAD-EEYAPSGGSGAGPKIEEVD  650



>gb|EMS50129.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=736

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  561  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  620

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KD+KI SKL++DDKKKIEDAI+QAIQWL+GNQL
Sbjct  621  SEDEEHKKKVESKNALENYAYNMRNTIKDDKIASKLAADDKKKIEDAIDQAIQWLDGNQL  680

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE +CNPIIAKMYQGAG DM GAMDED    A G       KIEEVD
Sbjct  681  AEADEFDDKMKELEGLCNPIIAKMYQGAGADMAGAMDEDDAPPAAGGAGP---KIEEVD  736



>emb|CDY52661.1| BnaC01g38510D [Brassica napus]
Length=647

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WLEGNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIA+MYQ
Sbjct  593  AEADEFEDKMKELESLCNPIIARMYQ  618



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIE+AI+ AIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE++CNPIIAKMYQGAG DM G MD+D       +  G GPKIEEVD
Sbjct  593  AEADEFEDKMKELEALCNPIIAKMYQGAGADMEGGMDDD----TPAASGGPGPKIEEVD  647



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WLEGNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIA+MYQ
Sbjct  593  AEADEFEDKMKELESLCNPIIARMYQ  618



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  540  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  599

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKD+KIG KL   DKKKIEDAIEQAIQWL+ NQL
Sbjct  600  SEDEEHKKKVEAKNALENYAYNMRNTVKDDKIGEKLDPTDKKKIEDAIEQAIQWLDSNQL  659

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  660  AEADEFEDKMKELESICNPIIAKMYQ  685



>gb|EEC76425.1| hypothetical protein OsI_14101 [Oryza sativa Indica Group]
Length=434

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  259  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  318

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KN+LENYAYNMRNT++DEKI SKL +DDKKKIEDA+EQAIQWL+ NQL
Sbjct  319  SEDEEHKKKVDAKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDNNQL  378

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE +EFEDKMKELE +CNPIIAKMYQ
Sbjct  379  AEVEEFEDKMKELEGLCNPIIAKMYQ  404



>ref|XP_010486515.1| PREDICTED: heat shock 70 kDa protein 3-like [Camelina sativa]
Length=649

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIE+MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNT++DEKIG KL++DDKKKIED+IE AI+WLEGNQL
Sbjct  533  SEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEAAIEWLEGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELES+CNPIIAKMYQG           D          GAGPKIEEVD
Sbjct  593  AECDEFEDKMKELESLCNPIIAKMYQGGEAGGPAPGGMD--EDVPPPAGGAGPKIEEVD  649



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI  KL SDDKKKIED IE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIAGKLDSDDKKKIEDTIEAAIQWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE +CNPIIAKMYQG  G   GA   D    A     GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGVCNPIIAKMYQGGAGPDMGAAPGD--DDAPSHAGGAGPKIEEVD  649



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 159/179 (89%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKI SKLSS+DK KI++AIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEGKNALENYAYNMRNTIKDEKISSKLSSEDKTKIDNAIEQAIQWLDTNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQG  G  G   D+    A    G+GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQGGAGTGGDVDDD----APPAGGSGAGPKIEEVD  647



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 160/179 (89%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKIG+KL   DKKKIED+IE AIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPIIAKMYQGAG D  G +D++    A    +G GPKIEEVD
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQGAGADGAGPVDDE----APAGASGPGPKIEEVD  647



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 161/179 (90%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVC+DIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCYDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKIG KL+  DKKKIEDAI++AI WL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE++CNPIIAKMYQG  GD  G MDED    A  SG GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELENVCNPIIAKMYQGGAGDAAGGMDED----AAPSGGGAGPKIEEVD  647



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 158/179 (88%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMV+EAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKIGSKLS +DKKKI+DAI+ AIQWL+ NQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIGSKLSPEDKKKIDDAIDAAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQG G    G   +D       +  GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESLCNPIIAKMYQGGGAPDMGGGMDD---EVPPAAGGAGPKIEEVD  648



>ref|XP_004156719.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=547

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  368  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  427

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            ++DE+HKKKVE KN+LENYAYNMRNTV+DEK  SKL   DKKKIEDAIEQA+QWL+ NQL
Sbjct  428  ADDEEHKKKVEAKNSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQL  487

Query  363  AESDEFEDKMKELESICNPIIAKMYQ-gaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELESICNPI+AKMYQ   G  MGG   +D        G+GAGPKIEEVD
Sbjct  488  AEADEFEDKMKELESICNPIVAKMYQGAGGPGMGGGAMDDDDAPPPSGGSGAGPKIEEVD  547



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 161/179 (90%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APR VPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  475  APRVVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  534

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+ KKKVE KN+LENYAYNMRNTVKDEKIGSKLSSDDKKKIEDA++QAI WLE NQL
Sbjct  535  AEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQL  594

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELE ICNPIIAKMYQGAGGD G  MD+D   A    G+ AGPKIEEVD
Sbjct  595  AEVDEFEDKMKELEGICNPIIAKMYQGAGGDAGVPMDDD---APPSGGSSAGPKIEEVD  650



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 158/179 (88%), Gaps = 3/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFD+DANGILNVSAEDKTT QKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDMDANGILNVSAEDKTTSQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
             EDE+HKKKVE KNALENYAYNMRNT++DEKI SKL + DKKKIEDA+EQAIQWL+GNQL
Sbjct  533  GEDEEHKKKVEAKNALENYAYNMRNTIRDEKIASKLPAADKKKIEDAVEQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE ICNPIIAKMYQGAG D  G MDED        G+ AGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQGAGADAAGGMDED---GPSAGGSDAGPKIEEVD  648



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIE MVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNTVKDEKI +KL   DKKKIEDA+EQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTVKDEKISAKLPPADKKKIEDAVEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESICNPIIAKMYQ  618



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLEAADKKKIEDAIDQAIEWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIA+MYQ
Sbjct  593  AEADEFEDKMKELESVCNPIIARMYQ  618



>ref|XP_010911697.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Elaeis guineensis]
Length=238

 Score =   262 bits (670),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNV AED+TTGQKNKIT+ NDKGRLSKEEIEKMVQ+AEKY+
Sbjct  63   APRGVPQINVCFDIDANGILNVLAEDETTGQKNKITMINDKGRLSKEEIEKMVQDAEKYE  122

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKL + DKKKIED IEQAIQWL+GNQL
Sbjct  123  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKIASKLPASDKKKIEDPIEQAIQWLDGNQL  182

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIA MYQ
Sbjct  183  AEADEFEDKMKELESICNPIIAGMYQ  208



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   276 bits (707),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  566  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  625

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNT+KDEKI +KLS  DKKKIEDAI+QAIQWL+ NQL
Sbjct  626  SEDEEHKKKVDAKNALENYAYNMRNTIKDEKISAKLSEGDKKKIEDAIDQAIQWLDSNQL  685

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELESICNPIIAKMYQ
Sbjct  686  AEADEFEDKMKELESICNPIIAKMYQ  711



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKIGSKLS +DKKKI+DAIE +IQWL+ NQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIGSKLSPEDKKKIDDAIEASIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE +CNPIIAKMYQG G         D         +GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELEGLCNPIIAKMYQGGGAPDMAGGMND--DVPPSGSSGAGPKIEEVD  649



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKL + DKKKIEDAI+QAI+WL+GNQL
Sbjct  533  AEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLEAADKKKIEDAIDQAIEWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIA+MYQ
Sbjct  593  AEADEFEDKMKELESVCNPIIARMYQ  618



>ref|XP_007139236.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
 gb|ESW11230.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
Length=647

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KD+KI SKLSS+DK KI++AIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDDKISSKLSSEDKTKIDNAIEQAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE ICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELEGICNPIIAKMYQ  618



>ref|XP_010490742.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=654

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  474  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  533

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKKIED+IEQAIQWLEGNQL
Sbjct  534  SEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQL  593

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DE+EDKMKELE +CNPIIAK+YQ
Sbjct  594  AEADEYEDKMKELEGVCNPIIAKIYQ  619



>ref|NP_187555.1| heat shock protein 70-3 [Arabidopsis thaliana]
 ref|NP_001189847.1| heat shock protein 70-3 [Arabidopsis thaliana]
 sp|O65719.1|HSP7C_ARATH RecName: Full=Heat shock 70 kDa protein 3; AltName: Full=Heat 
shock cognate 70 kDa protein 3; AltName: Full=Heat shock cognate 
protein 70-3; Short=AtHsc70-3; AltName: Full=Heat shock 
protein 70-3; Short=AtHsp70-3 [Arabidopsis thaliana]
 gb|AAF14038.1|AC011436_22 heat-shock protein (At-hsc70-3) [Arabidopsis thaliana]
 gb|AAF23276.1|AC016661_1 heat shock cognate 70kD protein [Arabidopsis thaliana]
 emb|CAA76606.1| At-hsc70-3 [Arabidopsis thaliana]
 gb|AAK92833.1| putative heat-shock protein At-hsc70-3 [Arabidopsis thaliana]
 gb|AAM20310.1| putative heat-shock protein [Arabidopsis thaliana]
 gb|AAM26685.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AAN46823.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AEE74767.1| heat shock protein 70-3 [Arabidopsis thaliana]
 gb|AEE74768.1| heat shock protein 70-3 [Arabidopsis thaliana]
Length=649

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNT++DEKIG KL+ DDKKKIED+IE AI+WLE NQL
Sbjct  533  SEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE DEFEDKMKELESICNPIIAKMYQG       A   D       S  GAGPKIEEVD
Sbjct  593  AECDEFEDKMKELESICNPIIAKMYQGGEAGGPAAGGMD--EDVPPSAGGAGPKIEEVD  649



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQI VCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNTVKDEKIG+KLS  DKKKIE+AI+ +IQWL+GNQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTVKDEKIGAKLSEADKKKIEEAIDASIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFDDKMKELESICNPIIAKMYQ  618



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT+KDEKIGSKLS DDKKKIEDAI+ AI WL+ NQ 
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDAAINWLDANQS  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNP+IAKMYQ
Sbjct  593  AEADEFEDKMKELESLCNPVIAKMYQ  618



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKK+VE KNALENYAYNMRNT+KD+KI +KL + DKKKIEDAIEQAIQWL+ NQL
Sbjct  533  SEDEEHKKRVEAKNALENYAYNMRNTIKDDKIAAKLDAADKKKIEDAIEQAIQWLDNNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELE+ICNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELETICNPIIAKMYQ  618



>ref|XP_002873055.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49314.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=653

 Score =   275 bits (702),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTG+KNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGKKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE KNALENYAYNMRNT++DEKIG KL + DKKK+ED+IE+AIQWL+GNQL
Sbjct  533  SEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEFEDKMKELES+CNPIIAKMYQ
Sbjct  593  AEADEFEDKMKELESVCNPIIAKMYQ  618



>dbj|BAJ86014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKE+IEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKV++KNALENYAYNMRNT+KD+KI SKL   DKKKIEDAIE AI WL+ NQL
Sbjct  533  AEDEEHKKKVDSKNALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELE ICNPIIAKMYQGAG +M G MDEDAP +A G  +G GPKIEEVD
Sbjct  593  AEADEFDDKMKELEGICNPIIAKMYQGAGAEMPGGMDEDAPASAAGGSSGPGPKIEEVD  651



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   274 bits (701),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENYAYNMRNT+KD+KI SKL++ DKKKIEDAI++AIQWL+ NQL
Sbjct  533  SEDEEHKKKVESKNALENYAYNMRNTIKDDKIASKLAAADKKKIEDAIDEAIQWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELESICNPIIAKMYQ
Sbjct  593  AEADEFDDKMKELESICNPIIAKMYQ  618



>gb|EMS45385.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=762

 Score =   276 bits (707),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 4/179 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  588  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  647

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KNALENY+YNMRNT+KDEKI SKL +DDKKKIEDAI+ AIQWL+ NQL
Sbjct  648  SEDEEHKKKVESKNALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQL  707

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELE++CNPIIAKMYQGAG DM G MD+D       +  G GPKIEEVD
Sbjct  708  AEADEFEDKMKELEALCNPIIAKMYQGAGADMEGGMDDD----TPAASGGPGPKIEEVD  762



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   274 bits (701),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAERYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            +EDE+HKKKVE KNALENY+YNMRNT+KD+KI SKLS++DKKKIEDAI+QAI WL+ NQL
Sbjct  533  AEDEEHKKKVEAKNALENYSYNMRNTIKDDKISSKLSAEDKKKIEDAIDQAISWLDSNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEFEDKMKELES+CNPIIAKMYQGAGG+ G  MD+D   A      GAGPKIEEVD
Sbjct  593  AEADEFEDKMKELESLCNPIIAKMYQGAGGEAGAPMDDD--DAPPAGSTGAGPKIEEVD  649



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   274 bits (701),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNT+KDEKI SKL + DKKKIEDA+E AIQWL+GNQL
Sbjct  533  SEDEEHKKKVESKNSLENYAYNMRNTIKDEKIASKLPAADKKKIEDAVEAAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ  286
            AE+DEF+DKMKELES+CNPIIAKMYQ
Sbjct  593  AEADEFDDKMKELESLCNPIIAKMYQ  618



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   274 bits (701),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 2/179 (1%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKVE+KN+LENYAYNMRNT+KDEKI SKL++DDKKKIEDAI+ AI WL+ NQL
Sbjct  533  SEDEEHKKKVESKNSLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDAAISWLDANQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQgaggdmggamDEDaphaaggsgagaGPKIEEVD  187
            AE+DEF+DKMKELES+CNPIIAKMYQGAG DMGG+   D    A     G GPKIEEVD
Sbjct  593  AEADEFDDKMKELESLCNPIIAKMYQGAGADMGGSGGMD--EDAPAGSGGPGPKIEEVD  649



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   274 bits (701),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 153/182 (84%), Gaps = 3/182 (2%)
 Frame = -2

Query  723  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  544
            APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
Sbjct  473  APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK  532

Query  543  SEDEDHKKKVETKNALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQL  364
            SEDE+HKKKV+ KNALENYAYNMRNT+KDEKI SKLS  DKKKIEDAI+QAIQWL+GNQL
Sbjct  533  SEDEEHKKKVDAKNALENYAYNMRNTIKDEKISSKLSDADKKKIEDAIDQAIQWLDGNQL  592

Query  363  AESDEFEDKMKELESICNPIIAKMYQ---gaggdmggamDEDaphaaggsgagaGPKIEE  193
            AE+DEF DKMKELESICNP+IAK YQ      G        D        G+ AGPKIEE
Sbjct  593  AEADEFGDKMKELESICNPVIAKTYQGAGAGAGGPDVGGGSDDDVPPPSGGSSAGPKIEE  652

Query  192  VD  187
            VD
Sbjct  653  VD  654



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440