BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001O17

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004244888.1|  PREDICTED: uncharacterized protein LOC101262938    222   7e-67   Solanum lycopersicum
ref|XP_006366515.1|  PREDICTED: uncharacterized protein LOC102585370    221   2e-66   Solanum tuberosum [potatoes]
ref|XP_009776174.1|  PREDICTED: uncharacterized protein LOC104225989    221   5e-66   Nicotiana sylvestris
ref|XP_009619129.1|  PREDICTED: uncharacterized protein LOC104111192    217   2e-64   Nicotiana tomentosiformis
ref|XP_002285361.1|  PREDICTED: uncharacterized protein LOC100262872    194   8e-56   Vitis vinifera
emb|CAN69699.1|  hypothetical protein VITISV_001515                     192   4e-55   Vitis vinifera
ref|XP_007011756.1|  Uncharacterized protein TCM_036932                 183   2e-51   
ref|XP_010665861.1|  PREDICTED: uncharacterized protein LOC104883105    180   3e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP33539.1|  hypothetical protein JCGZ_07110                         175   2e-48   Jatropha curcas
gb|KJB07669.1|  hypothetical protein B456_001G036600                    171   6e-47   Gossypium raimondii
emb|CBI21089.3|  unnamed protein product                                168   1e-46   Vitis vinifera
gb|KJB55057.1|  hypothetical protein B456_009G060700                    170   2e-46   Gossypium raimondii
ref|XP_006450316.1|  hypothetical protein CICLE_v10008624mg             169   3e-46   Citrus clementina [clementine]
ref|XP_004501367.1|  PREDICTED: uncharacterized protein LOC101507611    166   4e-45   Cicer arietinum [garbanzo]
ref|XP_010245551.1|  PREDICTED: uncharacterized protein LOC104589062    163   4e-44   Nelumbo nucifera [Indian lotus]
ref|XP_008220875.1|  PREDICTED: uncharacterized protein LOC103320911    161   1e-43   
ref|XP_003603315.1|  hypothetical protein MTR_3g106250                  160   3e-43   Medicago truncatula
ref|XP_010033684.1|  PREDICTED: uncharacterized protein LOC104422917    161   3e-43   Eucalyptus grandis [rose gum]
ref|XP_002515453.1|  conserved hypothetical protein                     160   4e-43   
ref|XP_010048907.1|  PREDICTED: uncharacterized protein LOC104437620    161   4e-43   Eucalyptus grandis [rose gum]
ref|XP_009363946.1|  PREDICTED: uncharacterized protein LOC103953867    159   1e-42   Pyrus x bretschneideri [bai li]
gb|KJB65893.1|  hypothetical protein B456_010G117700                    159   2e-42   Gossypium raimondii
ref|XP_008378697.1|  PREDICTED: uncharacterized protein LOC103441769    158   3e-42   Malus domestica [apple tree]
ref|XP_006382097.1|  hypothetical protein POPTR_0006s27720g             154   6e-42   
ref|XP_011039597.1|  PREDICTED: uncharacterized protein LOC105136101    155   1e-40   Populus euphratica
ref|XP_011036648.1|  PREDICTED: uncharacterized protein LOC105134078    154   2e-40   Populus euphratica
ref|XP_008377675.1|  PREDICTED: uncharacterized protein LOC103440754    153   2e-40   
ref|XP_007224916.1|  hypothetical protein PRUPE_ppa021934mg             154   4e-40   
ref|XP_004138846.1|  PREDICTED: uncharacterized protein LOC101205493    151   4e-40   
ref|XP_004160786.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    151   4e-40   
ref|XP_004291941.1|  PREDICTED: uncharacterized protein LOC101293553    152   5e-40   Fragaria vesca subsp. vesca
gb|KGN62983.1|  hypothetical protein Csa_2G382560                       151   8e-40   Cucumis sativus [cucumbers]
ref|XP_002324318.2|  hypothetical protein POPTR_0018s02290g             152   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_008445586.1|  PREDICTED: uncharacterized protein LOC103488566    150   1e-39   Cucumis melo [Oriental melon]
ref|XP_007136970.1|  hypothetical protein PHAVU_009G089200g             148   7e-39   Phaseolus vulgaris [French bean]
emb|CDX97072.1|  BnaC09g45530D                                          143   2e-36   
emb|CDX69793.1|  BnaA10g21420D                                          140   2e-35   
ref|XP_009122005.1|  PREDICTED: uncharacterized protein LOC103846761    141   2e-35   Brassica rapa
ref|XP_006399599.1|  hypothetical protein EUTSA_v10015286mg             140   3e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010541582.1|  PREDICTED: uncharacterized protein LOC104815002    140   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_003527779.1|  PREDICTED: uncharacterized protein LOC100783731    139   3e-35   Glycine max [soybeans]
ref|XP_010519647.1|  PREDICTED: uncharacterized protein LOC104799041    139   5e-35   Tarenaya hassleriana [spider flower]
ref|XP_006289029.1|  hypothetical protein CARUB_v10002414mg             137   5e-34   Capsella rubella
ref|XP_010265675.1|  PREDICTED: uncharacterized protein LOC104603360    136   6e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010050838.1|  PREDICTED: uncharacterized protein LOC104439472    135   8e-34   
ref|XP_010453134.1|  PREDICTED: uncharacterized protein LOC104735112    135   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002873490.1|  hypothetical protein ARALYDRAFT_909057             134   6e-33   Arabidopsis lyrata subsp. lyrata
ref|NP_196661.1|  uncharacterized protein                               133   9e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419653.1|  PREDICTED: uncharacterized protein LOC104705366    133   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010050717.1|  PREDICTED: uncharacterized protein LOC104439337    132   1e-32   
ref|XP_010491790.1|  PREDICTED: uncharacterized protein LOC104769314    132   2e-32   Camelina sativa [gold-of-pleasure]
emb|CDX85733.1|  BnaA02g00800D                                          131   3e-32   
emb|CDY51100.1|  BnaCnng20030D                                          129   1e-31   Brassica napus [oilseed rape]
ref|XP_009125261.1|  PREDICTED: uncharacterized protein LOC103850289    128   3e-31   Brassica rapa
gb|KFK25379.1|  hypothetical protein AALP_AA8G105700                    128   8e-31   Arabis alpina [alpine rockcress]
ref|XP_004145513.1|  PREDICTED: uncharacterized protein LOC101215936    125   9e-31   
emb|CDP18790.1|  unnamed protein product                                127   2e-30   Coffea canephora [robusta coffee]
ref|XP_008452874.1|  PREDICTED: uncharacterized protein LOC103493769    126   2e-30   Cucumis melo [Oriental melon]
gb|KGN55450.1|  hypothetical protein Csa_4G652140                       125   6e-30   Cucumis sativus [cucumbers]
gb|KCW80312.1|  hypothetical protein EUGRSUZ_C01671                     121   8e-30   Eucalyptus grandis [rose gum]
ref|XP_007161151.1|  hypothetical protein PHAVU_001G046800g             121   1e-28   Phaseolus vulgaris [French bean]
ref|XP_003549308.1|  PREDICTED: putative uncharacterized protein ...    119   9e-28   Glycine max [soybeans]
emb|CBI26241.3|  unnamed protein product                                114   2e-26   Vitis vinifera
ref|XP_009407751.1|  PREDICTED: uncharacterized protein LOC103990370    114   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010417285.1|  PREDICTED: uncharacterized protein LOC104703050    114   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010649892.1|  PREDICTED: uncharacterized protein LOC100246068    114   4e-26   Vitis vinifera
gb|KEH39864.1|  DUF868 family protein                                   114   4e-26   Medicago truncatula
emb|CAN68226.1|  hypothetical protein VITISV_040533                     113   4e-26   Vitis vinifera
ref|XP_009402136.1|  PREDICTED: uncharacterized protein LOC103986002    113   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910592.1|  PREDICTED: uncharacterized protein LOC105036529    111   2e-25   Elaeis guineensis
ref|XP_006288375.1|  hypothetical protein CARUB_v10001626mg             111   3e-25   Capsella rubella
ref|XP_008802684.1|  PREDICTED: uncharacterized protein LOC103716457    111   3e-25   Phoenix dactylifera
ref|XP_006395009.1|  hypothetical protein EUTSA_v10004720mg             110   7e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006838233.1|  hypothetical protein AMTR_s00103p00021650          110   1e-24   Amborella trichopoda
ref|XP_002872306.1|  hypothetical protein ARALYDRAFT_489643             109   1e-24   
ref|XP_010277409.1|  PREDICTED: uncharacterized protein LOC104611862    109   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008804337.1|  PREDICTED: uncharacterized protein LOC103717650    109   1e-24   Phoenix dactylifera
ref|XP_010256015.1|  PREDICTED: uncharacterized protein LOC104596517    109   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010923391.1|  PREDICTED: uncharacterized protein LOC105046501    109   1e-24   Elaeis guineensis
emb|CDP03641.1|  unnamed protein product                                108   2e-24   Coffea canephora [robusta coffee]
ref|XP_009601952.1|  PREDICTED: uncharacterized protein LOC104097132    109   2e-24   Nicotiana tomentosiformis
ref|NP_198167.1|  uncharacterized protein                               109   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455167.1|  PREDICTED: uncharacterized protein LOC104736806    109   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010421680.1|  PREDICTED: uncharacterized protein LOC104707100    108   2e-24   Camelina sativa [gold-of-pleasure]
emb|CDO99050.1|  unnamed protein product                                108   3e-24   Coffea canephora [robusta coffee]
ref|XP_006294490.1|  hypothetical protein CARUB_v10023518mg             108   4e-24   Capsella rubella
ref|XP_006405118.1|  hypothetical protein EUTSA_v10000227mg             108   4e-24   Eutrema salsugineum [saltwater cress]
ref|XP_009408456.1|  PREDICTED: uncharacterized protein LOC103990890    108   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS52757.1|  hypothetical protein TRIUR3_04572                       107   5e-24   Triticum urartu
ref|XP_006433029.1|  hypothetical protein CICLE_v10001999mg             107   5e-24   Citrus clementina [clementine]
ref|XP_010674843.1|  PREDICTED: uncharacterized protein LOC104890923    107   6e-24   
ref|XP_010494083.1|  PREDICTED: uncharacterized protein LOC104771271    107   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010929447.1|  PREDICTED: uncharacterized protein LOC105050916    107   7e-24   Elaeis guineensis
gb|ACN25495.1|  unknown                                                 106   7e-24   Zea mays [maize]
gb|ADG39148.1|  AT5G28150-like protein                                  104   7e-24   Capsella grandiflora
gb|EMT25403.1|  hypothetical protein F775_31443                         107   7e-24   
dbj|BAJ95878.1|  predicted protein                                      107   8e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEN83173.1|  AT5G28150-like protein                                  104   9e-24   Capsella rubella
ref|XP_004981359.1|  PREDICTED: uncharacterized protein LOC101774579    107   9e-24   Setaria italica
ref|XP_002880661.1|  hypothetical protein ARALYDRAFT_481378             107   9e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_004247361.1|  PREDICTED: uncharacterized protein LOC101254730    107   1e-23   Solanum lycopersicum
ref|XP_009151242.1|  PREDICTED: uncharacterized protein LOC103874571    107   1e-23   Brassica rapa
ref|XP_009792059.1|  PREDICTED: uncharacterized protein LOC104239187    107   1e-23   Nicotiana sylvestris
ref|NP_001167908.1|  hypothetical protein                               106   1e-23   Zea mays [maize]
gb|ADG39149.1|  AT5G28150-like protein                                  103   2e-23   Capsella grandiflora
gb|ADG39151.1|  AT5G28150-like protein                                  103   2e-23   Capsella grandiflora
ref|NP_850061.1|  uncharacterized protein                               107   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521743.1|  PREDICTED: uncharacterized protein LOC100791607    106   2e-23   
ref|XP_010429511.1|  PREDICTED: uncharacterized protein LOC104713...    107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010546610.1|  PREDICTED: uncharacterized protein LOC104818644    106   2e-23   Tarenaya hassleriana [spider flower]
gb|ACU18448.1|  unknown                                                 106   2e-23   Glycine max [soybeans]
ref|XP_011071576.1|  PREDICTED: uncharacterized protein LOC105156990    106   2e-23   Sesamum indicum [beniseed]
ref|XP_010429513.1|  PREDICTED: uncharacterized protein LOC104713...    106   2e-23   Camelina sativa [gold-of-pleasure]
emb|CDY52485.1|  BnaC07g49460D                                          105   2e-23   Brassica napus [oilseed rape]
gb|ADG39153.1|  AT5G28150-like protein                                  103   2e-23   Neslia paniculata [ball mustard]
ref|XP_006360806.1|  PREDICTED: uncharacterized protein LOC102583145    106   2e-23   Solanum tuberosum [potatoes]
emb|CDP21506.1|  unnamed protein product                                106   3e-23   Coffea canephora [robusta coffee]
ref|XP_010090415.1|  hypothetical protein L484_025081                   106   3e-23   Morus notabilis
ref|XP_009111920.1|  PREDICTED: uncharacterized protein LOC103837313    105   3e-23   Brassica rapa
ref|XP_002977922.1|  hypothetical protein SELMODRAFT_107811             105   3e-23   
gb|ADG39150.1|  AT5G28150-like protein                                  102   3e-23   Capsella grandiflora
emb|CDY00013.1|  BnaC09g02880D                                          105   3e-23   
ref|XP_010552768.1|  PREDICTED: uncharacterized protein LOC104823045    105   4e-23   Tarenaya hassleriana [spider flower]
ref|XP_010041438.1|  PREDICTED: uncharacterized protein LOC104430401    105   4e-23   Eucalyptus grandis [rose gum]
ref|XP_003564146.1|  PREDICTED: uncharacterized protein LOC100837549    105   6e-23   Brachypodium distachyon [annual false brome]
ref|XP_004302026.1|  PREDICTED: uncharacterized protein LOC101296394    105   6e-23   Fragaria vesca subsp. vesca
ref|XP_004230118.1|  PREDICTED: uncharacterized protein LOC101268432    105   6e-23   Solanum lycopersicum
gb|KJB45005.1|  hypothetical protein B456_007G284600                    104   7e-23   Gossypium raimondii
ref|XP_002466252.1|  hypothetical protein SORBIDRAFT_01g004400          104   7e-23   Sorghum bicolor [broomcorn]
ref|XP_001772274.1|  predicted protein                                  104   8e-23   
emb|CDY59819.1|  BnaA09g51660D                                          105   8e-23   Brassica napus [oilseed rape]
ref|XP_007147151.1|  hypothetical protein PHAVU_006G100000g             104   8e-23   Phaseolus vulgaris [French bean]
ref|XP_006444048.1|  hypothetical protein CICLE_v10021341mg             104   9e-23   
gb|ACU20214.1|  unknown                                                 104   1e-22   Glycine max [soybeans]
ref|XP_003536564.1|  PREDICTED: uncharacterized protein LOC100796685    103   1e-22   
ref|XP_002986948.1|  hypothetical protein SELMODRAFT_158336             103   1e-22   
ref|XP_006347793.1|  PREDICTED: uncharacterized protein LOC102597851    103   1e-22   Solanum tuberosum [potatoes]
ref|XP_010089947.1|  hypothetical protein L484_014458                   104   2e-22   
gb|ABR17303.1|  unknown                                                 103   2e-22   Picea sitchensis
gb|KDP23639.1|  hypothetical protein JCGZ_23472                         103   2e-22   Jatropha curcas
gb|ADG39147.1|  AT5G28150-like protein                                  100   2e-22   Capsella grandiflora
ref|XP_008783101.1|  PREDICTED: uncharacterized protein LOC103702440    102   2e-22   Phoenix dactylifera
ref|XP_002307590.1|  hypothetical protein POPTR_0005s23240g             103   3e-22   
gb|AFW67285.1|  hypothetical protein ZEAMMB73_929047                    103   3e-22   
ref|XP_002512236.1|  conserved hypothetical protein                     103   3e-22   
emb|CBI34200.3|  unnamed protein product                                102   4e-22   Vitis vinifera
ref|XP_011032437.1|  PREDICTED: uncharacterized protein LOC105131255    102   4e-22   Populus euphratica
ref|XP_007144641.1|  hypothetical protein PHAVU_007G172700g             102   4e-22   Phaseolus vulgaris [French bean]
gb|KHN03804.1|  hypothetical protein glysoja_011033                     102   5e-22   Glycine soja [wild soybean]
gb|EEE60141.1|  hypothetical protein OsJ_13031                          102   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051637.1|  Os03g0806700                                       102   6e-22   
ref|XP_008455804.1|  PREDICTED: uncharacterized protein LOC103495897    102   6e-22   Cucumis melo [Oriental melon]
ref|XP_009364535.1|  PREDICTED: uncharacterized protein LOC103954432    102   7e-22   Pyrus x bretschneideri [bai li]
ref|XP_007207341.1|  hypothetical protein PRUPE_ppa009272mg             102   8e-22   Prunus persica
ref|XP_008808239.1|  PREDICTED: uncharacterized protein LOC103720353    102   8e-22   Phoenix dactylifera
gb|KHN43207.1|  hypothetical protein glysoja_001790                     100   8e-22   Glycine soja [wild soybean]
ref|XP_008218232.1|  PREDICTED: uncharacterized protein LOC103318613    101   8e-22   
ref|XP_008345708.1|  PREDICTED: uncharacterized protein LOC103408652    101   9e-22   
ref|XP_008388659.1|  PREDICTED: uncharacterized protein LOC103451015    101   9e-22   
ref|XP_002277386.1|  PREDICTED: uncharacterized protein LOC100267457    101   9e-22   
ref|XP_009117076.1|  PREDICTED: uncharacterized protein LOC103842203    102   1e-21   Brassica rapa
gb|KGN60826.1|  hypothetical protein Csa_2G011590                       101   1e-21   Cucumis sativus [cucumbers]
ref|XP_006382769.1|  hypothetical protein POPTR_0005s05250g             101   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_007050578.1|  Uncharacterized protein isoform 2                  100   1e-21   
ref|XP_004139223.1|  PREDICTED: uncharacterized protein LOC101220430    101   1e-21   Cucumis sativus [cucumbers]
ref|XP_006650760.1|  PREDICTED: uncharacterized protein LOC102720690    100   1e-21   Oryza brachyantha
gb|KDP21447.1|  hypothetical protein JCGZ_21918                         101   1e-21   Jatropha curcas
ref|XP_003554710.1|  PREDICTED: uncharacterized protein LOC100806479    100   1e-21   Glycine max [soybeans]
ref|XP_007050577.1|  Uncharacterized protein isoform 1                  101   1e-21   
ref|XP_009805050.1|  PREDICTED: uncharacterized protein LOC104250176    100   1e-21   Nicotiana sylvestris
ref|XP_007030623.1|  Uncharacterized protein TCM_026394                 100   1e-21   
ref|XP_001770719.1|  predicted protein                                  100   1e-21   
gb|AFK42653.1|  unknown                                                 100   2e-21   Medicago truncatula
gb|ACU19762.1|  unknown                                                 100   2e-21   Glycine max [soybeans]
ref|XP_010090262.1|  hypothetical protein L484_006168                   100   2e-21   Morus notabilis
ref|XP_011090719.1|  PREDICTED: uncharacterized protein LOC105171...    100   2e-21   
gb|KEH23778.1|  plant/T24G3-80 protein                                  100   2e-21   Medicago truncatula
ref|XP_010929117.1|  PREDICTED: uncharacterized protein LOC105050701    101   2e-21   Elaeis guineensis
ref|XP_010644630.1|  PREDICTED: uncharacterized protein LOC100852612    100   2e-21   
emb|CDY50761.1|  BnaAnng10680D                                          100   2e-21   Brassica napus [oilseed rape]
ref|XP_009588422.1|  PREDICTED: uncharacterized protein LOC104085995    100   2e-21   Nicotiana tomentosiformis
ref|XP_003545439.1|  PREDICTED: putative uncharacterized protein ...    100   2e-21   Glycine max [soybeans]
ref|XP_011090718.1|  PREDICTED: uncharacterized protein LOC105171...    100   3e-21   
ref|XP_004493685.1|  PREDICTED: uncharacterized protein LOC101510231    100   3e-21   Cicer arietinum [garbanzo]
emb|CBI28703.3|  unnamed protein product                              99.8    3e-21   Vitis vinifera
ref|XP_010942142.1|  PREDICTED: uncharacterized protein LOC105060228    100   3e-21   Elaeis guineensis
ref|XP_003536115.1|  PREDICTED: uncharacterized protein LOC100778089    100   3e-21   Glycine max [soybeans]
gb|KJB46029.1|  hypothetical protein B456_007G344900                    100   3e-21   Gossypium raimondii
ref|XP_003632331.1|  PREDICTED: uncharacterized protein LOC100853449    100   3e-21   Vitis vinifera
ref|XP_011032694.1|  PREDICTED: uncharacterized protein LOC105131425  99.8    4e-21   Populus euphratica
ref|XP_003626413.1|  hypothetical protein MTR_7g114790                99.8    4e-21   Medicago truncatula
emb|CAN64151.1|  hypothetical protein VITISV_041021                   99.8    4e-21   Vitis vinifera
ref|XP_009124203.1|  PREDICTED: uncharacterized protein LOC103849150  99.8    4e-21   Brassica rapa
emb|CDY72112.1|  BnaC05g52260D                                        99.4    5e-21   Brassica napus [oilseed rape]
ref|XP_011026156.1|  PREDICTED: uncharacterized protein LOC105126841  99.8    5e-21   Populus euphratica
ref|XP_003518919.1|  PREDICTED: uncharacterized protein LOC100793503  99.4    5e-21   Glycine max [soybeans]
emb|CAN61445.1|  hypothetical protein VITISV_024138                     100   5e-21   Vitis vinifera
gb|KJB22972.1|  hypothetical protein B456_004G079100                  97.1    6e-21   Gossypium raimondii
ref|XP_009387555.1|  PREDICTED: uncharacterized protein LOC103974443  99.4    7e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002319062.1|  hypothetical protein POPTR_0013s03440g           99.0    7e-21   Populus trichocarpa [western balsam poplar]
emb|CDX76763.1|  BnaC08g33490D                                        99.4    7e-21   
ref|XP_004958096.1|  PREDICTED: uncharacterized protein LOC101782767  99.0    8e-21   Setaria italica
ref|XP_011005698.1|  PREDICTED: uncharacterized protein LOC105111908  99.0    8e-21   Populus euphratica
ref|XP_008451346.1|  PREDICTED: uncharacterized protein LOC103492661  99.0    9e-21   Cucumis melo [Oriental melon]
ref|XP_002300838.1|  hypothetical protein POPTR_0002s05250g           98.6    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010253022.1|  PREDICTED: uncharacterized protein LOC104594441  98.6    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_007162443.1|  hypothetical protein PHAVU_001G152600g           98.2    1e-20   Phaseolus vulgaris [French bean]
ref|XP_002520723.1|  conserved hypothetical protein                   98.2    2e-20   Ricinus communis
ref|XP_006408140.1|  hypothetical protein EUTSA_v10021255mg           97.8    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_004955779.1|  PREDICTED: uncharacterized protein LOC101785301  97.8    2e-20   Setaria italica
ref|XP_004494682.1|  PREDICTED: uncharacterized protein LOC101496846  97.8    2e-20   Cicer arietinum [garbanzo]
ref|XP_004146978.1|  PREDICTED: uncharacterized protein LOC101203661  97.8    2e-20   
ref|XP_004158912.1|  PREDICTED: uncharacterized protein LOC101227560  97.8    2e-20   
gb|KHN10674.1|  hypothetical protein glysoja_019105                   97.4    3e-20   Glycine soja [wild soybean]
ref|XP_007144817.1|  hypothetical protein PHAVU_007G186400g           97.4    3e-20   Phaseolus vulgaris [French bean]
gb|KJB22971.1|  hypothetical protein B456_004G079100                  97.4    3e-20   Gossypium raimondii
ref|XP_002884475.1|  hypothetical protein ARALYDRAFT_477757           97.1    3e-20   
ref|XP_003521248.2|  PREDICTED: uncharacterized protein LOC100799355  97.4    3e-20   Glycine max [soybeans]
gb|AAM65821.1|  unknown                                               96.7    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003556459.1|  PREDICTED: uncharacterized protein LOC100802...  97.1    4e-20   Glycine max [soybeans]
ref|NP_566240.1|  uncharacterized protein                             96.7    5e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KHN43917.1|  hypothetical protein glysoja_025956                   95.9    5e-20   Glycine soja [wild soybean]
gb|KJB10213.1|  hypothetical protein B456_001G189700                  96.3    6e-20   Gossypium raimondii
ref|XP_010532946.1|  PREDICTED: uncharacterized protein LOC104808831  95.9    8e-20   Tarenaya hassleriana [spider flower]
ref|XP_006298244.1|  hypothetical protein CARUB_v10014305mg           95.9    8e-20   Capsella rubella
emb|CDY30020.1|  BnaC01g39880D                                        95.5    1e-19   Brassica napus [oilseed rape]
emb|CDY21108.1|  BnaA01g33390D                                        95.1    1e-19   Brassica napus [oilseed rape]
ref|XP_006857698.1|  hypothetical protein AMTR_s00061p00168530        95.1    2e-19   Amborella trichopoda
ref|XP_011097721.1|  PREDICTED: uncharacterized protein LOC105176569  95.1    2e-19   Sesamum indicum [beniseed]
gb|EYU30508.1|  hypothetical protein MIMGU_mgv1a010362mg              95.1    2e-19   Erythranthe guttata [common monkey flower]
gb|EMT06649.1|  hypothetical protein F775_13550                       95.1    2e-19   
ref|XP_011458574.1|  PREDICTED: uncharacterized protein LOC101299...  95.1    2e-19   Fragaria vesca subsp. vesca
ref|XP_003617887.1|  Kinesin-4                                        98.6    2e-19   
emb|CDY00849.1|  BnaCnng00490D                                        94.7    2e-19   
emb|CDY27882.1|  BnaA07g04720D                                        94.7    2e-19   Brassica napus [oilseed rape]
ref|XP_010419519.1|  PREDICTED: uncharacterized protein LOC104705248  94.7    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004290606.1|  PREDICTED: uncharacterized protein LOC101299...  94.7    2e-19   Fragaria vesca subsp. vesca
ref|XP_009763291.1|  PREDICTED: uncharacterized protein LOC104215233  94.7    2e-19   Nicotiana sylvestris
ref|XP_003544282.1|  PREDICTED: uncharacterized protein LOC100810973  94.7    2e-19   Glycine max [soybeans]
gb|AET00846.2|  kinesin heavy chain, putative                         98.2    3e-19   Medicago truncatula
ref|XP_006452672.1|  hypothetical protein CICLE_v10010821mg           94.4    3e-19   Citrus clementina [clementine]
ref|XP_010485871.1|  PREDICTED: uncharacterized protein LOC104764117  94.4    3e-19   Camelina sativa [gold-of-pleasure]
gb|AFG57306.1|  hypothetical protein 0_630_01                         91.3    3e-19   Pinus taeda
ref|XP_009102402.1|  PREDICTED: uncharacterized protein LOC103828543  94.4    3e-19   Brassica rapa
ref|XP_009124977.1|  PREDICTED: uncharacterized protein LOC103850026  94.4    3e-19   Brassica rapa
gb|KJB10781.1|  hypothetical protein B456_001G224000                  94.4    3e-19   Gossypium raimondii
ref|NP_001143196.1|  uncharacterized protein LOC100275698             94.4    3e-19   
ref|XP_008651185.1|  PREDICTED: uncharacterized protein LOC100275...  94.4    3e-19   
gb|KHN33661.1|  hypothetical protein glysoja_013667                   93.6    3e-19   Glycine soja [wild soybean]
ref|XP_010463974.1|  PREDICTED: uncharacterized protein LOC104744596  94.4    3e-19   Camelina sativa [gold-of-pleasure]
gb|EAZ04414.1|  hypothetical protein OsI_26558                        94.0    4e-19   Oryza sativa Indica Group [Indian rice]
gb|AFG57303.1|  hypothetical protein 0_630_01                         90.9    4e-19   Pinus taeda
ref|XP_006418603.1|  hypothetical protein EUTSA_v10002618mg           94.0    4e-19   Eutrema salsugineum [saltwater cress]
gb|KHN23821.1|  hypothetical protein glysoja_028114                   94.4    4e-19   Glycine soja [wild soybean]
ref|XP_006299727.1|  hypothetical protein CARUB_v10015920mg           94.0    4e-19   Capsella rubella
ref|XP_009392096.1|  PREDICTED: uncharacterized protein LOC103978120  94.0    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO97954.1|  unnamed protein product                              94.0    4e-19   Coffea canephora [robusta coffee]
gb|AFG57305.1|  hypothetical protein 0_630_01                         90.9    4e-19   Pinus taeda
ref|XP_003615564.1|  hypothetical protein MTR_5g069570                94.0    5e-19   Medicago truncatula
ref|XP_002863234.1|  hypothetical protein ARALYDRAFT_497148           93.6    5e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_007206363.1|  hypothetical protein PRUPE_ppa017788mg           93.6    5e-19   
ref|XP_006604441.1|  PREDICTED: uncharacterized protein LOC100786850  93.6    5e-19   Glycine max [soybeans]
ref|NP_193005.1|  uncharacterized protein                             93.6    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284280.1|  hypothetical protein CARUB_v10005449mg           93.2    6e-19   Capsella rubella
ref|XP_010450329.1|  PREDICTED: uncharacterized protein LOC104732477  93.2    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010435360.1|  PREDICTED: uncharacterized protein LOC104719196  93.2    6e-19   Camelina sativa [gold-of-pleasure]
gb|EYU41493.1|  hypothetical protein MIMGU_mgv1a027106mg              93.2    7e-19   Erythranthe guttata [common monkey flower]
gb|KJB22685.1|  hypothetical protein B456_004G060700                  93.6    7e-19   Gossypium raimondii
ref|XP_002460890.1|  hypothetical protein SORBIDRAFT_02g037000        93.2    7e-19   Sorghum bicolor [broomcorn]
ref|XP_008229762.1|  PREDICTED: uncharacterized protein LOC103329112  93.2    7e-19   Prunus mume [ume]
gb|EMS45281.1|  hypothetical protein TRIUR3_16464                     93.2    8e-19   Triticum urartu
ref|XP_007020399.1|  Uncharacterized protein TCM_030574               93.2    8e-19   
ref|XP_008806297.1|  PREDICTED: uncharacterized protein LOC103719024  93.6    9e-19   Phoenix dactylifera
emb|CDP13671.1|  unnamed protein product                              92.8    1e-18   Coffea canephora [robusta coffee]
emb|CDP13674.1|  unnamed protein product                              92.8    1e-18   Coffea canephora [robusta coffee]
ref|XP_007199427.1|  hypothetical protein PRUPE_ppa026525mg           92.8    1e-18   
ref|XP_002883629.1|  hypothetical protein ARALYDRAFT_480071           92.8    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_004490568.1|  PREDICTED: uncharacterized protein LOC101492045  92.8    1e-18   Cicer arietinum [garbanzo]
gb|EAY92263.1|  hypothetical protein OsI_13984                        89.7    1e-18   Oryza sativa Indica Group [Indian rice]
gb|KHN46178.1|  hypothetical protein glysoja_022820                   92.0    1e-18   
ref|XP_006851632.1|  hypothetical protein AMTR_s00040p00202330        92.4    1e-18   
ref|XP_011072457.1|  PREDICTED: uncharacterized protein LOC105157708  92.4    1e-18   
ref|XP_003518296.1|  PREDICTED: uncharacterized protein LOC100796483  92.4    1e-18   
ref|XP_009622577.1|  PREDICTED: uncharacterized protein LOC104113961  92.4    1e-18   
ref|XP_009777340.1|  PREDICTED: uncharacterized protein LOC104226933  92.4    1e-18   
ref|XP_010228241.1|  PREDICTED: uncharacterized protein LOC100838117  92.4    2e-18   
ref|XP_010550936.1|  PREDICTED: uncharacterized protein LOC104821683  92.0    2e-18   
ref|XP_006657868.1|  PREDICTED: uncharacterized protein LOC102710887  92.0    2e-18   
gb|AFK40643.1|  unknown                                               92.0    2e-18   
ref|XP_010038753.1|  PREDICTED: uncharacterized protein LOC104427347  92.0    2e-18   
gb|AES61262.2|  plant/T24G3-80 protein                                92.0    2e-18   
gb|EYU33727.1|  hypothetical protein MIMGU_mgv1a0262881mg             92.0    2e-18   
ref|XP_007155488.1|  hypothetical protein PHAVU_003G205700g           92.0    2e-18   
gb|KDP22998.1|  hypothetical protein JCGZ_01720                       94.7    2e-18   
gb|KJB42120.1|  hypothetical protein B456_007G137800                  91.3    2e-18   
ref|XP_008235300.1|  PREDICTED: uncharacterized protein LOC103334...  91.3    2e-18   
ref|XP_003591011.1|  hypothetical protein MTR_1g081260                92.0    3e-18   
ref|NP_001060057.1|  Os07g0572300                                     91.7    3e-18   
ref|XP_007217278.1|  hypothetical protein PRUPE_ppa017616mg           91.7    3e-18   
ref|XP_008353616.1|  PREDICTED: uncharacterized protein LOC103417205  91.7    3e-18   
ref|XP_008368838.1|  PREDICTED: uncharacterized protein LOC103432425  91.7    3e-18   
ref|NP_178505.1|  uncharacterized protein                             91.7    3e-18   
gb|KJB42124.1|  hypothetical protein B456_007G137800                  91.7    3e-18   
gb|KFK31798.1|  hypothetical protein AALP_AA6G160300                  91.7    3e-18   
gb|KDO59224.1|  hypothetical protein CISIN_1g036500mg                 91.3    3e-18   
ref|XP_008235299.1|  PREDICTED: uncharacterized protein LOC103334...  91.7    3e-18   
ref|XP_010542041.1|  PREDICTED: uncharacterized protein LOC104815373  91.7    3e-18   
gb|ABK28164.1|  unknown                                               91.7    3e-18   
ref|XP_010488665.1|  PREDICTED: uncharacterized protein LOC104766470  91.7    3e-18   
ref|XP_008380035.1|  PREDICTED: uncharacterized protein LOC103443030  91.3    3e-18   
ref|XP_010676107.1|  PREDICTED: uncharacterized protein LOC104892001  91.3    3e-18   
ref|XP_007142451.1|  hypothetical protein PHAVU_008G281700g           91.3    3e-18   
ref|XP_008342273.1|  PREDICTED: uncharacterized protein LOC103405081  91.3    3e-18   
ref|XP_007049429.1|  Uncharacterized protein TCM_002465               91.3    3e-18   
ref|XP_010466979.1|  PREDICTED: uncharacterized protein LOC104747105  91.3    3e-18   
ref|XP_010487076.1|  PREDICTED: uncharacterized protein LOC104765...  91.3    4e-18   
ref|NP_001046211.1|  Os02g0198800                                     91.3    4e-18   
gb|EAY84891.1|  hypothetical protein OsI_06256                        91.3    4e-18   
ref|XP_010102967.1|  hypothetical protein L484_018986                 91.3    4e-18   
ref|XP_004495789.1|  PREDICTED: uncharacterized protein LOC101494890  91.3    4e-18   
ref|XP_010496357.1|  PREDICTED: uncharacterized protein LOC104773443  90.9    4e-18   
ref|XP_004235628.1|  PREDICTED: uncharacterized protein LOC101250288  90.9    4e-18   
gb|EYU45840.1|  hypothetical protein MIMGU_mgv1a019714mg              90.9    4e-18   
ref|XP_010487075.1|  PREDICTED: uncharacterized protein LOC104765...  90.9    5e-18   
ref|XP_006343140.1|  PREDICTED: uncharacterized protein LOC102583919  90.9    5e-18   
ref|XP_003549823.1|  PREDICTED: uncharacterized protein LOC100802...  90.9    5e-18   
ref|XP_004135720.1|  PREDICTED: uncharacterized protein LOC101212848  90.9    5e-18   
gb|KHN10445.1|  hypothetical protein glysoja_030881                   90.9    5e-18   
ref|XP_007208899.1|  hypothetical protein PRUPE_ppa026898mg           90.9    6e-18   
ref|XP_008239343.1|  PREDICTED: uncharacterized protein LOC103337946  90.9    6e-18   
ref|XP_006344483.1|  PREDICTED: uncharacterized protein LOC102586788  90.9    6e-18   
ref|XP_009385461.1|  PREDICTED: uncharacterized protein LOC103972819  90.5    6e-18   
ref|XP_006848668.1|  hypothetical protein AMTR_s00305p00015080        90.5    6e-18   
ref|XP_008444827.1|  PREDICTED: uncharacterized protein LOC103488057  90.5    6e-18   
gb|AFB32548.1|  hypothetical protein 0_14883_01                       87.8    6e-18   
ref|XP_003525519.1|  PREDICTED: uncharacterized protein LOC100779755  90.5    6e-18   
ref|XP_010465151.1|  PREDICTED: uncharacterized protein LOC104745569  90.1    7e-18   
ref|XP_009370813.1|  PREDICTED: uncharacterized protein LOC103960122  90.5    7e-18   
ref|XP_010929912.1|  PREDICTED: uncharacterized protein LOC105051269  90.5    7e-18   
ref|XP_004515862.1|  PREDICTED: uncharacterized protein LOC101502004  90.5    7e-18   
ref|XP_004305864.1|  PREDICTED: uncharacterized protein LOC101301230  90.5    7e-18   
ref|XP_009362927.1|  PREDICTED: uncharacterized protein LOC103952942  90.1    9e-18   
emb|CDY66553.1|  BnaCnng51410D                                        89.7    9e-18   
ref|XP_011040513.1|  PREDICTED: uncharacterized protein LOC105136753  90.1    1e-17   
ref|XP_004236272.1|  PREDICTED: uncharacterized protein LOC101245536  89.7    1e-17   
ref|XP_011015288.1|  PREDICTED: uncharacterized protein LOC105118926  89.4    1e-17   
ref|XP_011022881.1|  PREDICTED: uncharacterized protein LOC105124530  89.7    1e-17   
ref|XP_011046236.1|  PREDICTED: uncharacterized protein LOC105140891  89.7    1e-17   
gb|AFG57312.1|  hypothetical protein 0_630_01                         86.7    1e-17   
ref|XP_009798084.1|  PREDICTED: uncharacterized protein LOC104244370  90.1    1e-17   
emb|CDX82547.1|  BnaA03g32740D                                        89.7    1e-17   
ref|XP_009628338.1|  PREDICTED: uncharacterized protein LOC104118721  89.7    1e-17   
ref|XP_004502142.1|  PREDICTED: uncharacterized protein LOC101513281  89.7    1e-17   
ref|XP_010103965.1|  hypothetical protein L484_020218                 93.2    1e-17   
ref|XP_002310533.1|  hypothetical protein POPTR_0007s04630g           89.4    1e-17   
ref|XP_009135291.1|  PREDICTED: uncharacterized protein LOC103859505  89.4    2e-17   
gb|KJB51117.1|  hypothetical protein B456_008G201900                  89.4    2e-17   
ref|XP_006299636.1|  hypothetical protein CARUB_v10015817mg           89.4    2e-17   
gb|AFK39419.1|  unknown                                               89.4    2e-17   
ref|XP_002307050.1|  hypothetical protein POPTR_0005s06920g           89.4    2e-17   
ref|XP_011092005.1|  PREDICTED: uncharacterized protein LOC105172319  89.0    2e-17   
ref|XP_003601505.1|  hypothetical protein MTR_3g082430                89.0    2e-17   
ref|XP_011080356.1|  PREDICTED: uncharacterized protein LOC105163627  89.4    2e-17   
ref|XP_007142239.1|  hypothetical protein PHAVU_008G264000g           89.0    2e-17   
gb|AFB32542.1|  hypothetical protein 0_14883_01                       86.7    2e-17   
ref|XP_002987520.1|  hypothetical protein SELMODRAFT_126257           89.0    2e-17   
gb|KEH31766.1|  protein phosphatase 2c, putative                      89.0    2e-17   
ref|XP_010500251.1|  PREDICTED: uncharacterized protein LOC104777658  88.6    3e-17   
emb|CBI14939.3|  unnamed protein product                              88.6    3e-17   
gb|EYU45648.1|  hypothetical protein MIMGU_mgv1a010996mg              88.6    3e-17   
ref|XP_002322201.2|  hypothetical protein POPTR_0015s09600g           90.1    3e-17   
ref|XP_011031123.1|  PREDICTED: uncharacterized protein LOC105130358  88.6    3e-17   
ref|XP_009333930.1|  PREDICTED: uncharacterized protein LOC103926780  89.0    3e-17   
ref|XP_006407245.1|  hypothetical protein EUTSA_v10022027mg           88.2    3e-17   
ref|XP_004495197.1|  PREDICTED: uncharacterized protein LOC101503605  88.2    3e-17   
emb|CBI28480.3|  unnamed protein product                              88.2    3e-17   
ref|XP_009390571.1|  PREDICTED: uncharacterized protein LOC103976931  89.4    3e-17   
ref|XP_007037767.1|  Uncharacterized protein TCM_014486               88.6    3e-17   
ref|XP_011079867.1|  PREDICTED: uncharacterized protein LOC105163276  88.2    4e-17   
ref|XP_008360800.1|  PREDICTED: uncharacterized protein LOC103424495  88.6    4e-17   
ref|XP_002532169.1|  conserved hypothetical protein                   88.2    4e-17   
ref|XP_006846874.1|  hypothetical protein AMTR_s00150p00067790        88.6    4e-17   
ref|XP_007146005.1|  hypothetical protein PHAVU_006G004800g           88.2    4e-17   
gb|AFB32551.1|  hypothetical protein 0_14883_01                       85.5    5e-17   
ref|XP_008380651.1|  PREDICTED: uncharacterized protein LOC103443554  88.6    5e-17   
ref|XP_010912954.1|  PREDICTED: uncharacterized protein LOC105038765  87.8    5e-17   
ref|XP_007138005.1|  hypothetical protein PHAVU_009G173000g           88.2    5e-17   
gb|KHN30960.1|  hypothetical protein glysoja_017497                   87.8    5e-17   
ref|XP_008793736.1|  PREDICTED: uncharacterized protein LOC103709963  87.8    6e-17   
ref|XP_002987739.1|  hypothetical protein SELMODRAFT_126470           87.8    6e-17   
ref|XP_003522405.1|  PREDICTED: uncharacterized protein LOC100813254  87.8    6e-17   
ref|XP_003562863.1|  PREDICTED: uncharacterized protein LOC100826732  87.4    6e-17   
ref|XP_010663087.1|  PREDICTED: uncharacterized protein LOC100243254  87.8    6e-17   
gb|EPS66867.1|  hypothetical protein M569_07907                       87.4    8e-17   
ref|XP_002884958.1|  hypothetical protein ARALYDRAFT_478708           87.0    8e-17   
ref|XP_010039142.1|  PREDICTED: uncharacterized protein LOC104427810  87.4    9e-17   
gb|KJB63087.1|  hypothetical protein B456_009G452200                  87.0    9e-17   
gb|KJB08092.1|  hypothetical protein B456_001G064200                  86.7    9e-17   
ref|XP_010514327.1|  PREDICTED: uncharacterized protein LOC104790300  87.0    9e-17   
ref|NP_001136825.1|  uncharacterized protein LOC100216973             88.2    1e-16   
ref|NP_683561.1|  uncharacterized protein                             87.0    1e-16   
gb|KJB08091.1|  hypothetical protein B456_001G064200                  87.0    1e-16   
ref|XP_006661230.1|  PREDICTED: uncharacterized protein LOC102705282  86.7    1e-16   
ref|XP_006581901.1|  PREDICTED: uncharacterized protein LOC100816323  87.0    1e-16   
ref|XP_010552345.1|  PREDICTED: uncharacterized protein LOC104822...  86.3    1e-16   
ref|XP_002266988.1|  PREDICTED: uncharacterized protein LOC100249414  86.7    1e-16   
ref|XP_010552346.1|  PREDICTED: uncharacterized protein LOC104822...  86.3    1e-16   
gb|AFB32550.1|  hypothetical protein 0_14883_01                       84.0    1e-16   
ref|XP_011462197.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  86.3    2e-16   
gb|EMS50536.1|  hypothetical protein TRIUR3_22811                     86.7    2e-16   
ref|XP_006469407.1|  PREDICTED: uncharacterized protein LOC102629245  86.3    2e-16   
ref|XP_002530041.1|  protein phosphatase 2c, putative                 89.0    2e-16   
ref|XP_006447854.1|  hypothetical protein CICLE_v10017488mg           85.9    2e-16   
ref|XP_006645201.1|  PREDICTED: uncharacterized protein LOC102718506  85.9    2e-16   
dbj|BAK07193.1|  predicted protein                                    85.9    2e-16   
ref|XP_008353192.1|  PREDICTED: uncharacterized protein LOC103416744  85.9    2e-16   
gb|AEW07939.1|  hypothetical protein 0_14883_01                       83.2    3e-16   
ref|XP_008811744.1|  PREDICTED: uncharacterized protein LOC103722827  85.5    3e-16   
ref|XP_003556772.1|  PREDICTED: uncharacterized protein LOC100806502  85.5    3e-16   
gb|AFW70716.1|  hypothetical protein ZEAMMB73_330752                  87.4    3e-16   
gb|KHN09942.1|  hypothetical protein glysoja_043621                   84.7    4e-16   
ref|XP_009381564.1|  PREDICTED: uncharacterized protein LOC103969672  86.7    4e-16   
ref|XP_010107360.1|  hypothetical protein L484_006875                 85.1    4e-16   
dbj|BAJ98259.1|  predicted protein                                    86.7    4e-16   
ref|XP_007224142.1|  hypothetical protein PRUPE_ppa016161mg           85.1    4e-16   
ref|XP_004970997.1|  PREDICTED: uncharacterized protein LOC101768022  85.1    4e-16   
ref|XP_009367630.1|  PREDICTED: uncharacterized protein LOC103957228  85.1    5e-16   
emb|CDY56275.1|  BnaA09g55790D                                        82.8    6e-16   
ref|XP_002511308.1|  conserved hypothetical protein                   85.1    6e-16   
gb|ACF81406.1|  unknown                                               84.7    6e-16   
gb|KDP26687.1|  hypothetical protein JCGZ_17845                       84.7    7e-16   
ref|XP_002458958.1|  hypothetical protein SORBIDRAFT_03g043380        84.7    7e-16   
ref|XP_002451729.1|  hypothetical protein SORBIDRAFT_04g006760        84.7    7e-16   
ref|NP_001131873.1|  hypothetical protein                             84.3    8e-16   
gb|EPS70399.1|  hypothetical protein M569_04363                       84.0    8e-16   
ref|XP_009778863.1|  PREDICTED: uncharacterized protein LOC104228156  84.0    1e-15   
ref|XP_009417441.1|  PREDICTED: uncharacterized protein LOC103997840  84.7    1e-15   
ref|XP_008386487.1|  PREDICTED: uncharacterized protein LOC103448992  84.0    1e-15   
ref|XP_010275153.1|  PREDICTED: uncharacterized protein LOC104610298  84.0    1e-15   
ref|XP_011071966.1|  PREDICTED: uncharacterized protein LOC105157288  84.0    1e-15   
ref|XP_010314094.1|  PREDICTED: uncharacterized protein LOC101244061  84.0    1e-15   
ref|XP_004159590.1|  PREDICTED: uncharacterized protein LOC101232142  84.0    1e-15   
ref|XP_006366122.1|  PREDICTED: uncharacterized protein LOC102584925  84.0    1e-15   
ref|NP_001132137.1|  hypothetical protein                             83.6    1e-15   
ref|XP_004252365.1|  PREDICTED: uncharacterized protein LOC101249896  83.6    1e-15   
ref|XP_009379950.1|  PREDICTED: uncharacterized protein LOC103968448  84.0    1e-15   
gb|EPS70677.1|  hypothetical protein M569_04081                       83.6    1e-15   
ref|XP_002318087.2|  hypothetical protein POPTR_0012s09090g           84.0    1e-15   
gb|KHN38664.1|  hypothetical protein glysoja_008213                   84.0    1e-15   
gb|ACU18815.1|  unknown                                               83.6    2e-15   
ref|XP_009592922.1|  PREDICTED: uncharacterized protein LOC104089679  83.6    2e-15   
ref|XP_003538138.1|  PREDICTED: uncharacterized protein LOC100797969  83.6    2e-15   
gb|EEE55858.1|  hypothetical protein OsJ_04487                        83.6    2e-15   
ref|XP_010932250.1|  PREDICTED: uncharacterized protein LOC105052962  83.6    2e-15   
gb|EAZ44739.1|  hypothetical protein OsJ_29370                        85.1    2e-15   
gb|KDP31019.1|  hypothetical protein JCGZ_11395                       83.2    2e-15   
ref|XP_002524594.1|  conserved hypothetical protein                   83.2    2e-15   
dbj|BAD28921.1|  unknown protein                                      84.7    2e-15   
ref|XP_003601156.1|  hypothetical protein MTR_3g076610                83.6    2e-15   
ref|NP_001045150.1|  Os01g0909400                                     83.2    2e-15   
gb|EEC72003.1|  hypothetical protein OsI_04864                        83.2    2e-15   
gb|KDO82205.1|  hypothetical protein CISIN_1g020915mg                 83.2    3e-15   
gb|KHN21116.1|  hypothetical protein glysoja_006595                   82.8    3e-15   
ref|XP_003539811.1|  PREDICTED: uncharacterized protein LOC100794621  82.8    3e-15   
ref|XP_010251033.1|  PREDICTED: uncharacterized protein LOC104593063  83.2    3e-15   
ref|XP_006438240.1|  hypothetical protein CICLE_v10033962mg           83.2    3e-15   
gb|EYU22191.1|  hypothetical protein MIMGU_mgv1a010634mg              82.8    3e-15   
ref|XP_004951552.1|  PREDICTED: uncharacterized protein LOC101772581  82.8    3e-15   
gb|KDP32618.1|  hypothetical protein JCGZ_13168                       82.8    3e-15   
gb|EYU46571.1|  hypothetical protein MIMGU_mgv1a026066mg              82.4    3e-15   
ref|XP_008221896.1|  PREDICTED: uncharacterized protein LOC103321834  85.1    3e-15   
ref|XP_010689671.1|  PREDICTED: uncharacterized protein LOC104903342  82.8    3e-15   
ref|XP_008807465.1|  PREDICTED: uncharacterized protein LOC103719825  82.8    3e-15   
gb|EMT16711.1|  hypothetical protein F775_12417                       82.4    3e-15   
ref|XP_010682310.1|  PREDICTED: uncharacterized protein LOC104897184  84.7    4e-15   
ref|XP_006439940.1|  hypothetical protein CICLE_v10023489mg           82.0    6e-15   
emb|CDY48744.1|  BnaA02g30050D                                        81.6    7e-15   
ref|XP_010278217.1|  PREDICTED: uncharacterized protein LOC104612487  81.6    7e-15   
ref|XP_002268230.1|  PREDICTED: uncharacterized protein LOC100255180  81.6    7e-15   
ref|XP_011042396.1|  PREDICTED: uncharacterized protein LOC105138...  81.3    9e-15   
ref|XP_004301015.1|  PREDICTED: uncharacterized protein LOC101312836  81.6    9e-15   
ref|XP_003551067.1|  PREDICTED: uncharacterized protein LOC100775403  81.3    9e-15   
ref|XP_004143059.1|  PREDICTED: uncharacterized protein LOC101209288  83.6    1e-14   
emb|CDP12711.1|  unnamed protein product                              81.3    1e-14   
ref|XP_008444373.1|  PREDICTED: uncharacterized protein LOC103487722  83.6    1e-14   
ref|XP_011042397.1|  PREDICTED: uncharacterized protein LOC105138...  80.9    1e-14   
ref|XP_002865625.1|  hypothetical protein ARALYDRAFT_917720           81.3    1e-14   
ref|XP_006484324.1|  PREDICTED: uncharacterized protein LOC102618638  83.2    1e-14   
ref|XP_004501866.1|  PREDICTED: uncharacterized protein LOC101507...  80.9    2e-14   
ref|XP_003571347.2|  PREDICTED: uncharacterized protein LOC100832869  80.1    3e-14   
ref|NP_199638.1|  uncharacterized protein                             80.1    3e-14   
ref|XP_006648426.1|  PREDICTED: uncharacterized protein LOC102720024  79.0    3e-14   
ref|XP_011465680.1|  PREDICTED: uncharacterized protein LOC105351839  79.7    3e-14   
ref|XP_004294466.1|  PREDICTED: uncharacterized protein LOC101309136  79.7    4e-14   
ref|XP_002315660.1|  hypothetical protein POPTR_0010s05770g           79.7    4e-14   
emb|CDY05690.1|  BnaC02g38470D                                        79.3    4e-14   
ref|XP_007044827.1|  Uncharacterized protein TCM_010569               79.3    5e-14   
ref|XP_011021264.1|  PREDICTED: uncharacterized protein LOC105123388  79.0    6e-14   
ref|XP_010243783.1|  PREDICTED: uncharacterized protein LOC104587757  79.0    6e-14   
ref|XP_009385299.1|  PREDICTED: uncharacterized protein LOC103972680  78.6    7e-14   



>ref|XP_004244888.1| PREDICTED: uncharacterized protein LOC101262938 [Solanum lycopersicum]
Length=339

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 153/204 (75%), Gaps = 6/204 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVY-GGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAY++TRAR+      +VL+REHVY G KLY TKA  GGKER ISIDCR+ G+DP
Sbjct  141  GDLLKEAYSRTRARNKYMNMNMVLRREHVYCGNKLYITKAKFGGKEREISIDCRI-GEDP  199

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFE  391
             L FS+D+K+VLQIKHL+WKFRGNERIEV+G  + VSWDV++WLFDDDEDGYAL+ FKFE
Sbjct  200  RLYFSVDNKRVLQIKHLRWKFRGNERIEVDGVGVAVSWDVYNWLFDDDEDGYALYMFKFE  259

Query  390  KQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVME  211
            K S+  D             CG GFET +MKKG+     SSSSSS  S+++SS  +SVME
Sbjct  260  KSSL--DEEQFNNSMWSQQSCGFGFETKMMKKGV--LRSSSSSSSSLSSASSSCSSSVME  315

Query  210  WESAEENELKDPPGFSLLVYAWKS  139
            W S EENE+KDP GFSLLVYAWK+
Sbjct  316  WASTEENEMKDPTGFSLLVYAWKT  339



>ref|XP_006366515.1| PREDICTED: uncharacterized protein LOC102585370 [Solanum tuberosum]
Length=349

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 154/205 (75%), Gaps = 8/205 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAG--NGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDD  574
            GD  KEAY++TRAR     +   +VL+REHV G KLY TKA  GGKER ISIDCR+ G+D
Sbjct  151  GDLPKEAYSRTRARKPDKYSNSNMVLRREHVCGNKLYITKAKFGGKEREISIDCRI-GED  209

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKF  394
            P L FS+D+K+VLQIKHLKWKFRGNERIEV+G  + VSWDV++WLFDDDEDGYALF FKF
Sbjct  210  PRLYFSVDNKRVLQIKHLKWKFRGNERIEVDGVGVVVSWDVYNWLFDDDEDGYALFMFKF  269

Query  393  EKQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVM  214
            EK S+  D    G        CG GFET +MKKG+    RSSSSSS  S+++SS  +SVM
Sbjct  270  EKSSL--DELNNGVEMWSQQSCGFGFETKMMKKGV---LRSSSSSSSLSSASSSCSSSVM  324

Query  213  EWESAEENELKDPPGFSLLVYAWKS  139
            EW S EENELKDP GFSLLVYAWK+
Sbjct  325  EWASTEENELKDPSGFSLLVYAWKT  349



>ref|XP_009776174.1| PREDICTED: uncharacterized protein LOC104225989 [Nicotiana sylvestris]
Length=386

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 152/220 (69%), Gaps = 20/220 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQA------------LVLKREHVYGGKLYATKANVGGKERRI  604
            GD  KEAYAKTRAR     +             LVL+REHV G KLY TKAN GGKE+ I
Sbjct  170  GDLNKEAYAKTRARMPEKKENQNQNPNPNPNPNLVLRREHVCGNKLYKTKANFGGKEKEI  229

Query  603  SIDCRVAGDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDE  424
            SIDCR+ G+DP L FS+D+K+VLQIKHLKWKFRGNERIEV+G P+ VSWDV++WLFDDDE
Sbjct  230  SIDCRL-GEDPRLYFSVDNKRVLQIKHLKWKFRGNERIEVDGVPVLVSWDVYNWLFDDDE  288

Query  423  DGYALFTFKFEKQSVgedgggggfrgk-----mvnGCGLGFETMLMKKGLlrssrsssss  259
            DGYALF FKFEK S                      CG GFET +MKKG+     S SSS
Sbjct  289  DGYALFMFKFEKSSYEYVATDDSNFNNGVQLWSQQSCGFGFETKMMKKGV--LRSSRSSS  346

Query  258  slsstsasssctSVMEWESAEENELKDPPGFSLLVYAWKS  139
            S S +SASS+C+SVMEW S EENELK P GFSLLVYAWKS
Sbjct  347  SSSLSSASSTCSSVMEWASTEENELKGPSGFSLLVYAWKS  386



>ref|XP_009619129.1| PREDICTED: uncharacterized protein LOC104111192 [Nicotiana tomentosiformis]
Length=383

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 150/216 (69%), Gaps = 16/216 (7%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVL--------KREHVYGGKLYATKANVGGKERRISIDC  592
            GD  KEAYAKTRAR     Q L          +REHV G KLY TKAN GGKE+ ISIDC
Sbjct  171  GDLNKEAYAKTRARKPEKKQNLNPNPNPNLVLRREHVCGNKLYKTKANFGGKEKEISIDC  230

Query  591  RVAGDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYA  412
            R+ G+DP L FS+D+K+VLQIKHLKWKFRGNERIEV+G P+ VSWDV++WLFDDDEDGYA
Sbjct  231  RL-GEDPRLYFSVDNKRVLQIKHLKWKFRGNERIEVDGVPVLVSWDVYNWLFDDDEDGYA  289

Query  411  LFTFKFEKQSVgedgggggfrgk-----mvnGCGLGFETMLMKKGLlrssrsssssslss  247
            LF FKFEK S                      CG GFET +MKKG+     S SSSS S 
Sbjct  290  LFMFKFEKSSYEYVAADDYSLNNGVQLWSQQSCGFGFETKMMKKGV--LRSSRSSSSSSL  347

Query  246  tsasssctSVMEWESAEENELKDPPGFSLLVYAWKS  139
            +SASS+C+SVMEW S EENELK P GFSLLVYAWKS
Sbjct  348  SSASSTCSSVMEWASTEENELKGPSGFSLLVYAWKS  383



>ref|XP_002285361.1| PREDICTED: uncharacterized protein LOC100262872 [Vitis vinifera]
Length=371

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 147/212 (69%), Gaps = 11/212 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD +KEAY KTRA+ A   Q LVL+REHV+G K+Y T+A+ GGK R ISIDC V GDDP 
Sbjct  162  GDSEKEAYNKTRAKKAERTQVLVLRREHVFGNKVYTTRASFGGKTREISIDCSV-GDDPR  220

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L FS+D K+VLQIK LKWKFRGNE+IEV+G PIQVSWDV++WLFDD  + +A+F FKFE+
Sbjct  221  LSFSVDRKRVLQIKRLKWKFRGNEKIEVDGIPIQVSWDVYNWLFDDVMESHAVFMFKFER  280

Query  387  ------QSVgedgggggfrgkmvnGCGLG---FETMLMKKGLlrssrsssssslsstsas  235
                      +           +  CG G    E   MKK LL+++RSSSSSSLSS S+ 
Sbjct  281  VGFEEEDEELQQQQQHLNEKNGMALCGFGMNGIERKKMKKSLLKTTRSSSSSSLSSASSG  340

Query  234  ssctSVMEWESAEENELKDPPGFSLLVYAWKS  139
             S + VMEW S EE ELK P GFSLLVYAWKS
Sbjct  341  CSSS-VMEWASTEEMELKSPSGFSLLVYAWKS  371



>emb|CAN69699.1| hypothetical protein VITISV_001515 [Vitis vinifera]
Length=372

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 144/213 (68%), Gaps = 12/213 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD +KEAY KTRA+ A   Q LVL+REHV+G K+Y T+A+ GGK R ISIDC V GDDP 
Sbjct  162  GDSEKEAYNKTRAKKAERTQVLVLRREHVFGNKVYTTRASFGGKTREISIDCSV-GDDPR  220

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L FS+D K+VLQIK LKWKFRGNE+IEV+G PIQVSWDV++WLFDD  + +A+F FKFE+
Sbjct  221  LSFSVDRKRVLQIKRLKWKFRGNEKIEVDGIPIQVSWDVYNWLFDDVMESHAVFMFKFER  280

Query  387  -------QSVgedgggggfrgkmvnGCGL---GFETMLMKKGLlrssrsssssslsstsa  238
                   + + +           +  CG    G E   MKK L   +  SSSSS  S+++
Sbjct  281  VGFEEEDEELQQQQQQHLNEKNGMALCGFGMNGIERKKMKKSL-LKTTRSSSSSSLSSAS  339

Query  237  sssctSVMEWESAEENELKDPPGFSLLVYAWKS  139
            S   +SVMEW S EE +LK P GFSLLVYAWKS
Sbjct  340  SGCSSSVMEWASTEEMDLKSPSGFSLLVYAWKS  372



>ref|XP_007011756.1| Uncharacterized protein TCM_036932 [Theobroma cacao]
 gb|EOY29375.1| Uncharacterized protein TCM_036932 [Theobroma cacao]
Length=384

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 138/222 (62%), Gaps = 21/222 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  K AYA+TRA+     QALVL+REHV+G K+Y TKA  GGK R ISIDCRV  +D  
Sbjct  163  GDSTKAAYARTRAQKPRRSQALVLRREHVFGSKVYNTKARFGGKSREISIDCRV-NEDAK  221

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFE  391
            L FS+D+K+VLQIK LKWKFRGNERIEV+G  IQVSWDV++WLFD D  +G+A+F FKFE
Sbjct  222  LCFSVDNKRVLQIKRLKWKFRGNERIEVDGVSIQVSWDVYNWLFDQDLNNGHAVFVFKFE  281

Query  390  KQS---------------VgedgggggfrgkmvnGCGL---GFETMLMKKG-Llrssrss  268
             +                V              N C L   G E   M+K  L  +  SS
Sbjct  282  NEGSEILEEEHQQADAEVVSPFNEKNEVVLWQQNSCSLPLNGIEWKKMRKSLLRTARSSS  341

Query  267  sssslsstsasssctSVMEWESAEENELKDPPGFSLLVYAWK  142
            SSS   S+++S   +SVMEW S EE EL  P GFSLLVYAWK
Sbjct  342  SSSISMSSASSGGSSSVMEWASVEETELSAPTGFSLLVYAWK  383



>ref|XP_010665861.1| PREDICTED: uncharacterized protein LOC104883105 [Beta vulgaris 
subsp. vulgaris]
Length=384

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 148/220 (67%), Gaps = 19/220 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAG---  580
            GD +KEA+AKT+  + A   Q+LV++REHV+G + Y+T  ++GGK R I I+  V     
Sbjct  167  GDLEKEAFAKTKVTKFAEKLQSLVIRREHVFGDRFYSTTTDLGGKSRLILIELNVNNHNN  226

Query  579  -DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD----EDGY  415
             +DP LV   D K+VLQ+KHLKWKFRG+ERIEV+G+PIQ+SWDV++WLFD D    +DGY
Sbjct  227  EEDPRLVIRFDSKRVLQVKHLKWKFRGSERIEVDGYPIQLSWDVYNWLFDQDCGSHDDGY  286

Query  414  ALFTFKFEKQ--------SVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssss  259
            ALFTF+FEKQ        ++  +           + CGL +E   MKK      ++SSSS
Sbjct  287  ALFTFRFEKQGNEVFSDDNINNNVVSKREVIWSQDSCGLNYERKKMKK--KLLVKTSSSS  344

Query  258  slsstsasssctSVMEWESAEENELKDPPGFSLLVYAWKS  139
            + S +S SS  +SV+EWES EENELK P GFSLLVYAWK+
Sbjct  345  NSSISSVSSGSSSVLEWESVEENELKGPTGFSLLVYAWKN  384



>gb|KDP33539.1| hypothetical protein JCGZ_07110 [Jatropha curcas]
Length=384

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 138/221 (62%), Gaps = 20/221 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  K+A AKTRA+ A   Q LVL+REHVYG ++Y TKA  GGK R ISIDC V  +D  
Sbjct  164  GDLTKQACAKTRAKRADRSQVLVLRREHVYGNRVYTTKARFGGKNRDISIDCTV-NNDAR  222

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L FS+D++KVLQIK LKWKFRGNE+IEV+G P QVSWDV++WLF+D  +G+A+F F+FE 
Sbjct  223  LCFSVDNQKVLQIKRLKWKFRGNEKIEVDGVPTQVSWDVYNWLFEDVNNGHAVFMFRFET  282

Query  387  QSVgedgggggfrgkmvnGCG------------------LGFETMLMKKGLlrss-rsss  265
            Q + + G            C                    G E   M+  +  +   SSS
Sbjct  283  QDIEDAGEEEEEGRGGTEVCNGQDEKNGVVPWQHSNLGMSGIEWRKMRSLMRTTRSSSSS  342

Query  264  ssslsstsasssctSVMEWESAEENELKDPPGFSLLVYAWK  142
            S S+SS S++   +S+MEW S EENEL  P GFSLLVYAW+
Sbjct  343  SISMSSASSAGGSSSIMEWASTEENELSSPNGFSLLVYAWR  383



>gb|KJB07669.1| hypothetical protein B456_001G036600 [Gossypium raimondii]
Length=362

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 139/205 (68%), Gaps = 6/205 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEAYA+TR +  G  QALV +REH+YG KLY TKA  G K + ISI+C+   +   
Sbjct  160  GDSIKEAYARTRVQKPGKPQALVSRREHLYGNKLYTTKARFGSKRKEISIECKAMKEGAE  219

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFE  391
            L FS+D+++VLQIK LKWKFRGNERIEV+G  +QVSWDV++WLFD +  +G+A+F FKFE
Sbjct  220  LCFSVDNQRVLQIKRLKWKFRGNERIEVDGVSVQVSWDVYNWLFDQELNNGHAVFMFKFE  279

Query  390  K-QSVgedgggggfrgkmvnGCGLGFETMLMKKGL-lrssrsssssslsstsasssctSV  217
              ++V       G      +   +G +   M+K + + +  SSSSS  +S+++S   +SV
Sbjct  280  NDEAVSPLKEKEGIFLCQQSSPSIGEK---MRKSMWMTARSSSSSSISTSSASSGGSSSV  336

Query  216  MEWESAEENELKDPPGFSLLVYAWK  142
            +EW S EE+EL  P GFSLLVYAWK
Sbjct  337  LEWASVEESELSAPTGFSLLVYAWK  361



>emb|CBI21089.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD +KEAY KTRA+ A   Q LVL+REHV+G K+Y T+A+ GGK R ISIDC V GDDP 
Sbjct  122  GDSEKEAYNKTRAKKAERTQVLVLRREHVFGNKVYTTRASFGGKTREISIDCSV-GDDPR  180

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L FS+D K+VLQIK LKWKFRGNE+IEV+G PIQVSWDV++WLFDD  + +A+F FKFE+
Sbjct  181  LSFSVDRKRVLQIKRLKWKFRGNEKIEVDGIPIQVSWDVYNWLFDDVMESHAVFMFKFER  240



>gb|KJB55057.1| hypothetical protein B456_009G060700 [Gossypium raimondii]
Length=386

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 138/223 (62%), Gaps = 22/223 (10%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEAYA+ RA+  G  Q+LVL+REHV G K+Y TKA  GG+ R ISI+ + A +D  
Sbjct  164  GDSAKEAYARARAQRPGKSQSLVLRREHVLGNKVYNTKARFGGRNREISIEFK-ANEDGK  222

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFE  391
            L FS+D+ +VLQIK LKWKFRGNERIEV+G  IQVSWDV++WLFD D D G+A+F FKFE
Sbjct  223  LCFSVDNNRVLQIKRLKWKFRGNERIEVDGVSIQVSWDVYNWLFDQDLDNGHAVFMFKFE  282

Query  390  KQS----------------VgedgggggfrgkmvnGCGLGFETM----LMKKGLlrssrs  271
             +                 VG      G      + C  G   +    + K  L  +  S
Sbjct  283  NEGSEILEGDYQQDGVEEVVGPFNEKNGVVLWQQSSCNFGVNGIEWKKMRKSFLRTARSS  342

Query  270  ssssslsstsasssctSVMEWESAEENELKDPPGFSLLVYAWK  142
            SSSS   S+++S+  +SVMEW S EE+EL  P GFSLLVYAWK
Sbjct  343  SSSSISMSSASSAGSSSVMEWASVEESELSAPTGFSLLVYAWK  385



>ref|XP_006450316.1| hypothetical protein CICLE_v10008624mg [Citrus clementina]
 ref|XP_006483448.1| PREDICTED: uncharacterized protein LOC102620001 [Citrus sinensis]
 gb|ESR63556.1| hypothetical protein CICLE_v10008624mg [Citrus clementina]
 gb|KDO67512.1| hypothetical protein CISIN_1g016824mg [Citrus sinensis]
Length=382

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 142/217 (65%), Gaps = 17/217 (8%)
 Frame = -2

Query  747  GDCQKEAYAKTRAR---HAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGD  577
            GDC KEAYAKT+A+    +   QALVL+REHV+G K+Y TKA  GGK R +SIDC  + +
Sbjct  167  GDCIKEAYAKTKAQKPERSQAPQALVLRREHVFGNKVYTTKAKFGGKTRDVSIDCSTS-N  225

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD------DEDGY  415
            D  L FS+D+ +VLQIK LKWKFRGNERI+V+G P+Q+SWDV++WLFDD      D +G+
Sbjct  226  DARLCFSVDNVRVLQIKRLKWKFRGNERIDVDGVPVQISWDVYNWLFDDFKSNKNDGNGH  285

Query  414  ALFTFKFEKQSVgedgggggfrgkmvnGCG----LGFETMLMKKGLl-rssrssssssls  250
            A+F F+FE  +V  +           + C      G E   M+K L+  +  SSSSS   
Sbjct  286  AVFMFRFE-DTVDNEEEQEPMWQLQQSSCSNFGMSGIEWRKMRKSLMRTARSSSSSSISM  344

Query  249  stsasssctSVMEWESAEENELKD-PPGFSLLVYAWK  142
            S+S+S   +SVMEW S EE+EL   P GFSLLVY WK
Sbjct  345  SSSSSGCSSSVMEWASMEESELSPGPNGFSLLVYIWK  381



>ref|XP_004501367.1| PREDICTED: uncharacterized protein LOC101507611 [Cicer arietinum]
Length=347

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 131/209 (63%), Gaps = 13/209 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  K+AYAK++A+   NGQ LVLKREHV+  K+Y T+A  GGK R I IDC    D   
Sbjct  144  GDSNKDAYAKSKAKEPKNGQFLVLKREHVFANKIYVTRARFGGKMREIQIDCG-GRDHSR  202

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF-DDDEDGYALFTFKFE  391
            L FS+D KKVL IK LKWKFRGNER+E++G P+Q+SWDV++WLF  D+ DG+A+F FKFE
Sbjct  203  LCFSVDGKKVLVIKRLKWKFRGNERVEIDGVPVQISWDVYNWLFVKDNNDGHAIFMFKFE  262

Query  390  KQSVgedgggggfrgkmvnGCGLGFETMLMKKG------Llrssrsssssslsstsasss  229
            +              +  +   L  +  L   G      + +S  SSS S  SS  +  +
Sbjct  263  EDE-----NNEEQIVRERSLMNLWTQQNLNNLGVYELGKIGKSWSSSSVSMASSGGSFGA  317

Query  228  ctSVMEWESAEENELKDPPGFSLLVYAWK  142
             +SV+EW S EENEL  P GFSLLVYAWK
Sbjct  318  SSSVLEWSSVEENELVVPIGFSLLVYAWK  346



>ref|XP_010245551.1| PREDICTED: uncharacterized protein LOC104589062 [Nelumbo nucifera]
Length=369

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 142/223 (64%), Gaps = 21/223 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD Q+E Y +++ R      Q L+ +REHV+G K+Y T+A  GGK R ISIDC V+GD+P
Sbjct  148  GDSQREVYGRSKTRKPNRRSQVLISRREHVFGNKVYTTRARFGGKTRDISIDCSVSGDEP  207

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKF  394
             L FS+D K+VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLF+   EDG+A+F FKF
Sbjct  208  RLCFSVDRKRVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFEGGVEDGHAVFMFKF  267

Query  393  EKQSVgedggggg--------------frgkmvnGCGLG---FETMLMKKGLlrssrsss  265
            EK   GE+                      +     G+G   FE   + +G    +  SS
Sbjct  268  EKTEFGEEEEENVQEELNEKTGRMVVWKPQQSPTSGGIGMNTFEWKRINRGF-LKTTRSS  326

Query  264  ssslsstsasssctSVMEWESA-EENELKDPPGFSLLVYAWKS  139
            SSS  S+++S   +SVMEW S+ +E+EL+ P GF LLVYAW++
Sbjct  327  SSSSMSSASSGCSSSVMEWASSMDESELQSPSGFCLLVYAWRN  369



>ref|XP_008220875.1| PREDICTED: uncharacterized protein LOC103320911 [Prunus mume]
Length=342

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 133/206 (65%), Gaps = 9/206 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  +EAYAKTRA  A   Q  +LKREHV   K+Y TKA  GGK R I IDC    D   
Sbjct  141  GDLTREAYAKTRAHKAQTPQIPILKREHVVAKKIYTTKARFGGKLREIQIDCGYGNDLSR  200

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFKFE  391
            L FS+D ++VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D +DG+A+F F+FE
Sbjct  201  LCFSVDGQRVLQIKRLKWKFRGNERIEVDGAPLQISWDVYNWLFESDSDDGHAVFMFRFE  260

Query  390  K-QSVgedgggggfrgkmvnGCGL-GFETMLMKKGLlrssrsssssslsstsasssctSV  217
            + + + ++              G+ G E   M K     S SSSS S+SS  +S   +SV
Sbjct  261  EDEEINKESNNCQMGHLNSWNFGMNGIEWRKMGK-----SLSSSSVSMSSAGSSGGSSSV  315

Query  216  MEWESAEENELK-DPPGFSLLVYAWK  142
            MEW S EE+EL   P GFSLLVYAWK
Sbjct  316  MEWASMEESELSGGPTGFSLLVYAWK  341



>ref|XP_003603315.1| hypothetical protein MTR_3g106250 [Medicago truncatula]
 gb|AES73566.1| DUF868 family protein [Medicago truncatula]
Length=346

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 131/207 (63%), Gaps = 9/207 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRAR-HAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  K+AYAK++++ H  N Q LV+KREHVY  K+Y T+A  GGK R I IDC    D  
Sbjct  143  GDSNKDAYAKSKSKEHKNNFQYLVMKREHVYANKIYNTRARFGGKMREIQIDCG-GRDHS  201

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF-DDDEDGYALFTFKF  394
             L FS+D +KVLQIK LKWKFRGNER+E++G P+Q+SWDV++WLF  D+ DG+A+F FKF
Sbjct  202  RLCFSVDGQKVLQIKRLKWKFRGNERVEIDGVPVQISWDVYNWLFVKDNSDGHAIFMFKF  261

Query  393  EKQSVged---gggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssct  223
            E++   E                   LG   +     + +S  SSS S  SS  +  + +
Sbjct  262  EEEDEDEQQRGKEKSLTNLLAQQNLNLGVYEL---GKMGKSWSSSSVSMASSGGSFGASS  318

Query  222  SVMEWESAEENELKDPPGFSLLVYAWK  142
            SV+EW S EENEL  P GFSLLVYAWK
Sbjct  319  SVLEWSSVEENELVVPVGFSLLVYAWK  345



>ref|XP_010033684.1| PREDICTED: uncharacterized protein LOC104422917 [Eucalyptus grandis]
 gb|KCW53394.1| hypothetical protein EUGRSUZ_J02625 [Eucalyptus grandis]
Length=382

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 139/219 (63%), Gaps = 18/219 (8%)
 Frame = -2

Query  747  GDCQKEAYAKTRARH-AGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  K AY KT+AR  A  GQAL L+REH++G ++YAT A  GGK R IS+DC V G+  
Sbjct  164  GDAVKSAYGKTKARKPAERGQALFLRREHLFGHRVYATSARFGGKNRAISVDCNVHGEGK  223

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFE  391
             L  S+D ++VLQ+K LKWKFRGNER+EV+G   QVSWDV++WLF+D +D +A+F F+FE
Sbjct  224  -LCISVDKRRVLQVKRLKWKFRGNERVEVDGVNFQVSWDVYNWLFEDAKDSHAVFMFRFE  282

Query  390  K------------QSVgedgggggfrgkmvnGCGLG---FETMLMKKGLlrssrssssss  256
            K                               C  G    E   M+K  LRS+RSSSSSS
Sbjct  283  KLINNDEERKKGGGGDDGVQAVSNLLLWSQPSCSFGMNEIELRKMRKSKLRSARSSSSSS  342

Query  255  lsstsasssctSVMEWESAEENELKDP-PGFSLLVYAWK  142
            +SS+++S   +S+MEW SAEENEL  P  GFSLLVYAWK
Sbjct  343  ISSSASSGGSSSIMEWASAEENELSGPFVGFSLLVYAWK  381



>ref|XP_002515453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46902.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  K+A+AKTRAR     Q LVL+REHVYG +++ TKA  GGK R ISIDC V GD   
Sbjct  116  GDSTKQAFAKTRARKQERNQVLVLRREHVYGNRVFTTKARFGGKNRDISIDCTVNGD-AR  174

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L FS+D+K+VL IK LKWKFRGNE+IEV+G PIQVSWDV++WLF+D  +G+A+F F+FE 
Sbjct  175  LSFSVDNKRVLHIKQLKWKFRGNEKIEVDGVPIQVSWDVYNWLFEDINNGHAVFMFRFES  234

Query  387  QSV  379
              +
Sbjct  235  TDI  237



>ref|XP_010048907.1| PREDICTED: uncharacterized protein LOC104437620 [Eucalyptus grandis]
 gb|KCW81330.1| hypothetical protein EUGRSUZ_C02717 [Eucalyptus grandis]
Length=382

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 137/219 (63%), Gaps = 18/219 (8%)
 Frame = -2

Query  747  GDCQKEAYAKTRARH-AGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  K AY KT+ R  A  GQAL L+REH++G ++YAT A  GGK R ISIDC V G+  
Sbjct  164  GDAVKSAYGKTKVRKPAERGQALFLRREHLFGHRVYATSARFGGKNRTISIDCNVHGEG-  222

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFE  391
             L  S+D ++VLQ+K LKWKFRGNER+EV+G   QVSWDV++WLF+D  D +A+F F+FE
Sbjct  223  KLCISVDKRRVLQVKRLKWKFRGNERVEVDGVNFQVSWDVYNWLFEDASDSHAVFMFRFE  282

Query  390  K------------QSVgedgggggfrgkmvnGCGLG---FETMLMKKGLlrssrssssss  256
            K                               C  G    E   M+K  LRS+RSSSSSS
Sbjct  283  KLINNDEERKKGGGGDDGVQAVSNLLLWSQPSCSFGMNEIELRKMRKSKLRSARSSSSSS  342

Query  255  lsstsasssctSVMEWESAEENELKDP-PGFSLLVYAWK  142
            +SS+++S   +S+MEW SAEENEL  P  GFSLLVYAWK
Sbjct  343  ISSSASSGGSSSIMEWASAEENELSGPFVGFSLLVYAWK  381



>ref|XP_009363946.1| PREDICTED: uncharacterized protein LOC103953867 [Pyrus x bretschneideri]
Length=343

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 130/206 (63%), Gaps = 9/206 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  +EAYAKTRA+ +   Q  +LKREHV   K+YATKA  GGK R I IDC    D   
Sbjct  142  GDLTREAYAKTRAQKSETPQIPILKREHVVAKKIYATKARFGGKLREIRIDCGSNADPTR  201

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTFK  397
            L FS+D + VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D   +DG+A+F F+
Sbjct  202  LCFSVDGQVVLQIKRLKWKFRGNERIEVDGTPLQISWDVYNWLFESDGGGDDGHAVFMFR  261

Query  396  FEKQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSV  217
            FE+    ++           N    G E   M K     S SSSS S+SS  +S   +SV
Sbjct  262  FEEDGEIKENNYQLGHLNSWNFGMSGIEWRKMGK-----SLSSSSVSMSSAGSSGGSSSV  316

Query  216  MEWESAEENELK-DPPGFSLLVYAWK  142
            MEW S EE+EL   P GFSL VYAWK
Sbjct  317  MEWASTEESELSGGPAGFSLFVYAWK  342



>gb|KJB65893.1| hypothetical protein B456_010G117700 [Gossypium raimondii]
Length=357

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 133/210 (63%), Gaps = 8/210 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN--GQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDD  574
            GD  KEAY +TRA++ G+   Q LVL++EHV G ++Y TKA  GGK R ISIDCRV  +D
Sbjct  149  GDATKEAYTRTRAQNPGSRGSQTLVLRKEHVLGNRVYNTKARFGGKLRDISIDCRV-NED  207

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDG--YALFTF  400
              L  S+D+K+VLQIK LKWKFRGNERIEV+G  I VSWDV+SWL D D +    A+F F
Sbjct  208  ARLCLSVDNKRVLQIKRLKWKFRGNERIEVDGVWIGVSWDVYSWLSDKDGNNGRPAVFIF  267

Query  399  KFEKQSVgedgggggfrgk--mvnGCGLGFE-TMLMKKGLlrssrsssssslsstsasss  229
            KFE Q                  + C  G E     +  L  +  SSSSS   S+++S  
Sbjct  268  KFENQGTETMEDPFKEGVVLGQQSPCSDGIEWKKKRRSLLRSARSSSSSSISMSSASSGC  327

Query  228  ctSVMEWESAEENELKDPPGFSLLVYAWKS  139
             +SVMEWES EE+EL  P GFSLLVYAW++
Sbjct  328  SSSVMEWESVEESELCAPMGFSLLVYAWRN  357



>ref|XP_008378697.1| PREDICTED: uncharacterized protein LOC103441769 [Malus domestica]
Length=344

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 129/206 (63%), Gaps = 9/206 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  +EAY+KTRAR +   Q  +LKREHV   K+Y T A  GGK R I IDC    D   
Sbjct  143  GDLTREAYSKTRARKSETPQIPILKREHVIAKKIYTTMARFGGKLREIRIDCGSNADPTR  202

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTFK  397
            L FS+D + VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D   +DG+A+F F+
Sbjct  203  LCFSVDGQVVLQIKRLKWKFRGNERIEVDGTPLQISWDVYNWLFESDGCRDDGHAVFMFR  262

Query  396  FEKQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSV  217
            FE+    ++           N    G E   M K     S SSSS S+SS  +S   +SV
Sbjct  263  FEEDEEIKENNYQLGHLNSWNFGMSGIEWRKMGK-----SLSSSSVSMSSAGSSGGSSSV  317

Query  216  MEWESAEENELK-DPPGFSLLVYAWK  142
            MEW S EE+EL   P GFSLLVYAWK
Sbjct  318  MEWASTEESELSGGPAGFSLLVYAWK  343



>ref|XP_006382097.1| hypothetical protein POPTR_0006s27720g [Populus trichocarpa]
 gb|ERP59894.1| hypothetical protein POPTR_0006s27720g [Populus trichocarpa]
Length=246

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEA+AKT+A      Q LVL+REHV+G ++Y T+A  GGK R ISIDC V  +D  
Sbjct  6    GDLTKEAFAKTKALKKERAQVLVLRREHVFGNRVYTTRARFGGKNREISIDCSV-NNDAR  64

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFE  391
            L F +D+K+VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLFDD    +A+F F+FE
Sbjct  65   LCFCVDNKRVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFDDINTDHAVFMFRFE  123



>ref|XP_011039597.1| PREDICTED: uncharacterized protein LOC105136101 [Populus euphratica]
Length=402

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEA+AKT+A      Q LVL+REHV+G ++Y T+A  GGK R ISIDC V  +D  
Sbjct  163  GDLTKEAFAKTKALRKERAQVLVLRREHVFGNRVYTTRARFGGKNREISIDCSV-NNDAR  221

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L F +D+K+VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLFDD    +A+F F+FE 
Sbjct  222  LCFCVDNKRVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFDDIHTDHAVFMFRFES  281

Query  387  Q  385
             
Sbjct  282  N  282



>ref|XP_011036648.1| PREDICTED: uncharacterized protein LOC105134078 [Populus euphratica]
Length=407

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 92/121 (76%), Gaps = 1/121 (1%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEA+AKT+A      Q LVL+REHV+G ++Y T+A  GG+ R ISIDC V  +D  
Sbjct  168  GDLTKEAFAKTKALKQERPQVLVLRREHVFGNRVYTTRARFGGRNRVISIDCSV-NNDAR  226

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L FS+D+++VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLFDD  + +A+F F+FE 
Sbjct  227  LCFSVDNERVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFDDINNDHAVFMFRFES  286

Query  387  Q  385
             
Sbjct  287  N  287



>ref|XP_008377675.1| PREDICTED: uncharacterized protein LOC103440754 [Malus domestica]
Length=346

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 128/204 (63%), Gaps = 7/204 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  +EAYAKTRA  +   Q  +LKREHV   K+Y TKA  GGK R I ID   + D   
Sbjct  147  GDLTREAYAKTRANKSETSQIPILKREHVVAKKIYTTKARFGGKLREIRIDYGSSADPTR  206

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFTFKFE  391
            L FS+D + VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D +DG+A+F F+FE
Sbjct  207  LCFSVDGQIVLQIKRLKWKFRGNERIEVDGTPVQISWDVYNWLFESDGDDGHAVFMFRFE  266

Query  390  KQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVME  211
            +    ++           N    G E   M K     S SSSS S+SS  +S   +SVME
Sbjct  267  EXEEIKENNYQXGHLNSWNFGMSGIEWRKMGK-----SFSSSSVSMSSAGSSGGSSSVME  321

Query  210  WESAEENELK-DPPGFSLLVYAWK  142
            W S EE+EL   P GFSL +YAWK
Sbjct  322  WASTEESELNGGPAGFSLQIYAWK  345



>ref|XP_007224916.1| hypothetical protein PRUPE_ppa021934mg [Prunus persica]
 gb|EMJ26115.1| hypothetical protein PRUPE_ppa021934mg [Prunus persica]
Length=431

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 129/199 (65%), Gaps = 5/199 (3%)
 Frame = -2

Query  732  EAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSM  553
            EAYAKTRA  A   Q  +LKREHV   K+Y TKA  GGK R I IDC    D   L FS+
Sbjct  235  EAYAKTRAHKAQTPQIPILKREHVVAKKIYTTKARFGGKLRSIQIDCGYGNDLSRLCFSV  294

Query  552  DDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFKFEKQSVg  376
            D ++VLQIK LKWKFRGNERIEV+G P+Q+SWDV++WLF+ D +DG+A+F F+FE++   
Sbjct  295  DGQRVLQIKRLKWKFRGNERIEVDGAPLQISWDVYNWLFESDSDDGHAVFMFRFEEEEEI  354

Query  375  edgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAE  196
                     G + +    G   +  +K  +  S SSSS S+SS  +S   +SVMEW S E
Sbjct  355  NKESNNCQLGHLNSW-NFGMNGIEWRK--MGKSLSSSSVSMSSAGSSGGSSSVMEWASME  411

Query  195  ENELK-DPPGFSLLVYAWK  142
            E+EL   P GFSLLVYAWK
Sbjct  412  ESELSGGPTGFSLLVYAWK  430



>ref|XP_004138846.1| PREDICTED: uncharacterized protein LOC101205493 [Cucumis sativus]
Length=300

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEAYAKT+A    N Q+LVLKRE V   K+Y+TKA +GG+ R I IDC    DD  
Sbjct  102  GDLVKEAYAKTKALKPKNPQSLVLKREQVVAHKIYSTKAKIGGRIRDIQIDCGY-NDDTR  160

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFE  391
            L F+ DD KVL+IKHLKWKFRGNE+++VEG P+Q+SWDV++W+F D++D G+A+F F+F+
Sbjct  161  LCFAFDDVKVLEIKHLKWKFRGNEKVDVEGIPVQISWDVYNWVFGDEKDHGHAIFMFRFD  220

Query  390  KQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVME  211
            +                    G+   ++      +R S SSSS S+SS  +S+  +SV++
Sbjct  221  EDD-----EELRTETPSFQRNGMEHWSINNHSRRMRMSSSSSSLSMSSVGSSAGSSSVLD  275

Query  210  WESAEENEL-KDPPGFSLLVYAWK  142
            W + EE+EL   P  FSLLVYAWK
Sbjct  276  WTTVEESELGGGPSTFSLLVYAWK  299



>ref|XP_004160786.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230499 
[Cucumis sativus]
Length=300

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEAYAKT+A    N Q+LVLKRE V   K+Y+TKA +GG+ R I IDC    DD  
Sbjct  102  GDLVKEAYAKTKALKPKNPQSLVLKREQVVAHKIYSTKAKIGGRIRDIQIDCGY-NDDTR  160

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFE  391
            L F+ DD KVL+IKHLKWKFRGNE+++VEG P+Q+SWDV++W+F D++D G+A+F F+F+
Sbjct  161  LCFAFDDVKVLEIKHLKWKFRGNEKVDVEGIPVQISWDVYNWVFGDEKDHGHAIFMFRFD  220

Query  390  KQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVME  211
            +                    G+   ++      +R S SSSS S+SS  +S+  +SV++
Sbjct  221  EDD-----EELRTETPSFQRNGMEHWSINNHSRRMRMSSSSSSLSMSSVGSSAGSSSVLD  275

Query  210  WESAEENEL-KDPPGFSLLVYAWK  142
            W + EE+EL   P  FSLLVYAWK
Sbjct  276  WTTVEESELGGGPSTFSLLVYAWK  299



>ref|XP_004291941.1| PREDICTED: uncharacterized protein LOC101293553 [Fragaria vesca 
subsp. vesca]
Length=352

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 132/209 (63%), Gaps = 11/209 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHA----GNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAG  580
            GD  KEAYAKTRA  A       Q LVLKREHV    +Y TKA +GG+ R I I+C    
Sbjct  147  GDLNKEAYAKTRANQAIDQSPQPQTLVLKREHVVAKNIYTTKAKLGGRIRDIQIECGHND  206

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALFT  403
            D   L FS+D+K+VLQIK LKWKFRGNERIEV+G P+ +SWDV++WLF++D  DG+A+F 
Sbjct  207  DFSRLSFSVDNKRVLQIKRLKWKFRGNERIEVDGVPMHISWDVYNWLFENDGNDGHAVFM  266

Query  402  FKFEK-QSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssc  226
            F+FE+ +         G   +       G   +  +K      +S SSSS+S +SA S  
Sbjct  267  FRFEEDEQDINTQLSVGHWAQQQQFWNFGMNGIEWRK----MGKSFSSSSVSMSSAGSCS  322

Query  225  tSVMEWESAEENELKD-PPGFSLLVYAWK  142
            +SVMEW + EE+E+   P GFSLLVYAW+
Sbjct  323  SSVMEWATMEESEVSAGPTGFSLLVYAWR  351



>gb|KGN62983.1| hypothetical protein Csa_2G382560 [Cucumis sativus]
Length=328

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEAYAKT+A    N Q+LVLKRE V   K+Y+TKA +GG+ R I IDC    DD  
Sbjct  130  GDLVKEAYAKTKALKPKNPQSLVLKREQVVAHKIYSTKAKIGGRIRDIQIDCGY-NDDTR  188

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFE  391
            L F+ DD KVL+IKHLKWKFRGNE+++VEG P+Q+SWDV++W+F D++D G+A+F F+F+
Sbjct  189  LCFAFDDVKVLEIKHLKWKFRGNEKVDVEGIPVQISWDVYNWVFGDEKDHGHAIFMFRFD  248

Query  390  KQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVME  211
            +                    G+   ++      +R S SSSS S+SS  +S+  +SV++
Sbjct  249  EDD-----EELRTETPSFQRNGMEHWSINNHSRRMRMSSSSSSLSMSSVGSSAGSSSVLD  303

Query  210  WESAEENEL-KDPPGFSLLVYAWK  142
            W + EE+EL   P  FSLLVYAWK
Sbjct  304  WTTVEESELGGGPSTFSLLVYAWK  327



>ref|XP_002324318.2| hypothetical protein POPTR_0018s02290g [Populus trichocarpa]
 gb|EEF02883.2| hypothetical protein POPTR_0018s02290g [Populus trichocarpa]
Length=401

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEA+AKT+A      Q LVL+REHV+G ++Y T+A  GG+ R ISIDC V  +D  
Sbjct  162  GDLTKEAFAKTKALKQERPQVLVLRREHVFGNRVYTTRARFGGRNRVISIDCSV-NNDAR  220

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L FS+D+K+VLQIK LKWKFRGNERIEV+G PIQVSWDV++WLFD   + +A+F F+FE 
Sbjct  221  LCFSVDNKRVLQIKRLKWKFRGNERIEVDGVPIQVSWDVYNWLFDGINNDHAVFMFRFES  280

Query  387  Q  385
             
Sbjct  281  N  281



>ref|XP_008445586.1| PREDICTED: uncharacterized protein LOC103488566 [Cucumis melo]
Length=328

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 133/204 (65%), Gaps = 8/204 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEAYAKT+A    N Q+LVLKRE V   K+Y+TKA +GG+ R I IDC    DD  
Sbjct  130  GDLVKEAYAKTKALKPKNPQSLVLKREQVVAHKIYSTKAKIGGRIRDIQIDCGY-NDDTR  188

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTFKFE  391
            L F+ DD KVL+IKHLKWKFRGNE+++VEG P+Q+SWD+++W+F D++D G+A+F F+F+
Sbjct  189  LCFAFDDVKVLEIKHLKWKFRGNEKVDVEGIPVQISWDIYNWVFGDEKDHGHAIFMFRFD  248

Query  390  KQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVME  211
            +                    G+   ++      +R S SSSS S+SS  +S+  +SV++
Sbjct  249  EDD-----EELRTETPSFPRNGMEHWSINNHSRRMRMSSSSSSLSMSSVGSSAGSSSVLD  303

Query  210  WESAEENEL-KDPPGFSLLVYAWK  142
            W + EE+EL   P  FSLLVYAWK
Sbjct  304  WATVEESELGGGPSTFSLLVYAWK  327



>ref|XP_007136970.1| hypothetical protein PHAVU_009G089200g [Phaseolus vulgaris]
 gb|ESW08964.1| hypothetical protein PHAVU_009G089200g [Phaseolus vulgaris]
Length=319

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 122/203 (60%), Gaps = 15/203 (7%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  ++AY+K+RA H    Q L+LK+EHV+  ++Y+T+A  GG+ R I IDC    D   
Sbjct  130  GDAARDAYSKSRAYHPTTPQLLLLKKEHVFADRVYSTRATFGGRAREIQIDCGFR-DHSK  188

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFKFE  391
            L FS+D +KVLQIK LKWKFRGNER+ V+G  +Q+SWD+++W FD ++ D +A+F FKFE
Sbjct  189  LSFSVDGEKVLQIKRLKWKFRGNERVVVDGVHVQISWDLYNWFFDKNNADAHAIFMFKFE  248

Query  390  KQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVME  211
            ++               +  C  G                SSSS  SS  +    +SV+E
Sbjct  249  EEEEEAVADRNLAGLWNLGVCEWG-------------KTWSSSSVSSSGGSFGGSSSVLE  295

Query  210  WESAEENELKDPPGFSLLVYAWK  142
            W S EENEL  P GFSLLVYAWK
Sbjct  296  WSSVEENELVVPVGFSLLVYAWK  318



>emb|CDX97072.1| BnaC09g45530D [Brassica napus]
Length=387

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAYA+ + A+   N QAL+L++EHV+G ++++TKA  GGK R ISIDCRV  +D 
Sbjct  151  GDSVKEAYARVKSAKPPTNPQALLLRKEHVFGARVFSTKARFGGKSREISIDCRV-DEDA  209

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTF  400
             L FS+D K+VLQIK L+WKFRGNE++E++G P+Q+SWDV++WLF      E G+A+F F
Sbjct  210  RLCFSVDSKQVLQIKRLRWKFRGNEKVEIDGVPVQISWDVYNWLFQSKSSGEGGHAVFMF  269

Query  399  KFE  391
            +FE
Sbjct  270  RFE  272



>emb|CDX69793.1| BnaA10g21420D [Brassica napus]
Length=376

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 93/122 (76%), Gaps = 5/122 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAY++ + A+   N QAL+L++EHV+G ++++TKA  GGK R ISIDCRV  +D 
Sbjct  152  GDSVKEAYSRVKSAKPPTNPQALLLRKEHVFGARVFSTKARFGGKSREISIDCRV-DEDA  210

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTF  400
             L FS+D K+VLQIK L+WKFRGNE++E++G P+Q+SWDV++WLF      E G+A+F F
Sbjct  211  RLSFSVDSKQVLQIKRLRWKFRGNEKVEIDGVPVQISWDVYNWLFQSKASGEGGHAVFMF  270

Query  399  KF  394
            +F
Sbjct  271  RF  272



>ref|XP_009122005.1| PREDICTED: uncharacterized protein LOC103846761 [Brassica rapa]
Length=441

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 93/122 (76%), Gaps = 5/122 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAY++ + A+   N QAL+L++EHV+G ++++TKA  GGK R ISIDCRV  +D 
Sbjct  205  GDSVKEAYSRVKSAKPPTNPQALLLRKEHVFGARVFSTKARFGGKSREISIDCRV-DEDA  263

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD---EDGYALFTF  400
             L FS+D K+VLQIK L+WKFRGNE++E++G P+Q+SWDV++WLF      E G+A+F F
Sbjct  264  RLCFSVDSKQVLQIKRLRWKFRGNEKVEIDGVPVQISWDVYNWLFQSKASGEGGHAVFMF  323

Query  399  KF  394
            +F
Sbjct  324  RF  325



>ref|XP_006399599.1| hypothetical protein EUTSA_v10015286mg [Eutrema salsugineum]
 gb|ESQ41052.1| hypothetical protein EUTSA_v10015286mg [Eutrema salsugineum]
Length=387

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAYA+ + A+   N QAL+L++EHV+G ++++TKA  GGK R ISIDCRV  +D 
Sbjct  153  GDSVKEAYARAKEAKPPTNPQALLLRKEHVFGARVFSTKARFGGKSREISIDCRV-DEDA  211

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED---GYALFTF  400
             L F++D K+VLQIK L+WKFRGNE++E++G P+Q+SWDV++WLF        G+A+F F
Sbjct  212  RLCFNVDSKQVLQIKRLRWKFRGNEKVEIDGVPVQISWDVYNWLFQSKSSGDGGHAVFMF  271

Query  399  KFE  391
            +FE
Sbjct  272  RFE  274



>ref|XP_010541582.1| PREDICTED: uncharacterized protein LOC104815002 [Tarenaya hassleriana]
 ref|XP_010541584.1| PREDICTED: uncharacterized protein LOC104815002 [Tarenaya hassleriana]
Length=376

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 91/136 (67%), Gaps = 14/136 (10%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEAYA+TRA      QAL+L+REHV G +++ TKA +GG+ R ISIDC+ A +D  
Sbjct  138  GDAVKEAYARTRAGRPTIPQALILRREHVVGNRVFCTKARIGGRNREISIDCQ-ANEDAR  196

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY---------  415
            L F +D K+VLQIK L+WKFRGNERIEV+G P+Q+SWDV++WLF++              
Sbjct  197  LCFGIDSKRVLQIKRLRWKFRGNERIEVDGVPVQISWDVYNWLFENKPAVNDVNGNGNCN  256

Query  414  ----ALFTFKFEKQSV  379
                A+F F+FE   V
Sbjct  257  GGGDAVFMFRFETDPV  272



>ref|XP_003527779.1| PREDICTED: uncharacterized protein LOC100783731 [Glycine max]
Length=333

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 5/127 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  K+A++K++ARH    Q L+LK+EHV+  +LY T+A  GGK R I IDC    D   
Sbjct  140  GDSTKDAFSKSKARHPNTPQLLLLKKEHVFADRLYTTRATFGGKAREIQIDCGY-HDHSR  198

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDE----DGYALFTF  400
            L FS+D +KVLQIK LKWKFRGNER++V+G  +Q+SWD+++WLFD +     D +A+F F
Sbjct  199  LCFSVDGEKVLQIKRLKWKFRGNERVQVDGVHVQISWDLYNWLFDKNNNSAADAHAIFMF  258

Query  399  KFEKQSV  379
            KFE+  V
Sbjct  259  KFEEDEV  265



>ref|XP_010519647.1| PREDICTED: uncharacterized protein LOC104799041 [Tarenaya hassleriana]
Length=389

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 91/133 (68%), Gaps = 11/133 (8%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  +EAYA+T+A      QALVL+REH++G ++  TKA +GG+ R ISIDCR+  +D  
Sbjct  155  GDAVREAYARTKAGRPTIPQALVLRREHMFGNRVLCTKAKIGGRNREISIDCRI-DEDAR  213

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED----------G  418
            L F +D K+VLQIK L+WKFRGNE IEV+G P+QVSWDV++WLF++             G
Sbjct  214  LCFGVDSKRVLQIKRLRWKFRGNENIEVDGVPVQVSWDVYNWLFENKTTATVDGNGNGGG  273

Query  417  YALFTFKFEKQSV  379
             A+F F+FE   V
Sbjct  274  QAVFIFRFETDPV  286



>ref|XP_006289029.1| hypothetical protein CARUB_v10002414mg [Capsella rubella]
 gb|EOA21927.1| hypothetical protein CARUB_v10002414mg [Capsella rubella]
Length=390

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 93/125 (74%), Gaps = 7/125 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAYA+ + A+ + N QAL+L++EHV+G +++ TKA  GGK R ISIDCRV  +D 
Sbjct  150  GDSVKEAYARAKSAKPSTNPQALLLRKEHVFGARVFTTKARFGGKNREISIDCRV-DEDA  208

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-----DDEDGYALF  406
             L FS+D K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF      D   G+A+F
Sbjct  209  KLCFSVDSKQVLQIKRLRWKFRGNEKVEIDGVHVQISWDVYNWLFQSKNSGDGGGGHAVF  268

Query  405  TFKFE  391
             F+FE
Sbjct  269  MFRFE  273



>ref|XP_010265675.1| PREDICTED: uncharacterized protein LOC104603360 [Nelumbo nucifera]
Length=376

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = -2

Query  747  GDCQKEAY-AKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD Q+ AY      R     Q L+ +REHV+G K+Y T+A  GG+ R ISIDC V GD+P
Sbjct  151  GDLQRAAYDRTKTRRPKRRNQVLISRREHVFGNKVYTTRARFGGRTRDISIDCSVGGDEP  210

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDD-EDGYALF  406
             L F +D K+VL IK LKWKFRGNERIEV+G PIQVSWDV++WLFD   EDG+A+F
Sbjct  211  RLCFGVDKKRVLLIKRLKWKFRGNERIEVDGIPIQVSWDVYNWLFDGGVEDGHAVF  266



>ref|XP_010050838.1| PREDICTED: uncharacterized protein LOC104439472 [Eucalyptus grandis]
Length=331

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHA-GNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEA+A+T+AR    + QALVL+REHV G + +AT A  GG++R ISIDC     D 
Sbjct  111  GDRPKEAHARTKARGPERSSQALVLRREHVIGRRAFATAARFGGRDREISIDC-TTDADA  169

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFE  391
             L F +D K+VLQ+K LKWKFRG ER+EV+G P+QVSWDV+SWLF+    G+A+F F+F+
Sbjct  170  RLCFEVDGKRVLQVKRLKWKFRGCERVEVDGVPMQVSWDVYSWLFEGFRYGHAVFMFRFD  229

Query  390  K  388
            K
Sbjct  230  K  230



>ref|XP_010453134.1| PREDICTED: uncharacterized protein LOC104735112 [Camelina sativa]
Length=396

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 92/129 (71%), Gaps = 11/129 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAYA+T+ A+   N QAL+L++EHV+G +++ TKA  GGK R ISIDCRV  +D 
Sbjct  150  GDSVKEAYARTKSAKPPTNPQALLLRKEHVFGARVFTTKARFGGKNREISIDCRV-DEDA  208

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED---------G  418
             L FS+D K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF              G
Sbjct  209  KLCFSVDSKQVLQIKRLRWKFRGNEKVEIDGVNVQISWDVYNWLFQSKSSGDGGGGGGGG  268

Query  417  YALFTFKFE  391
            +A+F F+FE
Sbjct  269  HAVFMFRFE  277



>ref|XP_002873490.1| hypothetical protein ARALYDRAFT_909057 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49749.1| hypothetical protein ARALYDRAFT_909057 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 9/127 (7%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAYA+ + A+   N QAL+L++EHV+G +++ TKA  GGK R ISIDCRV  +D 
Sbjct  149  GDSVKEAYARAKSAKPPTNPQALLLRKEHVFGARVFTTKARFGGKNREISIDCRV-DEDA  207

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-------GYA  412
             L FS+D K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF            G+A
Sbjct  208  KLCFSVDSKQVLQIKRLRWKFRGNEKVEIDGVQVQISWDVYNWLFQSKNSGDGGGGGGHA  267

Query  411  LFTFKFE  391
            +F F+FE
Sbjct  268  VFMFRFE  274



>ref|NP_196661.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB96855.1| putative protein [Arabidopsis thaliana]
 gb|AAL15307.1| AT5g11000/T30N20_270 [Arabidopsis thaliana]
 gb|AAM51579.1| AT5g11000/T30N20_270 [Arabidopsis thaliana]
 gb|AAM63680.1| unknown [Arabidopsis thaliana]
 gb|AED91619.1| uncharacterized protein AT5G11000 [Arabidopsis thaliana]
Length=389

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 9/127 (7%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAYA+ + A+   N QAL+L++EHV+G +++ TKA  GGK R ISIDCRV  +D 
Sbjct  149  GDSVKEAYARAKSAKPPTNPQALLLRKEHVFGARVFTTKARFGGKNREISIDCRV-DEDA  207

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-------GYA  412
             L FS+D K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF            G+A
Sbjct  208  KLCFSVDSKQVLQIKRLRWKFRGNEKVEIDGVHVQISWDVYNWLFQSKSSGDGGGGGGHA  267

Query  411  LFTFKFE  391
            +F F+FE
Sbjct  268  VFMFRFE  274



>ref|XP_010419653.1| PREDICTED: uncharacterized protein LOC104705366 [Camelina sativa]
Length=395

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 92/125 (74%), Gaps = 7/125 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAYA+ + A+   N QAL+L++EHV+G +++ TKA  GGK R ISIDCRV  +D 
Sbjct  151  GDSVKEAYARAKSAKPPTNPQALLLRKEHVFGARVFTTKARFGGKNREISIDCRV-DEDA  209

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-----DDEDGYALF  406
             L FS+D K+VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF      D   G+A+F
Sbjct  210  KLCFSVDSKQVLQIKRLRWKFRGNEKVEIDGVNVQISWDVYNWLFQSKSSGDGGGGHAVF  269

Query  405  TFKFE  391
             F+FE
Sbjct  270  MFRFE  274



>ref|XP_010050717.1| PREDICTED: uncharacterized protein LOC104439337 [Eucalyptus grandis]
Length=357

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = -2

Query  741  CQKEAYAKTRARHA-GNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGL  565
             ++EA+A+T+AR      QAL+L+REHV G + +AT A  GG++R ISIDC     D  L
Sbjct  139  ARREAHARTKARGPERRAQALILRREHVIGRRAFATAARFGGRDREISIDC-TTDADARL  197

Query  564  VFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
             F +D K+VLQ+K LKWKFRG ER+EV+G P+QVSWDV+SWLF+    G+A+F F+F+K
Sbjct  198  CFEVDGKRVLQVKRLKWKFRGCERVEVDGVPMQVSWDVYSWLFEGFRYGHAVFMFRFDK  256



>ref|XP_010491790.1| PREDICTED: uncharacterized protein LOC104769314 [Camelina sativa]
Length=392

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 90/126 (71%), Gaps = 8/126 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTR-ARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAYA+ + A+   N QAL+L++EHV+G +++ TKA  GGK R ISIDCRV  +D 
Sbjct  150  GDSVKEAYARAKSAKPPTNPQALLLRKEHVFGARVFTTKARFGGKNREISIDCRV-DEDA  208

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED------GYAL  409
             L FS+D K VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF           G+A+
Sbjct  209  KLCFSVDSKLVLQIKRLRWKFRGNEKVEIDGVNVQISWDVYNWLFQSKNSGDGGGGGHAV  268

Query  408  FTFKFE  391
            F F+FE
Sbjct  269  FMFRFE  274



>emb|CDX85733.1| BnaA02g00800D [Brassica napus]
Length=343

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 130/209 (62%), Gaps = 19/209 (9%)
 Frame = -2

Query  717  TRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKV  538
            TR +   N QALV+++EHV+GG ++ATKA  GGK R I IDC V  +D  L FS+D +KV
Sbjct  134  TRVKSPANRQALVMRKEHVFGGSVFATKARFGGKNREIKIDCCV-DEDARLCFSVDSEKV  192

Query  537  LQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVgedgggg  358
            L++K L+WKFRGNER+E++G  +Q+SWDV++WLF     G+ +F F+FE      +G G 
Sbjct  193  LEVKRLRWKFRGNERVEIDGVAVQISWDVYNWLFQGKGLGHGVFMFRFESDPEEREGSGN  252

Query  357  gfrgkmvnGCGLGFETML----MKKGLlrssr---sssssslsstsasssctSVMEW-ES  202
                     CG GF+ M+    M++  ++S R   SSS S   S+++S+  +SV+EW  S
Sbjct  253  DVVLWKPRKCGSGFKGMVEWRKMRRRFVKSKRSSSSSSLSMSMSSASSACSSSVLEWASS  312

Query  201  AEENEL----------KDPPGFSLLVYAW  145
            A+E+E            +  GFSLLVYAW
Sbjct  313  ADESEYGGGGSSGLGSGNGLGFSLLVYAW  341



>emb|CDY51100.1| BnaCnng20030D [Brassica napus]
Length=340

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 123/206 (60%), Gaps = 17/206 (8%)
 Frame = -2

Query  714  RARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVL  535
            R +     QALV+++EHV+GG ++ TKA  GGK R I IDC V  +D  L FS+D K VL
Sbjct  134  RVKSPAKPQALVMRKEHVFGGSVFTTKARFGGKNREIKIDCCV-DEDARLCFSVDSKTVL  192

Query  534  QIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVgedggggg  355
            ++K L+WKFRGNER+E++G  +Q+SWDV++WLF     G+A+F F+FE       G G  
Sbjct  193  EVKRLRWKFRGNERVEIDGVAVQISWDVYNWLFQGKGLGHAVFMFRFESDPEERVGNGND  252

Query  354  frgkmvnGCGLGFETM-----LMKKGLlrssrsssssslsstsasssctSVMEW-ESAEE  193
                    CG GF+ M     + ++ +     SSSSS   S+++S+  +SV+EW  SA+E
Sbjct  253  VVLWKRRKCGSGFKGMVEWRKMRRRFVKSKRSSSSSSMSMSSASSACSSSVLEWASSADE  312

Query  192  NEL----------KDPPGFSLLVYAW  145
            +E            +  GFSLLVYAW
Sbjct  313  SEYGGGGSSGLGSGNGLGFSLLVYAW  338



>ref|XP_009125261.1| PREDICTED: uncharacterized protein LOC103850289 [Brassica rapa]
Length=343

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 130/219 (59%), Gaps = 24/219 (11%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GDC        R +   N QALV+++EHV+GG ++ATKA  GGK R I IDC V  +D  
Sbjct  129  GDC-----GDARVKSPANRQALVMRKEHVFGGSVFATKARFGGKNRAIKIDCCV-DEDAR  182

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            L F +D K VL++K L+WKFRGNER+E++G  +Q+SWDV++WLF     G+ +F F+FE 
Sbjct  183  LCFCVDSKMVLEVKRLRWKFRGNERVEIDGVAVQISWDVYNWLFQGKSLGHGVFMFRFES  242

Query  387  QSVgedgggggfrgkmvnGCGLGFETML----MKKGLlrssr---sssssslsstsasss  229
                 +G G          CG GF+ M+    M++  ++S R   SSS S   S+++S+ 
Sbjct  243  DPEEREGSGNDVVLWKPRKCGSGFKGMVEWRKMRRRFVKSKRSSSSSSLSMSMSSASSAC  302

Query  228  ctSVMEW-ESAEENEL----------KDPPGFSLLVYAW  145
             +SV+EW  SA+E+E            +  GFSLLVYAW
Sbjct  303  SSSVLEWASSADESEYGGGGSSGLGSGNGLGFSLLVYAW  341



>gb|KFK25379.1| hypothetical protein AALP_AA8G105700 [Arabis alpina]
Length=377

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRA-RHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDP  571
            GD  KEAY + ++ +   N QAL+L++EHV+G +++ TKA  GGK R +SIDCRV  +D 
Sbjct  144  GDSIKEAYTRVKSVKPPMNRQALLLRKEHVFGARVFTTKARFGGKNRELSIDCRV-DEDA  202

Query  570  GLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD------DDEDGYAL  409
             L FS+D K VLQIK L+WKFRGNE++E++G  +Q+SWDV++WLF           G+A+
Sbjct  203  KLCFSVDSKMVLQIKRLRWKFRGNEKVEIDGVVVQISWDVYNWLFQRGGDGGSGGGGHAV  262

Query  408  FTFKFE  391
            F F+FE
Sbjct  263  FMFRFE  268



>ref|XP_004145513.1| PREDICTED: uncharacterized protein LOC101215936, partial [Cucumis 
sativus]
Length=270

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 129/210 (61%), Gaps = 13/210 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNG-QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAG---  580
            GD  KEA  K RA       Q L+LKREHV   K+Y TKA   G+ R I IDC  +    
Sbjct  65   GDMVKEASKKIRAAKPPQVLQTLILKREHVTAHKVYTTKAKFAGQIREIQIDCGFSNYND  124

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED--GYALF  406
            DD GL FS+D K+VL+IK LKWKFRGNERIEV G P+ V WDV++W+F+ +++  G A+F
Sbjct  125  DDLGLSFSVDGKRVLEIKRLKWKFRGNERIEVAGVPMDVYWDVYNWVFELEKESRGNAVF  184

Query  405  TFKFEKQSVgedgggggfrgkmvnGCGLG-FETMLMKKGLlrssrsssssslsstsasss  229
             F+FE+++            +     GL   E   M+  L  SS S S+S+ S  S++ +
Sbjct  185  MFRFEEEN-----EEQSSNQQQNWNLGLNELEWRRMRNSLSSSSISFSTSTSSVGSSAGA  239

Query  228  ctSVMEWESAEE-NELKDPPGFSLLVYAWK  142
             +SVMEW ++E+ +++  P GFSLL+YAW+
Sbjct  240  SSSVMEWANSEDSDQIGAPLGFSLLIYAWR  269



>emb|CDP18790.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 128/225 (57%), Gaps = 46/225 (20%)
 Frame = -2

Query  723  AKTRARHAGNGQALVLKREHVYGGK---LYATKANVGGKERRI--SIDCRVAGDD--PGL  565
            AK  A      Q +VL+REHVYG K    Y T+AN+GG ++ I  SID R  G +  P L
Sbjct  168  AKETAAAEIRNQVMVLRREHVYGNKKRLYYTTRANIGGGQQEIDVSIDYRAMGGEGGPTL  227

Query  564  VFSMDDKKVLQIKHLKWKFRGNERIEVEG--FPIQVSWDVHSWLFDDDED-----GYALF  406
             FS+  ++VLQ+KHLKWKFRGNER+E +    P+QVSWDV++WLF  D+D      +ALF
Sbjct  228  CFSIAGQRVLQVKHLKWKFRGNERVEGDDGIPPVQVSWDVYNWLFVQDDDHELTNAHALF  287

Query  405  TFKFEKQSVgedgggggfrgkmvnGCG----LGFETMLMKKG------------Llrssr  274
             FKFEK+                  CG    +GFET   KK             +     
Sbjct  288  MFKFEKKP---------------GDCGGLNLIGFETKKKKKKTTTTMMMKKGFKMRSGRS  332

Query  273  sssssslsstsasssctSVMEWESAEENELKDPP-GFSLLVYAWK  142
             SSSS  S +S+S+S +SVMEW S EENELK  P GFSL+VYAW 
Sbjct  333  WSSSSLSSVSSSSNSTSSVMEWASVEENELKGGPCGFSLVVYAWN  377



>ref|XP_008452874.1| PREDICTED: uncharacterized protein LOC103493769 [Cucumis melo]
Length=347

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 127/210 (60%), Gaps = 14/210 (7%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNG-QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAG---  580
            GD  KEA  K RA       Q L+LKREHV   K+Y TKA   G+ R I IDC  +    
Sbjct  143  GDMIKEASKKIRAAKPPQVLQTLILKREHVTAHKIYTTKAKFAGQIREIQIDCGFSNYND  202

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED--GYALF  406
            DD GL FS+D K+VL+IK LKWKFRGNERIEV G  + V WDV++W+F+ +++  G A+F
Sbjct  203  DDLGLSFSVDGKRVLEIKRLKWKFRGNERIEVAGVQMDVYWDVYNWVFELEKENRGNAVF  262

Query  405  TFKFEKQSVgedgggggfrgkmvnGCGLG-FETMLMKKGLlrssrsssssslsstsasss  229
             F+FE++             +     GL   E   M+  L  SS S S+S+ S  S++ +
Sbjct  263  MFRFEEE------IEEQSNQQQNWNLGLNELEWRRMRSSLSSSSISFSTSTSSVGSSAGA  316

Query  228  ctSVMEWESAEE-NELKDPPGFSLLVYAWK  142
             +SVMEW ++E+ +++  P GFSLL+YAW+
Sbjct  317  SSSVMEWANSEDSDQIGAPLGFSLLIYAWR  346



>gb|KGN55450.1| hypothetical protein Csa_4G652140 [Cucumis sativus]
Length=351

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 129/210 (61%), Gaps = 13/210 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNG-QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAG---  580
            GD  KEA  K RA       Q L+LKREHV   K+Y TKA   G+ R I IDC  +    
Sbjct  146  GDMVKEASKKIRAAKPPQVLQTLILKREHVTAHKVYTTKAKFAGQIREIQIDCGFSNYND  205

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED--GYALF  406
            DD GL FS+D K+VL+IK LKWKFRGNERIEV G P+ V WDV++W+F+ +++  G A+F
Sbjct  206  DDLGLSFSVDGKRVLEIKRLKWKFRGNERIEVAGVPMDVYWDVYNWVFELEKESRGNAVF  265

Query  405  TFKFEKQSVgedgggggfrgkmvnGCGLG-FETMLMKKGLlrssrsssssslsstsasss  229
             F+FE+++            +     GL   E   M+  L  SS S S+S+ S  S++ +
Sbjct  266  MFRFEEENE-----EQSSNQQQNWNLGLNELEWRRMRNSLSSSSISFSTSTSSVGSSAGA  320

Query  228  ctSVMEWESAEE-NELKDPPGFSLLVYAWK  142
             +SVMEW ++E+ +++  P GFSLL+YAW+
Sbjct  321  SSSVMEWANSEDSDQIGAPLGFSLLIYAWR  350



>gb|KCW80312.1| hypothetical protein EUGRSUZ_C01671, partial [Eucalyptus grandis]
Length=200

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = -2

Query  687  ALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQIKHLKWKF  508
            AL+L+REHV G + +AT A  GG++R ISIDC     D  L F +D K+VLQ+K LKWKF
Sbjct  1    ALILRREHVIGRRAFATAARFGGRDREISIDC-TTDADARLCFEVDGKRVLQVKRLKWKF  59

Query  507  RGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEK  388
            RG ER+EV+G P+QVSWDV+SWLF+    G+A+F F+F+K
Sbjct  60   RGCERVEVDGVPMQVSWDVYSWLFEGFRYGHAVFMFRFDK  99



>ref|XP_007161151.1| hypothetical protein PHAVU_001G046800g [Phaseolus vulgaris]
 gb|ESW33145.1| hypothetical protein PHAVU_001G046800g [Phaseolus vulgaris]
Length=334

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 120/216 (56%), Gaps = 50/216 (23%)
 Frame = -2

Query  690  QALVLKREHVY----GGKLYATKANVGGKERRISIDCRVAGDDPG---LVFSMDDKKVLQ  532
            Q L+LKR+HV+      ++Y TK  +GGK R I IDC    ++     LVFS+D++KVL+
Sbjct  135  QVLLLKRDHVHVASHRSRVYQTKTILGGKVREIQIDCDAYSNEDESLRLVFSVDEEKVLE  194

Query  531  IKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED--------------------GYA  412
            +  LKWKFRG+ER+EV+G  +Q+SWDVH WLF+ D+D                    G+A
Sbjct  195  VTRLKWKFRGSERVEVDGAHVQISWDVHDWLFEKDKDHGFSNISNDVNGNSDGGKNEGHA  254

Query  411  LFTFKFEKQSVgedgggggfrgkmvnGCGLGFETMLM------KKGLlrssrssssssls  250
            +F FKFE   V               GCG G E  ++      K G  +S  SSS S  S
Sbjct  255  VFMFKFENDEV---------------GCGSGKEVDVVWSSGEWKNG--KSWSSSSLSVSS  297

Query  249  stsasssctSVMEWESAEENELKDPPGFSLLVYAWK  142
            S  +    +SVMEW S EENEL  P GFSL+VYAW+
Sbjct  298  SVGSFGGSSSVMEWSSLEENELVVPFGFSLVVYAWR  333



>ref|XP_003549308.1| PREDICTED: putative uncharacterized protein DDB_G0282499-like 
[Glycine max]
 gb|KHN22514.1| hypothetical protein glysoja_036218 [Glycine soja]
Length=340

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 119/215 (55%), Gaps = 37/215 (17%)
 Frame = -2

Query  693  GQALVLKREHVY----GGKLYATKANVGGKERRISIDCRVAG---------DDPGLVFSM  553
             Q LVLKR++V+      ++Y TKA +GGK R I IDC V           +   L+FS+
Sbjct  131  NQLLVLKRDNVHVAPHRSRVYQTKAKLGGKVREIEIDCDVYNCGGYGYENENSSRLLFSV  190

Query  552  DDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED----------------  421
            D +KVL++  LKWKFRG+ER+E++G  +Q+SWDVH WLF+ D+D                
Sbjct  191  DGEKVLEVARLKWKFRGSERVEIDGVHVQISWDVHDWLFEKDKDIVNHRSSNNNNSNNNG  250

Query  420  --GYALFTFKFEKQSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslss  247
              G+A+F FKFE+  V   GGG     +   G G  +      +     S SS S S +S
Sbjct  251  IEGHAVFMFKFEEDEVRGSGGGKEEEQQWSMGSGGEW------RNGKSWSSSSLSVSSTS  304

Query  246  tsasssctSVMEWESAEENELKDPPGFSLLVYAWK  142
              +    +SVMEW S EENEL  P GFSL+VYAW+
Sbjct  305  GGSFGGSSSVMEWSSVEENELVVPLGFSLVVYAWR  339



>emb|CBI26241.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A         V K+EH++G KLY TKA     G+   +SI+C   G D
Sbjct  95   GDMRKEAFKKTNATPGFYNAIFVSKKEHIFGKKLYGTKAQFWDNGQNHNLSIECDTVGTD  154

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+KHL+WKFRGN+ I ++G P++V WDVH+WLF     G A+F F+
Sbjct  155  DPFLAIRIDSKMVMQVKHLRWKFRGNQTILIDGLPVEVFWDVHNWLFGPSV-GNAVFMFQ  213



>ref|XP_009407751.1| PREDICTED: uncharacterized protein LOC103990370 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407752.1| PREDICTED: uncharacterized protein LOC103990370 [Musa acuminata 
subsp. malaccensis]
Length=287

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  KEAY KT A  + +    + KREH+YG K+Y+TKA     G+   ++I+C   G  
Sbjct  132  GDLTKEAYRKTNASPSPSNAVFIAKREHIYGKKVYSTKAQFCDNGQSHEVAIECDTIGLK  191

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K+V+QIK L WKFRGN+ I ++G P++V WDVHSWLF     G A+F F+
Sbjct  192  DPYLEIRIDRKRVMQIKRLAWKFRGNQTILIDGLPVEVFWDVHSWLFGPS-SGNAVFMFQ  250



>ref|XP_010417285.1| PREDICTED: uncharacterized protein LOC104703050 [Camelina sativa]
Length=373

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 108/199 (54%), Gaps = 34/199 (17%)
 Frame = -2

Query  690  QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQIKHLKWK  511
            Q LV KRE+++G ++Y+TK  + GK R ISID +V  DD  L FS+DDK VL+I  L+WK
Sbjct  192  QVLVSKRENLFGNRVYSTKIKIQGKLRDISIDVKVVNDDASLRFSVDDKSVLKINQLQWK  251

Query  510  FRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQSVgedgggggfrg  346
            FRGN +I ++G  IQ+SWDV++WLF D      +   A+F  +FE Q V           
Sbjct  252  FRGNTKIVIDGVTIQISWDVYNWLFGDKDKVKPDKTPAVFLLRFENQEVE----------  301

Query  345  kmvnGCGLGFETMLMKKGLlrssrsssssslssts--------asssctSVMEWESAEEN  190
                    G + ++M K +  +      +S + +         +SS  +SVMEW S  E 
Sbjct  302  --------GNDALMMNKRVRDNVVLRKENSPTPSFWETSYGHWSSSRMSSVMEWSSCREE  353

Query  189  ELKD---PPGFSLLVYAWK  142
            + +       FSL++YAW+
Sbjct  354  DERSFGCKSWFSLVIYAWR  372



>ref|XP_010649892.1| PREDICTED: uncharacterized protein LOC100246068 [Vitis vinifera]
Length=300

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A         V K+EH++G KLY TKA     G+   +SI+C   G D
Sbjct  134  GDMRKEAFKKTNATPGFYNAIFVSKKEHIFGKKLYGTKAQFWDNGQNHNLSIECDTVGTD  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+KHL+WKFRGN+ I ++G P++V WDVH+WLF     G A+F F+
Sbjct  194  DPFLAIRIDSKMVMQVKHLRWKFRGNQTILIDGLPVEVFWDVHNWLFGPSV-GNAVFMFQ  252



>gb|KEH39864.1| DUF868 family protein [Medicago truncatula]
Length=328

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 107/198 (54%), Gaps = 35/198 (18%)
 Frame = -2

Query  690  QALVLKREHV------YGGKLYATKANVGGKERRISI----DCR--VAGDDPGLVFSMDD  547
            Q LVLK+EHV       G   YATK   GGK R + I    DC     G++  L+FS+D 
Sbjct  148  QILVLKKEHVDMEVNRNGSSSYATKTRFGGKVREVEIEIGSDCDDDNKGNNTRLLFSVDG  207

Query  546  KKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD---DEDGYALFTFKFEKQSVg  376
            ++VL+++ LKWKFRGNER+E++G  + + WDVH WLF++   D DG+A+F FKFE+  V 
Sbjct  208  ERVLEVRKLKWKFRGNERVEIDGVSVLICWDVHDWLFENGGSDGDGHAVFMFKFEENEV-  266

Query  375  edgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslsstsasssctSVMEWESAE  196
                           CG        +         SSSS   S+++     SV EW S E
Sbjct  267  ------------GGCCG-------ERSEFGSCKSWSSSSLSMSSNSVGGSCSVTEWSSFE  307

Query  195  ENELKDPPGFSLLVYAWK  142
            E+E   P GFSL VYAW+
Sbjct  308  ESEFLVPLGFSLFVYAWR  325



>emb|CAN68226.1| hypothetical protein VITISV_040533 [Vitis vinifera]
Length=300

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A         V K+EH++G KLY TKA     G+   +SI+C   G D
Sbjct  134  GDMRKEAFKKTNATPGFYNAIFVSKKEHIFGKKLYGTKAQFWDNGQNHNLSIECDTVGTD  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+KHL+WKFRGN+ I ++G P++V WDVH+WLF     G A+F F+
Sbjct  194  DPFLAIRIDSKMVMQVKHLRWKFRGNQTILIDGLPVEVFWDVHNWLFGPSV-GNAVFMFQ  252



>ref|XP_009402136.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402137.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402138.1| PREDICTED: uncharacterized protein LOC103986002 [Musa acuminata 
subsp. malaccensis]
Length=290

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            G+  KEAY +T AR   +   LV K EH+YG KLY+TKA     G+   ++I+C   G  
Sbjct  134  GNLIKEAYQRTNARPPPSSAVLVAKTEHIYGKKLYSTKAQFCDNGQFHDVAIECDTVGLK  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K+V+QIK L WKFRGN+ I V+G P++V WDVHSWLF     G A+F F+
Sbjct  194  DPCLEICIDKKRVMQIKRLAWKFRGNQTILVDGLPVEVFWDVHSWLF-GSPTGNAVFMFQ  252



>ref|XP_010910592.1| PREDICTED: uncharacterized protein LOC105036529 [Elaeis guineensis]
Length=290

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  KEAY KT A    +    + KREH+YG K+Y TKA     G+   I+I+C   G  
Sbjct  135  GDLTKEAYRKTSASPLPSSAVFIAKREHIYGKKIYCTKAQFCDNGQVHDIAIECETVGLK  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K+V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  195  DPTLEIRIDKKRVMQVKRLMWKFRGNQTILVDGLPVEVFWDVHNWLF-GAPTGNAVFMFQ  253



>ref|XP_006288375.1| hypothetical protein CARUB_v10001626mg [Capsella rubella]
 gb|EOA21273.1| hypothetical protein CARUB_v10001626mg [Capsella rubella]
Length=289

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  133  GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSADGKIHDLVIECDTSVTD  192

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  193  PCLVVRVDGKTMLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGLPSAGNAVFMFR  251



>ref|XP_008802684.1| PREDICTED: uncharacterized protein LOC103716457 [Phoenix dactylifera]
Length=289

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  KEAY KT A    +    + KREH+YG K+Y TKA     G+   I+I+C + G  
Sbjct  134  GDLSKEAYRKTGASPPPSSAVFIAKREHIYGKKIYCTKAQFCDNGQVHDIAIECEMVGLK  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K+V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  194  DPTLEIRIDKKRVMQVKRLVWKFRGNQTILVDGLPVEVFWDVHNWLF-GAPTGNAVFMFQ  252



>ref|XP_006395009.1| hypothetical protein EUTSA_v10004720mg [Eutrema salsugineum]
 gb|ESQ32295.1| hypothetical protein EUTSA_v10004720mg [Eutrema salsugineum]
Length=288

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  133  GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLCADGKIHDLVIECDTSVTD  192

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            P L+  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  193  PCLIVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFAMPSAGNAVFMFR  251



>ref|XP_006838233.1| hypothetical protein AMTR_s00103p00021650 [Amborella trichopoda]
 gb|ERN00802.1| hypothetical protein AMTR_s00103p00021650 [Amborella trichopoda]
Length=301

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  K+AY KT AR        V KREH++G ++Y TKA     G+   +SI+C   G  
Sbjct  132  GDLSKDAYRKTNARPPSFNPVFVAKREHIFGKRVYFTKAQFCNNGQSHDVSIECDTVGVK  191

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L   +D K VLQ+K L WKFRGN  I V+G P++V WDVH+WLF     G A+F FK
Sbjct  192  EPSLSIRIDKKMVLQVKQLVWKFRGNHTILVDGLPVEVYWDVHNWLFSQTM-GSAVFMFK  250



>ref|XP_002872306.1| hypothetical protein ARALYDRAFT_489643 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48565.1| hypothetical protein ARALYDRAFT_489643 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  133  GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLCADGKIHDLLIECDTSVTD  192

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  193  PCLVVRVDGKTLLQVKRLKWKFRGNDTIIVNRMAVEVLWDVHSWLFGLPPAGNAVFMFR  251



>ref|XP_010277409.1| PREDICTED: uncharacterized protein LOC104611862 [Nelumbo nucifera]
 ref|XP_010277418.1| PREDICTED: uncharacterized protein LOC104611862 [Nelumbo nucifera]
Length=298

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD  KEAY KT A    +    V KREH++G +LY TKA     G+   ++I+C  V  +
Sbjct  132  GDLSKEAYKKTNAAPVPSNAIFVAKREHIFGKRLYGTKAQFCDNGQIHDVTIECDTVNLN  191

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  192  DPCLLIRIDSKTVMQVKRLRWKFRGNQTILVDGLPVEVFWDVHNWLF-GPALGSAVFMFQ  250



>ref|XP_008804337.1| PREDICTED: uncharacterized protein LOC103717650 [Phoenix dactylifera]
Length=288

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  KEAY KT A    +    + +REH+YG  +Y TKA     G+   I+I+C   G  
Sbjct  133  GDLTKEAYRKTSATPPPSNALFIARREHIYGKNVYCTKAQFCDNGQVHDIAIECETVGLR  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K+V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  193  DPSLEIRIDKKRVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHNWLF-GPTTGNAVFMFQ  251



>ref|XP_010256015.1| PREDICTED: uncharacterized protein LOC104596517 [Nelumbo nucifera]
Length=298

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  KEAY KT A    +    + KREH++G ++Y TKA     G+   ++I+C   G +
Sbjct  132  GDLSKEAYKKTSAAPVPSSAIFIAKREHIFGKRVYGTKAQFCDNGQIHDVTIECDTVGLN  191

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  192  DPCLLIRIDTKTVMQVKRLRWKFRGNQTILVDGLPVEVFWDVHNWLF-GPALGSAVFMFQ  250



>ref|XP_010923391.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
 ref|XP_010923392.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
 ref|XP_010923393.1| PREDICTED: uncharacterized protein LOC105046501 [Elaeis guineensis]
Length=288

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  KEAY KT A    +    + +REH+YG  +Y TKA     G+   I+I+C   G  
Sbjct  133  GDLTKEAYRKTSASPPPSNAVFIARREHIYGKNVYCTKAQFCDNGQVHDIAIECETVGLK  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K+V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF     G A+F F+
Sbjct  193  DPSLEIRIDKKRVMQVKRLGWKFRGNQTILVDGLPVEVFWDVHNWLF-GTPTGNAVFMFQ  251



>emb|CDP03641.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD QKE Y K       +    + KREH++G ++Y TKA     G    I I+C   G +
Sbjct  113  GDLQKEVYKKIGTSPVASNTVFIAKREHIFGKRVYTTKAQFCDHGPIHDIEIECDTGGIN  172

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L  S+D + VLQ+K L+WKFRGNE I V+G P++V WDVHSW F +   G A+F F+
Sbjct  173  DPSLAISVDSRAVLQVKRLRWKFRGNETILVDGLPVEVYWDVHSWFFGNVM-GNAVFLFQ  231



>ref|XP_009601952.1| PREDICTED: uncharacterized protein LOC104097132 [Nicotiana tomentosiformis]
Length=302

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A  + +    + KREH++G +++ TKA     G    I+I+C   G D
Sbjct  136  GDLRKEAFKKTNATPSFSNAMFISKREHIFGKRVFGTKAQFCYTGPIHDITIECDSNGID  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+KHL+WKFRGN  + ++G P++V WDVH+WLF  +  G A+F F+
Sbjct  196  DPCLLVRIDSKTVMQVKHLRWKFRGNYTVLIDGLPVEVFWDVHNWLFSSNF-GNAVFMFQ  254



>ref|NP_198167.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL90906.1| AT5g28150/T24G3_80 [Arabidopsis thaliana]
 gb|AAN18148.1| At5g28150/T24G3_80 [Arabidopsis thaliana]
 gb|AED93776.1| uncharacterized protein AT5G28150 [Arabidopsis thaliana]
Length=289

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C     D
Sbjct  134  GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLFADGKFHDLLIECDTNVTD  193

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  194  PCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNKMTVEVLWDVHSWLFGLPTTGNAVFMFR  252



>ref|XP_010455167.1| PREDICTED: uncharacterized protein LOC104736806 [Camelina sativa]
Length=288

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 75/124 (60%), Gaps = 2/124 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD  KEA  KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  133  GDMNKEALKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLCADGKIHDLVIECDTSVTD  192

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKF  394
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+ 
Sbjct  193  PCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGLPSAGNAVFMFRT  252

Query  393  EKQS  382
             + +
Sbjct  253  TQST  256



>ref|XP_010421680.1| PREDICTED: uncharacterized protein LOC104707100 [Camelina sativa]
Length=288

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA  KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  133  GDMKKEALKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLCADGKIHDLVIECDTSVTD  192

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKF  394
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+ 
Sbjct  193  PCLVVRVDGKILLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGLPSAGNAVFMFRT  252

Query  393  EKQS  382
             + +
Sbjct  253  TQST  256



>emb|CDO99050.1| unnamed protein product [Coffea canephora]
Length=304

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEA+ KT A  A +    V KREH++G ++  TKA     G+   + I+C   G D
Sbjct  136  GDLRKEAFKKTNAAPALSSPLFVSKREHLFGKRICGTKAQFCDKGQIHDLKIECDTNGID  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+KHL+WKFRGN  I V+G P++V WDV++WLF +   G A+F F+
Sbjct  196  DPCLMIRIDSKTVMQVKHLQWKFRGNYTILVDGLPVEVFWDVYNWLFGNSGLGNAVFVFQ  255



>ref|XP_006294490.1| hypothetical protein CARUB_v10023518mg [Capsella rubella]
 gb|EOA27388.1| hypothetical protein CARUB_v10023518mg [Capsella rubella]
Length=353

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 106/200 (53%), Gaps = 35/200 (18%)
 Frame = -2

Query  690  QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQIKHLKWK  511
            Q LV KRE+++G ++Y+TK  + G  R ISID +V  D+  L FS+DDK VL+I  L+WK
Sbjct  171  QILVSKRENLFGNRVYSTKIKIQGTLREISIDVKVVNDEASLRFSLDDKSVLKIDKLQWK  230

Query  510  FRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQSVgedgggggfrg  346
            FRGN +I ++G  IQ+SWDV++WLF D      +   A+F  +FE Q V           
Sbjct  231  FRGNTKIVIDGVTIQISWDVYNWLFGDKDKVKPDKVPAVFLLRFENQEVE----------  280

Query  345  kmvnGCGLGFETMLMKKGLlrssrsssssslsst---------sasssctSVMEWESAEE  193
                    G + ++M K +  +      +S + +         S+ +   +VMEW S  E
Sbjct  281  --------GNDALMMNKRVRDNVVLRKENSKTPSFWATSYGHWSSFTRMPNVMEWSSCRE  332

Query  192  NELKD---PPGFSLLVYAWK  142
             + +       FSL++YAW+
Sbjct  333  EDERSFGYKSWFSLVIYAWR  352



>ref|XP_006405118.1| hypothetical protein EUTSA_v10000227mg [Eutrema salsugineum]
 gb|ESQ46571.1| hypothetical protein EUTSA_v10000227mg [Eutrema salsugineum]
Length=343

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 109/190 (57%), Gaps = 26/190 (14%)
 Frame = -2

Query  690  QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQIKHLKWK  511
            Q LV +RE+++G ++Y T   + GK R ISID +V  +D  L FS+D+K VL+IK L+WK
Sbjct  172  QILVSRRENLFGNRVYCTNIKIKGKLREISIDVKV-NNDANLRFSVDNKSVLKIKQLQWK  230

Query  510  FRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKFEKQSVgedgggggfrgkmvnG  331
            FRGN ++ ++G  IQ+SWD+++WLF D +   A+F  +FE Q V                
Sbjct  231  FRGNAKVVIDGVNIQISWDLYNWLFGDKDKVPAVFLLRFENQEVE---------------  275

Query  330  CGLGFETMLMKK----GLlrssrsssssslsstsasssctSVMEWESAEENELKD---PP  172
               G + ++M K     ++    +S ++S  S+S     +SVMEW + +E E +      
Sbjct  276  ---GNDLLMMNKRERDDVVLRKENSRTASFWSSSYRHWSSSVMEWSTCKEEEERSFGHKS  332

Query  171  GFSLLVYAWK  142
             +SL+VYAW+
Sbjct  333  WYSLIVYAWR  342



>ref|XP_009408456.1| PREDICTED: uncharacterized protein LOC103990890 [Musa acuminata 
subsp. malaccensis]
Length=286

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  KEAY KT A  + +  A V KREH+ G  LY TKA     GK   + I+C   G  
Sbjct  133  GDLAKEAYRKTAAVPSTSNMAFVAKREHISGKNLYCTKAQFCDNGKSHDVVIECDTVGLK  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K+V+Q+K L WKFRGN+ I ++G P++V WDVHSWLF     G A+F F+
Sbjct  193  DPCLEIHIDKKRVMQVKRLAWKFRGNQTILIDGLPVEVFWDVHSWLF-GVPGGNAVFMFQ  251



>gb|EMS52757.1| hypothetical protein TRIUR3_04572 [Triticum urartu]
Length=235

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 80/151 (53%), Gaps = 3/151 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +K+AY KT A       A V ++EH+YG K+Y+ KA     G+   + I+C   G  
Sbjct  79   GDMKKDAYRKTGANRPALNAAFVARKEHIYGKKIYSAKAQFCDNGQFHDLVIECDTVGLK  138

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  139  DPCLEIRIDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGPTTASNAVFMFQ  198

Query  396  FEKQSVgedgggggfrgkmvnGCGLGFETML  304
              +              +     GLGF  +L
Sbjct  199  TCQAPEKSMPWSYSQIFRESQLQGLGFSLIL  229



>ref|XP_006433029.1| hypothetical protein CICLE_v10001999mg [Citrus clementina]
 ref|XP_006471721.1| PREDICTED: uncharacterized protein LOC102630218 isoform X1 [Citrus 
sinensis]
 ref|XP_006471722.1| PREDICTED: uncharacterized protein LOC102630218 isoform X2 [Citrus 
sinensis]
 gb|ESR46269.1| hypothetical protein CICLE_v10001999mg [Citrus clementina]
 gb|KDO41101.1| hypothetical protein CISIN_1g022287mg [Citrus sinensis]
Length=299

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREH++G K++ TKA    GG+   + I+C   G +
Sbjct  133  GDMRKEAFKKTNATPVPSNAVFVAKREHLFGKKVFFTKAQFCNGGQIHDLVIECDTHGMN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+++KHL+WKFRGN  I V+G P++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLMVRVDGKSVMKVKHLRWKFRGNHTILVDGLPVEVFWDVHNWLFGASV-GNAVFMFK  251



>ref|XP_010674843.1| PREDICTED: uncharacterized protein LOC104890923 [Beta vulgaris 
subsp. vulgaris]
Length=299

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDC-RVAGD  577
            GD +KEA+ KT A    +    + KREHVYG K++ +KA     G    + I+C  ++ +
Sbjct  133  GDMRKEAFKKTNATPVSSNAVFIAKREHVYGKKVFYSKAKFSDNGPVHDLMIECDTISTN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K ++Q+K L+WKFRGN  I ++G P++V WDVHSWLF     G A+F F+
Sbjct  193  DPCLIVRVDTKNLMQVKRLRWKFRGNHTILIDGLPVEVFWDVHSWLFGSSP-GSAVFMFR  251



>ref|XP_010494083.1| PREDICTED: uncharacterized protein LOC104771271 [Camelina sativa]
Length=288

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 2/124 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA  KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  133  GDMKKEALKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLCADGKIHDLVIECDTSVTD  192

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFKF  394
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F  + 
Sbjct  193  PCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGLPSAGNAVFMLRT  252

Query  393  EKQS  382
             + +
Sbjct  253  TQST  256



>ref|XP_010929447.1| PREDICTED: uncharacterized protein LOC105050916 [Elaeis guineensis]
Length=299

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 76/121 (63%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG---GKERRISIDCRVAG-  580
            GDC+KEAY +T+ R A    ALV KRE+V+G K + T+A       KE  I ++  ++G 
Sbjct  134  GDCKKEAYKRTKCRPALESAALVSKRENVFGKKCFTTRARFDERKTKEHDIIVENSISGA  193

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
             DP +  S+D   ++ + +L+WKFRGNE + VE  P+QV WDVH WLF     G+ALF F
Sbjct  194  KDPEMWISIDGVVLIHVDNLQWKFRGNETVMVEKVPVQVFWDVHDWLFGAPGTGHALFIF  253

Query  399  K  397
            K
Sbjct  254  K  254



>gb|ACN25495.1| unknown [Zea mays]
Length=236

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 83/152 (55%), Gaps = 5/152 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAG-NGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-  580
            GD +K+AY KT A  +  N  A V +REH+YG K+Y+ KA     G+   I+I+C   G 
Sbjct  80   GDMKKDAYRKTGASQSTLNAAAFVARREHIYGKKIYSAKAQFCDNGQFHDIAIECDTVGF  139

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
             DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F
Sbjct  140  KDPCLEIRVDKKPVMQVKRLAWKFRGNQAILVDGLPVEVFWDVHSWLFGSTASN-AVFMF  198

Query  399  KFEKQSVgedgggggfrgkmvnGCGLGFETML  304
            +  +              +     GLGF  +L
Sbjct  199  QTRQAPEKSLPWSYSQNFRESQLQGLGFSLIL  230



>gb|ADG39148.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  50   GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSADGKIHDLVIECDTSVTD  109

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF
Sbjct  110  PCLVVRVDGKTMLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLF  155



>gb|EMT25403.1| hypothetical protein F775_31443 [Aegilops tauschii]
Length=292

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 80/151 (53%), Gaps = 3/151 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +K+AY KT A       A V ++EH+YG K+Y+ KA     G+   + I+C   G  
Sbjct  136  GDMKKDAYRKTGANRPALNAAFVARKEHIYGKKIYSAKAQFCDNGQFHDLVIECDTVGLK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  196  DPCLEMRIDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGPTTTSNAVFMFQ  255

Query  396  FEKQSVgedgggggfrgkmvnGCGLGFETML  304
              +              +     GLGF  +L
Sbjct  256  TCQAPEKSMPWSYSQIFRESQLQGLGFSLIL  286



>dbj|BAJ95878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 79/151 (52%), Gaps = 3/151 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  K+AY KT A       A V ++EH+YG K+Y+ KA     G+   + I+C   G  
Sbjct  136  GDMNKDAYRKTGANRPALNAAFVARKEHIYGKKIYSAKAQFCDNGQFHDLVIECDTVGLK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  196  DPCLEIRIDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSTTTSNAVFMFQ  255

Query  396  FEKQSVgedgggggfrgkmvnGCGLGFETML  304
              +              +     GLGF  +L
Sbjct  256  TCQAPEKSMPWSYSQIFRESQLQGLGFSLIL  286



>gb|AEN83173.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83174.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83175.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83176.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83177.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83178.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83179.1| AT5G28150-like protein, partial [Capsella rubella]
 gb|AEN83180.1| AT5G28150-like protein, partial [Capsella rubella]
Length=156

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  50   GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSADGKIHDLVIECDTSVTD  109

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF
Sbjct  110  PCLVVRVDGKTMLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLF  155



>ref|XP_004981359.1| PREDICTED: uncharacterized protein LOC101774579 [Setaria italica]
Length=291

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +K+AY KT A  +    A V +REH+YG K+Y+ KA     G+   I I+C   G  
Sbjct  136  GDMKKDAYRKTGANRSMLNAAFVARREHIYGKKIYSAKAQFCDNGQFHDIVIECDTIGLK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+KHL WKFRGN+ I ++G P++V WDVHSWLF       A+F F+
Sbjct  196  DPCLEIRVDKKPVMQVKHLAWKFRGNQTILIDGLPVEVFWDVHSWLFGSTASN-AVFMFQ  254



>ref|XP_002880661.1| hypothetical protein ARALYDRAFT_481378 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56920.1| hypothetical protein ARALYDRAFT_481378 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 109/213 (51%), Gaps = 38/213 (18%)
 Frame = -2

Query  732  EAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSM  553
            E   K R R     Q LV K+E+++G ++Y+TK  + GK R ISID +V  +D  L FS+
Sbjct  163  EGNLKQRPRR----QILVSKKENLFGNRVYSTKIKIQGKLREISIDIKVVNNDANLRFSV  218

Query  552  DDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEK  388
            +DK VL+I  L+WKFRGN +I ++G  IQ+ WDV++WLF D      +   A+F  +FE 
Sbjct  219  EDKSVLKINQLQWKFRGNSKIVIDGVTIQIIWDVYNWLFSDKDKVKPDKVPAVFLLRFEN  278

Query  387  QSVgedgggggfrgkmvnGCGLGFETMLMKKGLlrssrsssssslssts--------ass  232
            Q V                   G + ++M K +         +S + +          SS
Sbjct  279  QDVE------------------GNDVLMMNKRVRDDVVLRKENSRTPSFWGTSYGHWCSS  320

Query  231  sctSVMEWESAEENELK---DPPGFSLLVYAWK  142
              +SVMEW S  E + +       FSL++YAW+
Sbjct  321  RMSSVMEWPSCREEDERSFGSKSWFSLIIYAWR  353



>ref|XP_004247361.1| PREDICTED: uncharacterized protein LOC101254730 [Solanum lycopersicum]
Length=303

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD +KEA+ K+ A  + +    + KREH++G ++++TKA     G    I+I+C     D
Sbjct  136  GDLRKEAFKKSNATPSLSNAMFISKREHIFGKRVFSTKAQFCYTGPVHDITIECDSSVID  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+KHL+WKFRGN  + ++G P++V WDVH+WLF  +  G A+F F+
Sbjct  196  DPCLLVRIDSKTVMQVKHLRWKFRGNYTVLIDGLPVEVFWDVHNWLFSSNF-GNAVFMFQ  254



>ref|XP_009151242.1| PREDICTED: uncharacterized protein LOC103874571 [Brassica rapa]
 ref|XP_009151243.1| PREDICTED: uncharacterized protein LOC103874571 [Brassica rapa]
 emb|CDX86191.1| BnaA06g29080D [Brassica napus]
Length=293

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD  577
            GD +KEA+ KT A  + + G   V K+EHV+G + +ATKA +   GK   + I+C  +  
Sbjct  134  GDMRKEAFKKTNASPSSSLGAVFVAKKEHVFGKRAFATKAELCADGKIHDVVIECDTSVT  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  194  DPCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPSAGNAVFMFR  253



>ref|XP_009792059.1| PREDICTED: uncharacterized protein LOC104239187 [Nicotiana sylvestris]
Length=302

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A  + +    + KREH++G +++ TKA     G    I+I+C   G D
Sbjct  136  GDLRKEAFKKTNATPSFSNAMFISKREHIFGKRVFGTKAQFCYTGPIHDITIECDSNGID  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+++KHL+WKFRGN  + ++G P++V WDVH+WLF  +  G A+F F+
Sbjct  196  DPYLLVRIDSKTVMKVKHLRWKFRGNYTVLIDGLPVEVFWDVHNWLFSSNF-GNAVFMFQ  254



>ref|NP_001167908.1| hypothetical protein [Zea mays]
 gb|ACN25441.1| unknown [Zea mays]
 gb|ACN26475.1| unknown [Zea mays]
 tpg|DAA52032.1| TPA: hypothetical protein ZEAMMB73_540283 [Zea mays]
Length=294

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 83/152 (55%), Gaps = 5/152 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAG-NGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-  580
            GD +K+AY KT A  +  N  A V +REH+YG K+Y+ KA     G+   I+I+C   G 
Sbjct  138  GDMKKDAYRKTGASQSTLNAAAFVARREHIYGKKIYSAKAQFCDNGQFHDIAIECDTVGF  197

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
             DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F
Sbjct  198  KDPCLEIRVDKKPVMQVKRLAWKFRGNQAILVDGLPVEVFWDVHSWLFGSTASN-AVFMF  256

Query  399  KFEKQSVgedgggggfrgkmvnGCGLGFETML  304
            +  +              +     GLGF  +L
Sbjct  257  QTRQAPEKSLPWSYSQNFRESQLQGLGFSLIL  288



>gb|ADG39149.1| AT5G28150-like protein [Capsella grandiflora]
 gb|ADG39152.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  50   GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSADGKIHDLVIECDTSVTD  109

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
            P LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF
Sbjct  110  PCLVVRVDGKTMLQVKRLKWKFRGNDTIVVNRXAVEVLWDVHSWLF  155



>gb|ADG39151.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 2/106 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  50   GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSADGKIHDLVIECDTSVTD  109

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
            P LV  +D K  LQ+K LKWKFRGN+ I V    ++V WDVHSWLF
Sbjct  110  PCLVVRVDGKTXLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLF  155



>ref|NP_850061.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD23671.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAS49111.1| At2g25200 [Arabidopsis thaliana]
 dbj|BAD43081.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07670.1| uncharacterized protein AT2G25200 [Arabidopsis thaliana]
Length=354

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 105/199 (53%), Gaps = 34/199 (17%)
 Frame = -2

Query  690  QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQIKHLKWK  511
            Q LV K+E+++G ++Y+TK  + GK R ISID +V  DD  L FS+DDK VL+I  L+WK
Sbjct  173  QILVSKKENLFGNRVYSTKIMIQGKLREISIDVKVVNDDASLRFSVDDKSVLKISQLQWK  232

Query  510  FRGNERIEVEGFPIQVSWDVHSWLFD-----DDEDGYALFTFKFEKQSVgedgggggfrg  346
            FRGN +I ++G  IQ+SWDV +WLF        +   A+F  +FE Q V           
Sbjct  233  FRGNTKIVIDGVTIQISWDVFNWLFGGKDKVKPDKIPAVFLLRFENQEVE----------  282

Query  345  kmvnGCGLGFETMLMKKGLl--------rssrsssssslsstsasssctSVMEWESAEEN  190
                    G + ++M K +              S  +S  S  +SS  +SVMEW S  E 
Sbjct  283  --------GNDVLMMNKRVRDDVILRKENCRTPSFWASTYSHWSSSRMSSVMEWSSCREE  334

Query  189  ELK---DPPGFSLLVYAWK  142
            + +       FSL++YAW+
Sbjct  335  DERSFGSKSWFSLIIYAWR  353



>ref|XP_003521743.1| PREDICTED: uncharacterized protein LOC100791607 [Glycine max]
 gb|KHN31447.1| hypothetical protein glysoja_035554 [Glycine soja]
Length=297

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +  ALV K+EHV+G KLY TKA     G+   + I+C  A   
Sbjct  133  GDLRKEAFKKTNANPLPHNAALVAKKEHVFGKKLYGTKAVFCDNGQIHDLVIECGTASVG  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F F+
Sbjct  193  DPSLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSL-GNAVFMFR  251



>ref|XP_010429511.1| PREDICTED: uncharacterized protein LOC104713983 isoform X1 [Camelina 
sativa]
Length=353

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 106/199 (53%), Gaps = 34/199 (17%)
 Frame = -2

Query  690  QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQIKHLKWK  511
            Q LV K+E+++G ++Y+TK  + GK R ISID +V  DD  L FS+D+K VL+I  L+WK
Sbjct  172  QVLVSKKENLFGNRVYSTKIKIQGKLRDISIDVKVVIDDASLRFSVDNKSVLKINQLQWK  231

Query  510  FRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQSVgedgggggfrg  346
             RGN +I ++G  IQ+SWDV++WLF D      +   A+F  +FE Q V           
Sbjct  232  CRGNTKIVIDGVTIQISWDVYNWLFGDKDKVKPDKTPAVFLLRFENQEVE----------  281

Query  345  kmvnGCGLGFETMLMKKGLlrssrsssssslssts--------asssctSVMEWESAEEN  190
                    G + ++M K +  +      +S + +          SS  +SVMEW S  E 
Sbjct  282  --------GNDALMMNKRVRDNVVLRKENSRTPSFWATSYGHWPSSRMSSVMEWSSCREE  333

Query  189  ELKD---PPGFSLLVYAWK  142
            + +       FSL++YAW+
Sbjct  334  DERSFGCKSWFSLVIYAWR  352



>ref|XP_010546610.1| PREDICTED: uncharacterized protein LOC104818644 [Tarenaya hassleriana]
Length=286

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGDD  574
            GD  KEA+ KT A  + +    V K+EHV+G +++A KA   G  K   + I+C  +  D
Sbjct  133  GDMNKEAFKKTNATPSSSSALFVAKKEHVFGKRVFAAKAQFSGNGKTHDLVIECDTSVSD  192

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            P L+  ++ K ++Q+K LKWKFRGN+ I V+   ++V WDVHSWLF     G A+F F+
Sbjct  193  PCLIVRVNGKPMMQVKRLKWKFRGNDTIIVDRMAVEVLWDVHSWLFGIPSTGNAVFMFR  251



>gb|ACU18448.1| unknown [Glycine max]
Length=297

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +  ALV K+EHV+G KLY TKA     G+   + I+C  A   
Sbjct  133  GDLRKEAFKKTNANPLPHNAALVAKKEHVFGKKLYGTKAVFCDNGQIHDLVIECGTASVG  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F F+
Sbjct  193  DPSLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSL-GNAVFMFR  251



>ref|XP_011071576.1| PREDICTED: uncharacterized protein LOC105156990 [Sesamum indicum]
Length=302

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD  KEA+ KT A  + +    V KREH+ G +++ TKA     G+   + I+C  + GD
Sbjct  135  GDLTKEAFKKTGAIASLSSAVFVSKREHICGKRVFGTKAQFCDNGQIHDLKIECDTIFGD  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+KHL+WKFRGN  I V+G P+ V WDVH+WLF  +  G A+F F+
Sbjct  195  DPFLVVRVDSKPVMQVKHLRWKFRGNCTILVDGIPVDVFWDVHNWLFGSNL-GSAVFMFQ  253



>ref|XP_010429513.1| PREDICTED: uncharacterized protein LOC104713983 isoform X2 [Camelina 
sativa]
Length=353

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 106/199 (53%), Gaps = 34/199 (17%)
 Frame = -2

Query  690  QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQIKHLKWK  511
            Q LV K+E+++G ++Y+TK  + GK R ISID +V  DD  L FS+D+K VL+I  L+WK
Sbjct  172  QVLVSKKENLFGNRVYSTKIKIQGKLRDISIDVKVVIDDASLRFSVDNKSVLKINQLQWK  231

Query  510  FRGNERIEVEGFPIQVSWDVHSWLFDD-----DEDGYALFTFKFEKQSVgedgggggfrg  346
             RGN +I ++G  IQ+SWDV++WLF D      +   A+F  +FE Q V           
Sbjct  232  CRGNTKIVIDGVTIQISWDVYNWLFGDKDKVKPDKTPAVFLLRFENQEVE----------  281

Query  345  kmvnGCGLGFETMLMKKGLlrssrsssssslssts--------asssctSVMEWESAEEN  190
                    G + ++M K +  +      +S   +         +SS  +SVMEW S  E 
Sbjct  282  --------GNDALMMNKRVRDNVVLRKENSQIPSFWATSYGHWSSSRLSSVMEWSSCREE  333

Query  189  ELKD---PPGFSLLVYAWK  142
            + +       FSL++YAW+
Sbjct  334  DERSFGCKSWFSLVIYAWR  352



>emb|CDY52485.1| BnaC07g49460D [Brassica napus]
Length=293

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD  577
            GD +KEA+ KT A  + + G   + K+EHV+G + +ATKA +   GK   + I+C  +  
Sbjct  134  GDMRKEAFKKTNASPSSSLGAVFIAKKEHVFGKRSFATKAQLCADGKIHDVVIECDTSVT  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF     G A+F F+
Sbjct  194  DPCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPSVGNAVFMFR  253



>gb|ADG39153.1| AT5G28150-like protein [Neslia paniculata]
Length=155

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 2/106 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD  KEA+ KT A  +  G   + K+EHV+G +++ATKA +   GK   + I+C  +  D
Sbjct  50   GDMNKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLSADGKIHDLVIECDTSVTD  109

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
            P LV  +D K +LQ+K LKWKFRGN+ I V    +++ WDVHSWLF
Sbjct  110  PCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVELLWDVHSWLF  155



>ref|XP_006360806.1| PREDICTED: uncharacterized protein LOC102583145 [Solanum tuberosum]
Length=303

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD +KEA+ K+ A  + +    + KREH++G +++ TKA     G    I+I+C     D
Sbjct  136  GDLRKEAFKKSNATPSLSNAIFISKREHIFGKRVFGTKAQFCYTGPIHDITIECDSSVID  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+KHL+WKFRGN  + ++G P++V WDVH+WLF  +  G A+F F+
Sbjct  196  DPCLLVRIDSKTVMQVKHLRWKFRGNYTVLIDGLPVEVFWDVHNWLFSSNF-GNAVFMFQ  254



>emb|CDP21506.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA  KT A  A +G  L+ KREH++G K++ TKA     G    + I+C   G  
Sbjct  136  GDMRKEALKKTGATPASSGSVLIAKREHIFGRKMFGTKAQFCDNGPVHDLMIECDTTGIS  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K +LQ+K L WKFRGN  I V+G  I+V WDVH+WLF     G A+F FK
Sbjct  196  DPCLVIRVDTKPLLQVKRLTWKFRGNHTILVDGIGIEVFWDVHNWLFATSL-GNAVFMFK  254



>ref|XP_010090415.1| hypothetical protein L484_025081 [Morus notabilis]
 gb|EXB39385.1| hypothetical protein L484_025081 [Morus notabilis]
Length=305

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 90/166 (54%), Gaps = 18/166 (11%)
 Frame = -2

Query  747  GDCQKEAYAKT---RARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD ++EAY K      R   +    V KREH++G K Y  KA     G+   ++I+C   
Sbjct  134  GDLKREAYKKIDNDAERVRCSNSIFVAKREHIFGKKFYVAKAQFCDKGQTHDVAIECDTV  193

Query  582  G-DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYAL  409
            G +DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF ++ + G A+
Sbjct  194  GLNDPSLVIRIDSKPVMQVKRLKWKFRGNNTILVDGLPVEVFWDVHNWLFGNNNNMGNAV  253

Query  408  FTFK--------FEKQSVgedgggggfrgkmvnGC---GLGFETML  304
            F F+        +  QSV +         + +  C   GLGF  +L
Sbjct  254  FMFQTSLSAEKLWSNQSVFDPSVLTRSYSQQIKDCQTQGLGFSLIL  299



>ref|XP_009111920.1| PREDICTED: uncharacterized protein LOC103837313 [Brassica rapa]
 ref|XP_009111921.1| PREDICTED: uncharacterized protein LOC103837313 [Brassica rapa]
Length=294

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV---GGKERRISIDCRVAGD  577
            GD +KEA+ KT A  +  G   + K+EHV+G + +ATKA +   G K   + I+C  +  
Sbjct  133  GDMKKEAFKKTNASPSSRGAVFIAKKEHVFGKREFATKAQLCSDGVKVHDLVIECDTSVT  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF      G A+F F
Sbjct  193  DPCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPSSAGNAVFMF  252

Query  399  K  397
            +
Sbjct  253  R  253



>ref|XP_002977922.1| hypothetical protein SELMODRAFT_107811 [Selaginella moellendorffii]
 gb|EFJ21260.1| hypothetical protein SELMODRAFT_107811 [Selaginella moellendorffii]
Length=294

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD-  577
            GD  +EAY KT+AR       L+ +REHV+G + Y TKA  G  GK   I I+C  +G  
Sbjct  132  GDMVREAYKKTQARPPTIEAMLLSRREHVFGKRYYTTKAQFGESGKTHDIMIECHTSGAR  191

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L   +D + V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF+    G A+F F+
Sbjct  192  EPRLYVRVDRQLVIQVKKLMWKFRGNQTILVDGLPVEVFWDVHNWLFNPSL-GNAVFMFQ  250



>gb|ADG39150.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G  ++ATKA +   GK   + I+C  +  D
Sbjct  50   GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKXVFATKAQLSADGKIHDLVIECDTSVTD  109

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
            P LV  +D K  LQ+K LKWKFRGN+ I V    ++V WDVHSWLF
Sbjct  110  PCLVVRVDGKTXLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLF  155



>emb|CDY00013.1| BnaC09g02880D [Brassica napus]
Length=295

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRIS---IDCRVAGD  577
            GD +KEA+ KT A  +  G   V K+EHV+G + +ATKA +     RI    I+C  +  
Sbjct  133  GDMKKEAFKKTNASPSSRGAVFVAKKEHVFGKREFATKAQLCSDGVRIHDLVIECDTSVT  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF      G A+F F
Sbjct  193  DPCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPSSAGNAVFMF  252

Query  399  K  397
            +
Sbjct  253  R  253



>ref|XP_010552768.1| PREDICTED: uncharacterized protein LOC104823045 [Tarenaya hassleriana]
Length=298

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 6/128 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNG--QALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVA  583
            GD +KEAY K     AG       V K+EHV+G KLY T+A    GG+   I+I+C  V 
Sbjct  135  GDMKKEAYKKIGISTAGGSCNAVFVAKKEHVFGKKLYTTRAQFHGGGRTHDIAIECDAVH  194

Query  582  GDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDE-DGYALF  406
              DP L   +D K+++QI+ LKWKFRGN+ + ++G P+ V WDVHSWLF +   D  A+F
Sbjct  195  AGDPCLSIRIDGKRLVQIRRLKWKFRGNDTVFIDGLPVDVFWDVHSWLFGNAAGDNAAVF  254

Query  405  TFKFEKQS  382
             F+ +++S
Sbjct  255  MFRADERS  262



>ref|XP_010041438.1| PREDICTED: uncharacterized protein LOC104430401 [Eucalyptus grandis]
 ref|XP_010041445.1| PREDICTED: uncharacterized protein LOC104430401 [Eucalyptus grandis]
 gb|KCW84880.1| hypothetical protein EUGRSUZ_B01700 [Eucalyptus grandis]
 gb|KCW84881.1| hypothetical protein EUGRSUZ_B01700 [Eucalyptus grandis]
Length=299

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA  KT A    +    + KREHV+G K++ TKA     G+   + I+C  +G +
Sbjct  133  GDLRKEALKKTNAVPVPSNAYFLAKREHVFGKKMFVTKAQFCDNGQTHDLVIECDTSGVN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF +   G A+F FK
Sbjct  193  DPCLLIRVDSKSVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLF-NPSSGNAVFMFK  251



>ref|XP_003564146.1| PREDICTED: uncharacterized protein LOC100837549 [Brachypodium 
distachyon]
Length=291

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 81/151 (54%), Gaps = 4/151 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD +K+AY KT      +  A V +REH+YG K+Y+ KA     G+   + I+C  V+  
Sbjct  136  GDMKKDAYRKTGMNRPMSNAAFVARREHIYGKKIYSAKAQFCDNGQFHDVVIECDAVSLK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  196  DPCLEIRIDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSSTSN-AVFMFQ  254

Query  396  FEKQSVgedgggggfrgkmvnGCGLGFETML  304
              +              +     GLGF  +L
Sbjct  255  TSQAPEKSMPWSYSQIFRESQLQGLGFSLIL  285



>ref|XP_004302026.1| PREDICTED: uncharacterized protein LOC101296394 [Fragaria vesca 
subsp. vesca]
Length=303

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A  A +    + +REH++G K++ TKA     G+   + I+C   G +
Sbjct  137  GDMKKEAFKKTSASPASSNAGCIARREHIFGKKVFTTKARFCNDGQVHDLVIECDTVGVN  196

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  197  DPCLIVRVDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGSSP-GSAVFMFK  255



>ref|XP_004230118.1| PREDICTED: uncharacterized protein LOC101268432 [Solanum lycopersicum]
Length=299

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA  KT A  A +G   + K+EH++G K+++TKA     G+   + I+C  +G  
Sbjct  133  GDMKKEAIKKTSATPAASGAVFIAKKEHMFGKKVFSTKAQFCDNGRVHDLVIECDTSGTS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K ++Q+K LKWKFRGN  + V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLVIRVDSKPMMQVKRLKWKFRGNHTMLVDGLGVEVFWDVHNWLFSTSV-GSAVFMFK  251



>gb|KJB45005.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45006.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45007.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
 gb|KJB45008.1| hypothetical protein B456_007G284600 [Gossypium raimondii]
Length=303

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD  KEA  KT A H     +LV K+EHV+G +++ TKA     G+   + I+C  V  +
Sbjct  135  GDMSKEACKKTGATHIPCNASLVAKKEHVFGKRVFGTKAQFCDNGRIHDLIIECDAVCMN  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K ++Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  195  DPCLIIRVDGKALMQVKRLRWKFRGNHTILVDGMAVEVYWDVHNWLFGTSLGGSAVFMFK  254



>ref|XP_002466252.1| hypothetical protein SORBIDRAFT_01g004400 [Sorghum bicolor]
 gb|EER93250.1| hypothetical protein SORBIDRAFT_01g004400 [Sorghum bicolor]
Length=291

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +K+AY KT A  +    A V ++EH+YG K+Y+ KA     G+   I+I+C   G  
Sbjct  136  GDMKKDAYRKTGANRSMLNAAFVARKEHIYGKKIYSAKAQFCNNGQFHDIAIECDTVGLK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  196  DPCLEIRVDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSTTSN-AVFMFQ  254



>ref|XP_001772274.1| predicted protein [Physcomitrella patens]
 gb|EDQ62927.1| predicted protein [Physcomitrella patens]
Length=284

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVA-GD  577
            GD   EAY KT+AR A     LV + EHV+G K ++TKA    GGK   I I+C+++   
Sbjct  131  GDMYSEAYKKTKARPASIEAILVSRSEHVFGKKYHSTKAQFEEGGKAHDIVIECQISPSS  190

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P +   +D + V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF +   G+A+F F+
Sbjct  191  EPRMYIRVDREIVVQVKRLAWKFRGNQTIIVDGNPVEVFWDVHNWLF-NPRVGHAVFMFQ  249



>emb|CDY59819.1| BnaA09g51660D [Brassica napus]
Length=444

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV---GGKERRISIDCRVAGD  577
            GD +KEA+ KT A  +  G   + K+EHV+G + +ATKA +   G K   + I+C  +  
Sbjct  282  GDMKKEAFKKTNASPSSRGAVFIAKKEHVFGKREFATKAQLCSDGVKVHDLVIECDTSVT  341

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP LV  +D K +LQ+K LKWKFRGN+ I V    ++V WDVHSWLF      G A+F F
Sbjct  342  DPCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNRMAVEVLWDVHSWLFGMPSSAGNAVFMF  401

Query  399  K  397
            +
Sbjct  402  R  402



>ref|XP_007147151.1| hypothetical protein PHAVU_006G100000g [Phaseolus vulgaris]
 gb|ESW19145.1| hypothetical protein PHAVU_006G100000g [Phaseolus vulgaris]
Length=297

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +   L+ K+EHV+G KLY TKA     G+   I I+C  A   
Sbjct  133  GDLKKEAFKKTNASPLPHNGFLIAKKEHVFGKKLYGTKAVFCDNGQIHDIVIECDTATVS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F F+
Sbjct  193  DPSLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSL-GNAVFMFR  251



>ref|XP_006444048.1| hypothetical protein CICLE_v10021341mg [Citrus clementina]
 ref|XP_006479703.1| PREDICTED: uncharacterized protein LOC102609980 [Citrus sinensis]
 gb|ESR57288.1| hypothetical protein CICLE_v10021341mg [Citrus clementina]
 gb|KDO68699.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
 gb|KDO68700.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
 gb|KDO68701.1| hypothetical protein CISIN_1g022154mg [Citrus sinensis]
Length=302

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDC-RVAGD  577
            GD +KEAY K  A    +    + KREH++G K Y  KA     G    I+I+C  +   
Sbjct  136  GDLKKEAYRKINAAPINSNPIFIAKREHIFGKKFYGAKAQFCDKGLTHDITIECDTIDVK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  196  DPCLVIRIDSKTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  254



>gb|ACU20214.1| unknown [Glycine max]
Length=300

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 88/162 (54%), Gaps = 14/162 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTR---ARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD +KEA  K     A  + +G   + KREH++G K Y  KA     G+   ++I+C   
Sbjct  133  GDLKKEACKKIESDCACFSHSGAIFIAKREHIFGKKFYGAKAQFCDKGQVHDVTIECDTL  192

Query  582  G-DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALF  406
            G +DP LV  +D K V+++K LKWKFRGN  I V+G P++V WDVHSWLF +     A+F
Sbjct  193  GLNDPSLVIRIDSKTVMKVKRLKWKFRGNHTILVDGVPVEVLWDVHSWLFGNAMGNNAVF  252

Query  405  TFK--------FEKQSVgedgggggfrgkmvnGCGLGFETML  304
             F+        +E QSV +       + +     GLGF  +L
Sbjct  253  MFQTCISNDKMWEGQSVSDPSWASSQQFRDSQLQGLGFSLIL  294



>ref|XP_003536564.1| PREDICTED: uncharacterized protein LOC100796685 [Glycine max]
Length=300

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 88/162 (54%), Gaps = 14/162 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTR---ARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD +KEA  K     A  + +G   + KREH++G K Y  KA     G+   ++I+C   
Sbjct  133  GDLKKEACKKIESDCACFSHSGAIFIAKREHIFGKKFYGAKAQFCDKGQVHDVTIECDTL  192

Query  582  G-DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALF  406
            G +DP LV  +D K V+++K LKWKFRGN  I V+G P++V WDVHSWLF +     A+F
Sbjct  193  GLNDPSLVIRIDSKTVMKVKRLKWKFRGNHTILVDGVPVEVFWDVHSWLFGNAMGNNAVF  252

Query  405  TFK--------FEKQSVgedgggggfrgkmvnGCGLGFETML  304
             F+        +E QSV +       + +     GLGF  +L
Sbjct  253  MFQTCISNDKMWEGQSVSDPSWASSQQFRDSQLQGLGFSLIL  294



>ref|XP_002986948.1| hypothetical protein SELMODRAFT_158336 [Selaginella moellendorffii]
 gb|EFJ12030.1| hypothetical protein SELMODRAFT_158336 [Selaginella moellendorffii]
Length=297

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD-  577
            GD  +EAY KT+AR       L+ +REHV+G + Y TKA  G  G+   I I+C   G  
Sbjct  135  GDMVREAYKKTQARPPTIEAMLLSRREHVFGKRYYTTKAQFGESGRTHDIMIECHTNGAR  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L   +D + V+Q+K L WKFRGN+ I V+G P++V WDVH+WLF+    G A+F F+
Sbjct  195  EPRLYVRVDRQLVIQVKKLMWKFRGNQTILVDGLPVEVFWDVHNWLFNPSL-GNAVFMFQ  253



>ref|XP_006347793.1| PREDICTED: uncharacterized protein LOC102597851 [Solanum tuberosum]
Length=299

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA  KT A  A  G   + K+EH++G K+++TKA     G+   + I+C  +G  
Sbjct  133  GDMKKEAIKKTSATPAACGAVFIAKKEHMFGKKVFSTKAQFCDNGRVHDLVIECDTSGTS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K ++Q+K LKWKFRGN  + V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLVIRVDSKPMMQVKRLKWKFRGNHTMLVDGLGVEVFWDVHNWLFSTSV-GSAVFMFK  251



>ref|XP_010089947.1| hypothetical protein L484_014458 [Morus notabilis]
 gb|EXB38643.1| hypothetical protein L484_014458 [Morus notabilis]
Length=360

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 8/119 (7%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPG  568
            GD  KEA+AKT+++ +G      L      G         +GGK R I I+C    D   
Sbjct  152  GDLAKEAHAKTKSQPSGKNHDRALSTSSRRGS------TRLGGKTREIQINCG-HDDCSK  204

Query  567  LVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFKF  394
            LVFS+D KK+LQIK LKWKFRGNER EV+G  +Q+SWDV++WLFD  + D +A+F F+F
Sbjct  205  LVFSVDGKKILQIKRLKWKFRGNERAEVDGVNVQISWDVYNWLFDAQNGDAHAVFMFRF  263



>gb|ABR17303.1| unknown [Picea sitchensis]
Length=270

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 5/120 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAGD-  577
            GD  KEA+ KT A+       L+ ++EHV+G   Y TKA     G+   I I+C+  G  
Sbjct  108  GDMCKEAFKKTHAKPPAE-TVLISRKEHVFGKNCYTTKAQFCNSGRIHDIVIECQTGGPR  166

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L   +D + V+Q+KHL WKFRGN+ I V+G PI++ WDVH WLF+    G+A+F FK
Sbjct  167  EPKLCVRIDKQLVVQVKHLIWKFRGNQTISVDGLPIEMFWDVHDWLFNPSL-GHAVFMFK  225



>gb|KDP23639.1| hypothetical protein JCGZ_23472 [Jatropha curcas]
Length=299

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD +KEA+ KT A    +    V KREHV+G K+++T+A     G+   + I+C  ++  
Sbjct  133  GDLRKEAFKKTSATPIPSNAVFVAKREHVFGKKVFSTRAQFCDNGQIHDLVIECDTISTS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLVVRVDCKTVMQVKRLRWKFRGNHTILVDGLAVEVLWDVHNWLFGTSV-GNAVFMFK  251



>gb|ADG39147.1| AT5G28150-like protein [Capsella grandiflora]
Length=155

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD  574
            GD +KEA+ KT A  +  G   + K+EHV+G  ++ATKA +   GK   + I+C  +  D
Sbjct  50   GDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKXVFATKAQLSADGKIHDLVIECDTSVTD  109

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
            P LV  +D K +LQ+K LKWKFRGN+   V    ++V WDVHSWLF
Sbjct  110  PCLVVRVDGKTMLQVKRLKWKFRGNDTXVVNRXAVEVLWDVHSWLF  155



>ref|XP_008783101.1| PREDICTED: uncharacterized protein LOC103702440 [Phoenix dactylifera]
Length=273

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD-  577
            GD +KEAY +T+ R A    ALV +RE+V+G K + T+A      KE  I ++  ++G  
Sbjct  126  GDGKKEAYRRTKCRPALESAALVSRRENVFGKKCFTTRARFDERKKEHDIVVENSISGPQ  185

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP +  S+D   ++ + +L+WKFRGNE + VE  P+QV WDVH WLF     G+ALF FK
Sbjct  186  DPEMWISIDGVVLIHVSNLQWKFRGNETVLVEKVPVQVFWDVHDWLFGTPGTGHALFIFK  245



>ref|XP_002307590.1| hypothetical protein POPTR_0005s23240g [Populus trichocarpa]
 gb|EEE94586.1| hypothetical protein POPTR_0005s23240g [Populus trichocarpa]
Length=300

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDC-RVAGD  577
            GD  KEAY K  +         + +REH++G K YA KA     G+   ++I+C  +   
Sbjct  133  GDMAKEAYKKIESAPVHTNAIFIARREHIFGKKFYAAKAQFCDKGQMHDVTIECDTIDLK  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  193  DPCLVIRIDSKMVMQVKRLKWKFRGNYTILVDGLPVEVFWDVHNWLFGNSM-GNAVFMFQ  251



>gb|AFW67285.1| hypothetical protein ZEAMMB73_929047 [Zea mays]
Length=291

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 80/151 (53%), Gaps = 4/151 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD +K+AY KT A  +    A V +REH+YG K Y+ KA     G+   I IDC  V   
Sbjct  136  GDMKKDAYRKTGANRSMLNAAFVARREHIYGKKTYSAKAQFCDNGQFHDIVIDCDTVDLK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  196  DPCLEIRVDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSTASN-AVFMFQ  254

Query  396  FEKQSVgedgggggfrgkmvnGCGLGFETML  304
              +              +     GLGF  +L
Sbjct  255  TCQAPEKSLPWSYSQIFRESQLQGLGFSLIL  285



>ref|XP_002512236.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49688.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREHV+G ++++TKA     G+   + I+C   G  
Sbjct  133  GDMRKEAFKKTSAAPISSTAVFVSKREHVFGKRVFSTKAQFSDNGQVHDLVIECDTIGVS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLVVRVDCKTVMQVKRLRWKFRGNHTILVDGLAVEVLWDVHNWLFGSSV-GNAVFMFK  251



>emb|CBI34200.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    + KRE+++G K++ TKA     G+   + I+C   G  
Sbjct  97   GDLRKEAFKKTNATPVPSNAVFIAKRENIFGKKVFRTKAQFCDNGQIHDLMIECDTIGVT  156

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  157  DPYLVIRVDSKIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNWLFSTTL-GNAVFLFK  215



>ref|XP_011032437.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032438.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032439.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032440.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032441.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032442.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032443.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032444.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032446.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032447.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032448.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032449.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032450.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032452.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032453.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032454.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032455.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032456.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032457.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032458.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032459.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032460.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
 ref|XP_011032461.1| PREDICTED: uncharacterized protein LOC105131255 [Populus euphratica]
Length=299

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREHV+G K++ TKA     G    + I+C   G  
Sbjct  133  GDMRKEAFKKTGATPVPSNAVFVAKREHVFGKKVFCTKARFCDNGHIHDLVIECDTVGVS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  I+V WDVHSWLF     G A+F FK
Sbjct  193  DPCLLVRVDCKTVMQVKRLRWKFRGNHTILVDGLAIEVFWDVHSWLFGASV-GNAVFMFK  251



>ref|XP_007144641.1| hypothetical protein PHAVU_007G172700g [Phaseolus vulgaris]
 gb|ESW16635.1| hypothetical protein PHAVU_007G172700g [Phaseolus vulgaris]
Length=300

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 75/122 (61%), Gaps = 6/122 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN--GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG  580
            GD +KEA  K  +  A +  G   + KREH++G K Y  KA     G+   ++I+C   G
Sbjct  133  GDLKKEACKKIDSDCAFSHCGTVFIAKREHIFGKKFYGAKAQFCDKGQMHDVTIECDTVG  192

Query  579  -DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFT  403
             +DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVHSWLF +   G A+F 
Sbjct  193  FNDPSLVIRVDSKTVMQVKRLKWKFRGNHTILVDGVPVEVFWDVHSWLFGNAM-GNAVFM  251

Query  402  FK  397
            F+
Sbjct  252  FQ  253



>gb|KHN03804.1| hypothetical protein glysoja_011033 [Glycine soja]
Length=300

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 87/162 (54%), Gaps = 14/162 (9%)
 Frame = -2

Query  747  GDCQKEAYAKTR---ARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD +KEA  K     A  + +G   + KREH++G K Y  KA     G+   ++I+C   
Sbjct  133  GDLKKEACKKIESDCACFSHSGAIFIAKREHIFGKKFYGAKAQFCDKGQVHDVTIECDTL  192

Query  582  G-DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALF  406
            G +DP LV  +D K V+++K LKWKFRGN  I V+G P++V WDVHSWLF +     A+F
Sbjct  193  GLNDPSLVIRIDSKTVMKVKRLKWKFRGNHTILVDGVPVEVFWDVHSWLFGNAMGNNAVF  252

Query  405  TFK--------FEKQSVgedgggggfrgkmvnGCGLGFETML  304
             F+        +E QSV +       + +     G GF  +L
Sbjct  253  MFQTCISNDKMWEGQSVSDPSWASSQQFRDSQLQGFGFSLIL  294



>gb|EEE60141.1| hypothetical protein OsJ_13031 [Oryza sativa Japonica Group]
Length=269

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD +K+AY KT A       A V +REH+YG K+Y  KA     G+   + I+C  V+  
Sbjct  114  GDMKKDAYRKTGANRPMLNAAFVARREHIYGKKIYTAKAQFCENGQFHDVVIECDTVSLK  173

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  174  DPCLEIRVDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGLTTSN-AVFMFQ  232



>ref|NP_001051637.1| Os03g0806700 [Oryza sativa Japonica Group]
 gb|AAP21412.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99447.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13551.1| Os03g0806700 [Oryza sativa Japonica Group]
 dbj|BAG88202.1| unnamed protein product [Oryza sativa Japonica Group]
Length=291

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 80/151 (53%), Gaps = 4/151 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD +K+AY KT A       A V +REH+YG K+Y  KA     G+   + I+C  V+  
Sbjct  136  GDMKKDAYRKTGANRPMLNAAFVARREHIYGKKIYTAKAQFCENGQFHDVVIECDTVSLK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  196  DPCLEIRVDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGLTTSN-AVFMFQ  254

Query  396  FEKQSVgedgggggfrgkmvnGCGLGFETML  304
              +              +     GLGF  +L
Sbjct  255  TCQAPEKSMPWSYSQVFRESQLQGLGFSLIL  285



>ref|XP_008455804.1| PREDICTED: uncharacterized protein LOC103495897 [Cucumis melo]
Length=299

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ K+ +    +    + K+EH++G K++ +KA     G+   I I+C   G  
Sbjct  133  GDLRKEAFKKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQFCDNGQIHDIIIECDTNGVT  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L+  +D K VLQ+K L+WKFRGN  I VEG  ++V WDVHSWLF     G A+F FK
Sbjct  193  EPCLILRVDSKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLFSTSP-GNAVFMFK  251



>ref|XP_009364535.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364536.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364537.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364538.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
 ref|XP_009364540.1| PREDICTED: uncharacterized protein LOC103954432 [Pyrus x bretschneideri]
Length=299

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREH++G + + TKA     G+   + I+C   G +
Sbjct  133  GDMRKEAFKKTSANPVPSSAVCVAKREHIFGKRGFTTKAQFCNNGQVHDLVIECDTVGVN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLLVRVDSKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>ref|XP_007207341.1| hypothetical protein PRUPE_ppa009272mg [Prunus persica]
 gb|EMJ08540.1| hypothetical protein PRUPE_ppa009272mg [Prunus persica]
Length=299

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREHV+G + + TKA     G+   + I+C   G +
Sbjct  133  GDMRKEAFKKTSASPVPSNAVCVAKREHVFGKRGFTTKAQFSNNGQVHDLVIECDTLGVN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLLVRVDSKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>ref|XP_008808239.1| PREDICTED: uncharacterized protein LOC103720353 [Phoenix dactylifera]
Length=437

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 88/147 (60%), Gaps = 25/147 (17%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN--GQALVLKREHVY-----GGKLYATKANVGGKERRISID--  595
            GD   EAY K++A    +     L+ +REHV      GG+ Y T+A  GGKER ISID  
Sbjct  191  GDLVDEAYRKSKAAKGNSLRNPILISRREHVVLRDSGGGRSYKTRALFGGKEREISIDLG  250

Query  594  CRVAGDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFP-IQVSWDVHSWLFDDDED-  421
             R    D G++  +D K++LQ++ L+WKFRG+ER+EVEG   IQVSWD+H+WLF   ++ 
Sbjct  251  TRERERDVGMLLGVDGKRLLQVRRLRWKFRGSERVEVEGGARIQVSWDLHNWLFQPKDEP  310

Query  420  --------------GYALFTFKFEKQS  382
                          G+A+F F+F++++
Sbjct  311  PATASTAAAAAAELGHAVFVFRFDREA  337



>gb|KHN43207.1| hypothetical protein glysoja_001790 [Glycine soja]
Length=243

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +   LV K+EHV+G KL+ TKA     G    + I+C  A   
Sbjct  79   GDLRKEAFKKTNANPLPHNAVLVAKKEHVFGKKLHGTKAVFCDNGPIHDLVIECDTASVG  138

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+W F     G A+F F+
Sbjct  139  DPSLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWFFGTSL-GNAVFMFR  197



>ref|XP_008218232.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218233.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218234.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
 ref|XP_008218235.1| PREDICTED: uncharacterized protein LOC103318613 [Prunus mume]
Length=299

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREHV+G + + TKA     G+   + I+C   G +
Sbjct  133  GDMRKEAFKKTSASPVPSNAVCVAKREHVFGKRGFTTKAQFSNNGQLHDLVIECDTLGVN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLLVRVDSKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>ref|XP_008345708.1| PREDICTED: uncharacterized protein LOC103408652 [Malus domestica]
 ref|XP_008345709.1| PREDICTED: uncharacterized protein LOC103408652 [Malus domestica]
Length=299

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT      +    V KREH++G + +ATKA     G+   + I+C   G +
Sbjct  133  GDMRKEAFKKTSVTPVPSSAVCVAKREHIFGKRGFATKAQFCNNGQVHDLVIECDTVGVN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLLVRVDSKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>ref|XP_008388659.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
 ref|XP_008388660.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
 ref|XP_008388661.1| PREDICTED: uncharacterized protein LOC103451015 [Malus domestica]
Length=299

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREH++G + + TKA     G+   + I+C   G +
Sbjct  133  GDMRKEAFKKTSASPVPSSAVCVAKREHIFGKRGFTTKAQFCNNGQVHDLVIECDTVGVN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLLVRVDSKPVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLFGTSP-GNAVFMFK  251



>ref|XP_002277386.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659902.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659903.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659904.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659905.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659906.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659907.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659908.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659909.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659910.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659911.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659912.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
 ref|XP_010659913.1| PREDICTED: uncharacterized protein LOC100267457 [Vitis vinifera]
Length=305

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    + KRE+++G K++ TKA     G+   + I+C   G  
Sbjct  133  GDLRKEAFKKTNATPVPSNAVFIAKRENIFGKKVFRTKAQFCDNGQIHDLMIECDTIGVT  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPYLVIRVDSKIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNWLFSTTL-GNAVFLFK  251



>ref|XP_009117076.1| PREDICTED: uncharacterized protein LOC103842203 [Brassica rapa]
Length=350

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 109/201 (54%), Gaps = 31/201 (15%)
 Frame = -2

Query  708  RHAGNGQALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQI  529
            +H    Q LV + E+++G ++Y TK  + GK R I ID +V  DD  L FS+D+KKVL+I
Sbjct  168  KHRPKRQILVSRGENLFGNRVYHTKIKIKGKVREIGIDVKVH-DDATLRFSVDNKKVLKI  226

Query  528  KHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY-----ALFTFKFEKQSVgedgg  364
            + L+WKFRGN ++ ++   IQ+SWDV++W+F D +        A+F  +FE Q V     
Sbjct  227  EQLQWKFRGNAKVVIDDLTIQLSWDVYNWMFVDKDKANLVKVPAVFLLRFENQEVE----  282

Query  363  gggfrgkmvnGCGLGFETMLMKKG----LlrssrsssssslsstsasssctSVMEWESAE  196
                          G + ++MKK     L+    +S   S  ++S     +SVMEW + +
Sbjct  283  --------------GNDVLMMKKRERDYLVLGKENSRMLSFRASSYGHWSSSVMEWSTCK  328

Query  195  ENELKD---PPGFSLLVYAWK  142
            E + +       FSL+VYAW+
Sbjct  329  EEDERSFGHKSWFSLVVYAWR  349



>gb|KGN60826.1| hypothetical protein Csa_2G011590 [Cucumis sativus]
Length=335

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD ++EA+ K+ +    +    + K+EH++G K++ +KA     G+   I I+C   G  
Sbjct  169  GDLRREAFKKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQFCDNGQIHDIIIECDTNGVT  228

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L+  +D K VLQ+K L+WKFRGN  I VEG  ++V WDVHSWLF     G A+F FK
Sbjct  229  EPCLILRVDSKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLFSTSP-GNAVFMFK  287



>ref|XP_006382769.1| hypothetical protein POPTR_0005s05250g [Populus trichocarpa]
 gb|ERP60566.1| hypothetical protein POPTR_0005s05250g [Populus trichocarpa]
Length=299

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREHV+G K++ TKA     G+   + I+C   G  
Sbjct  133  GDMRKEAFKKTGATPIPSNAVFVAKREHVFGKKVFCTKARFCDNGQIHDLVIECDTIGVS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  I+V WDVH+WLF     G A+F FK
Sbjct  193  DPCLLVRVDCKTVMQVKRLRWKFRGNHTILVDGLAIEVFWDVHNWLFGASV-GNAVFMFK  251



>ref|XP_007050578.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007050579.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94735.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94736.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=246

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQAL-VLKREHVYGGKLYATKANVG--GKERRISIDC-RVAG  580
            GD +KEAY K       N  A+ + KREH++G K Y  KA     G+   + I+C  V  
Sbjct  79   GDLKKEAYKKIDTSAPVNSDAIFIAKREHIFGKKFYGAKAQFCDKGQMHDVIIECDTVDL  138

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
             DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F
Sbjct  139  KDPCLVIRIDSKTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMF  197

Query  399  K  397
            +
Sbjct  198  Q  198



>ref|XP_004139223.1| PREDICTED: uncharacterized protein LOC101220430 [Cucumis sativus]
 ref|XP_004156452.1| PREDICTED: uncharacterized LOC101220430 [Cucumis sativus]
Length=299

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD ++EA+ K+ +    +    + K+EH++G K++ +KA     G+   I I+C   G  
Sbjct  133  GDLRREAFKKSNSSPVPSSAVFISKKEHIFGKKVFCSKAQFCDNGQIHDIIIECDTNGVT  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L+  +D K VLQ+K L+WKFRGN  I VEG  ++V WDVHSWLF     G A+F FK
Sbjct  193  EPCLILRVDSKTVLQVKRLQWKFRGNHTILVEGLAVEVFWDVHSWLFSTSP-GNAVFMFK  251



>ref|XP_006650760.1| PREDICTED: uncharacterized protein LOC102720690 [Oryza brachyantha]
Length=291

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDC-RVAGD  577
            GD +K+A+ KT A       A V +REH+YG K+Y  KA     G+   + I+C  V+  
Sbjct  136  GDMRKDAFRKTGANRPMLNAAFVARREHIYGKKIYTAKAQFCENGQYHDVVIECDTVSIK  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF       A+F F+
Sbjct  196  DPCLEIRVDKKPVMQVKRLAWKFRGNQTILVDGLPVEVFWDVHSWLFGSMTSN-AVFMFQ  254



>gb|KDP21447.1| hypothetical protein JCGZ_21918 [Jatropha curcas]
Length=299

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDC-RVAGD  577
            GD +KEAY K       +    + KREH++G K Y  KA     G+   ++I+C  V   
Sbjct  133  GDMKKEAYKKIDNASIHSAAIFIAKREHIFGKKFYGAKAQFCDKGQMHDVTIECDTVDLK  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  193  DPCLVIRIDSKIVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  251



>ref|XP_003554710.1| PREDICTED: uncharacterized protein LOC100806479 [Glycine max]
Length=297

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +   LV K+EHV+G KL+ TKA     G    + I+C  A   
Sbjct  133  GDLRKEAFKKTNANPLPHNAVLVAKKEHVFGKKLHGTKAVFCDNGPIHDLVIECDTASVG  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+W F     G A+F F+
Sbjct  193  DPSLVIRIDSKTVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWFFGTSL-GNAVFMFR  251



>ref|XP_007050577.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94734.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=310

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQAL-VLKREHVYGGKLYATKANVG--GKERRISIDC-RVAG  580
            GD +KEAY K       N  A+ + KREH++G K Y  KA     G+   + I+C  V  
Sbjct  143  GDLKKEAYKKIDTSAPVNSDAIFIAKREHIFGKKFYGAKAQFCDKGQMHDVIIECDTVDL  202

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
             DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F
Sbjct  203  KDPCLVIRIDSKTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMF  261

Query  399  K  397
            +
Sbjct  262  Q  262



>ref|XP_009805050.1| PREDICTED: uncharacterized protein LOC104250176 [Nicotiana sylvestris]
Length=297

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA  KT A  + +G   + K+EH++G K++ TKA     G+   + I+C  +G  
Sbjct  131  GDMRKEATKKTSATPSASGAVFIAKKEHIFGKKVFGTKAQFCDNGRVHDLVIECDTSGTS  190

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K +LQ+K L+WKFRGN  + V+G  ++V WDVH+WLF     G  +F FK
Sbjct  191  DPCLVIRVDSKPMLQVKRLRWKFRGNHTLLVDGLGVEVFWDVHNWLFGTSA-GDGVFMFK  249



>ref|XP_007030623.1| Uncharacterized protein TCM_026394 [Theobroma cacao]
 gb|EOY11125.1| Uncharacterized protein TCM_026394 [Theobroma cacao]
Length=300

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEAY KT A    +    V K+EHV+G K++ TKA     G+   + I+C   G +
Sbjct  133  GDMRKEAYKKTGATPVPSTAVYVAKKEHVFGKKVFGTKAQFCDNGQIHDLIIECDTIGVN  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K ++Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPCLIIRLDGKTLMQVKRLRWKFRGNHTILVDGMAVEVYWDVHNWLFGASL-GNAVFMFK  251



>ref|XP_001770719.1| predicted protein [Physcomitrella patens]
 gb|EDQ64543.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRV-AGD  577
            GD   EAY KT+A+ A      V + EHV+G + + TKA    GGK   I I+C++    
Sbjct  131  GDMYNEAYKKTKAKPASIEAIRVSRSEHVFGKRYHCTKAQFEEGGKAHDIVIECQIRPSS  190

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P +   +D + V+Q+K L WKFRGN+ I V+G P++V WDVHSWLF +   G+A+F F+
Sbjct  191  EPRMYVRVDQQIVVQVKRLMWKFRGNQTIVVDGAPVEVFWDVHSWLF-NPRAGHAVFMFQ  249



>gb|AFK42653.1| unknown [Medicago truncatula]
Length=262

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 10/126 (8%)
 Frame = -2

Query  747  GDCQKEAYAKTRARH--AGNGQA---LVLKREHVYGGKLYATKANVGGKER----RISID  595
            GD +KEA  K  + +  +GN  +    + KREH++G K Y+ KA    K +    RI  D
Sbjct  90   GDLKKEACKKIDSDNNVSGNNNSDAIFIAKREHIFGKKFYSAKAQFCDKGKVHDVRIECD  149

Query  594  CRVAGDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY  415
              V  ++P LV  +D K V+Q+K LKWKFRGN+ + V+GFP++V WDVH+WLF +   G 
Sbjct  150  TLVGTNEPCLVIRIDSKIVMQVKQLKWKFRGNQTVLVDGFPVEVFWDVHNWLFGNAM-GN  208

Query  414  ALFTFK  397
            A+F F+
Sbjct  209  AVFMFQ  214



>gb|ACU19762.1| unknown [Glycine max]
Length=257

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ K+ A    +    V K+EHV+G K++  KA     G+   + I+C  +G  
Sbjct  134  GDLRKEAFKKSSAIPLPSNAVFVAKKEHVFGKKMFGNKAVFCDNGQIHDLVIECDTSGVS  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K LKWKFRGN  I V+G  ++V WDV++WLF     G A+F F+
Sbjct  194  DPCLIIRIDSKTVMQVKRLKWKFRGNHTILVDGLAVEVFWDVYNWLFGGTSLGNAVFMFR  253



>ref|XP_010090262.1| hypothetical protein L484_006168 [Morus notabilis]
 gb|EXB39200.1| hypothetical protein L484_006168 [Morus notabilis]
Length=299

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V K+EH++G +++ TKA     G+   ++I+C   G  
Sbjct  133  GDLRKEAFKKTGANPVASDAVFVAKKEHIFGKRVFTTKAQFCNNGQSHDLAIECDTIGVS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K ++Q+K L+WKFRGN  I V+G  I+V WD+H+WLF     G A+F FK
Sbjct  193  DPCLVIRVDGKNLMQVKRLRWKFRGNHTILVDGLAIEVFWDLHNWLFGASL-GNAVFMFK  251



>ref|XP_011090719.1| PREDICTED: uncharacterized protein LOC105171343 isoform X2 [Sesamum 
indicum]
Length=296

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRV-AGD  577
            GD +KEA  KT A  +     L+ KREH+ G ++Y TKA     G+   + I+C   + D
Sbjct  135  GDLRKEALKKTGAVASICSAVLISKREHISGKRVYGTKAQFCDNGQIHDLRIECDANSND  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V++I HL+WKFRGN  I V+G P++V WDVH+WLF     G A+F F+
Sbjct  195  DPCLMVRVDAKTVMRINHLQWKFRGNYTILVDGLPVEVFWDVHNWLFGPSL-GSAVFMFQ  253



>gb|KEH23778.1| plant/T24G3-80 protein [Medicago truncatula]
Length=307

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 10/126 (8%)
 Frame = -2

Query  747  GDCQKEAYAKTRARH--AGNGQA---LVLKREHVYGGKLYATKANVGGKER----RISID  595
            GD +KEA  K  + +  +GN  +    + KREH++G K Y+ KA    K +    RI  D
Sbjct  135  GDLKKEACKKIDSDNNVSGNNNSDAIFIAKREHIFGKKFYSAKAQFCDKGKVHDVRIECD  194

Query  594  CRVAGDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY  415
              V  ++P LV  +D K V+Q+K LKWKFRGN+ + V+GFP++V WDVH+WLF +   G 
Sbjct  195  TLVGTNEPCLVIRIDSKIVMQVKQLKWKFRGNQTVLVDGFPVEVFWDVHNWLFGNAM-GN  253

Query  414  ALFTFK  397
            A+F F+
Sbjct  254  AVFMFQ  259



>ref|XP_010929117.1| PREDICTED: uncharacterized protein LOC105050701 [Elaeis guineensis]
Length=404

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 130/257 (51%), Gaps = 54/257 (21%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN--GQALVLKREHVY-----GGKLYATKANVGGKERRISIDC-  592
            GD   EA+ +T+A    +     L+ +REHV      GG+ Y T+A  GGKER ISID  
Sbjct  148  GDLVDEAWRRTKAARGKSPWNSILISRREHVALEDSGGGRSYKTRALFGGKEREISIDLG  207

Query  591  -RVAGDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVE-GFPIQVSWDVHSWLFDDD---  427
             +    D G+   +D + VLQ++ LKWKFRG+ER+EVE G  IQVSWD+++W F      
Sbjct  208  KKEKERDVGMWLGVDGRNVLQVRRLKWKFRGSERVEVESGARIQVSWDLYNWFFQPKDKP  267

Query  426  ------------------EDGYALFTFKFEKQSVgedgggggfrgkmvnGCGLGFETML-  304
                              E G+A+F F+FE ++  E     GF G+    C  G    L 
Sbjct  268  HATASTAAAAAAAAAAAAELGHAVFVFRFEWEAGEERHFVKGFGGRARGVCYKGIGGFLG  327

Query  303  ----------------------MKKGLlrssrsssssslsstsasssctSVMEWESAEEN  190
                                   K G  +S   +SSSS SS+++S+S ++VMEW S EE 
Sbjct  328  KNRNRSQSSGGDCGGGGGGEVRRKMGRSQSLLKTSSSSPSSSASSASSSTVMEWASPEET  387

Query  189  ELKDPPGFSLLVYAWKS  139
            EL+   GF LLV+AWKS
Sbjct  388  ELQSADGFLLLVHAWKS  404



>ref|XP_010644630.1| PREDICTED: uncharacterized protein LOC100852612 [Vitis vinifera]
Length=308

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD + EAY +T ++ +     LV K+E+VYG +L+ TKA +G   KE  I I+  V+G  
Sbjct  140  GDLKNEAYKRTNSKPSLEEATLVYKKENVYGKRLFCTKAKLGEGKKEHDIVIENAVSGFG  199

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP +  S D   ++++ +L W+FRGNE + +   PIQ+ WDVH WLF+    G+ALF FK
Sbjct  200  DPEIWISADGIVLIRVMNLHWRFRGNETVFLNNLPIQIFWDVHDWLFNSPSLGHALFIFK  259



>emb|CDY50761.1| BnaAnng10680D [Brassica napus]
Length=287

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 78/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD  577
            GD +KEA+ KT A  + + G  ++ KREHV+G + + TKA     GK   + I+C V+  
Sbjct  130  GDMRKEAFKKTNAAPSSSLGAVIIAKREHVFGKRTFETKARFSNDGKTHDLVIECDVSVS  189

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP LV  +D K ++++K + WKFRGN+ + V+   ++V WDVHSW F      G+A+F F
Sbjct  190  DPCLVVRVDGKVLMKVKRVHWKFRGNDTMVVDRISVEVLWDVHSWFFGLPSSPGHAVFMF  249

Query  399  KFEKQSV  379
            +  +Q V
Sbjct  250  RTCQQPV  256



>ref|XP_009588422.1| PREDICTED: uncharacterized protein LOC104085995 [Nicotiana tomentosiformis]
Length=297

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA  KT A  + +G   + K+EH++G K++ TKA     G+   + I+C  +G  
Sbjct  131  GDMRKEATKKTGATPSASGAVFIAKKEHIFGKKVFGTKAQFCDNGRVHDLVIECDTSGTS  190

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K ++Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G  +F FK
Sbjct  191  DPCLVIRVDSKPMMQVKRLRWKFRGNHTILVDGLGVEVFWDVHNWLFGTSA-GDGVFMFK  249



>ref|XP_003545439.1| PREDICTED: putative uncharacterized protein DDB_G0282499-like 
[Glycine max]
Length=342

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 77/135 (57%), Gaps = 31/135 (23%)
 Frame = -2

Query  690  QALVLKREHVY----GGKLYATKANVGGKERRISIDC-----------RVAGDDPGLVFS  556
            Q LVLKR+HV+      ++Y TKA +GGK R I IDC                   L+F 
Sbjct  136  QLLVLKRDHVHVAPHRSRVYQTKARLGGKVREIEIDCDGYNGNGGGYENENESSLRLLFG  195

Query  555  MDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED---------------  421
            +D +KVL++  LKWKFRG+ER+E++G  +Q+SWDVH WLF+ D+D               
Sbjct  196  VDGEKVLEVTRLKWKFRGSERVEIDGVHVQISWDVHDWLFEKDKDNNHCSTNNNNNNNGN  255

Query  420  -GYALFTFKFEKQSV  379
             G+A+F FKFE+  V
Sbjct  256  EGHAVFVFKFEEDEV  270



>ref|XP_011090718.1| PREDICTED: uncharacterized protein LOC105171343 isoform X1 [Sesamum 
indicum]
Length=320

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRV-AGD  577
            GD +KEA  KT A  +     L+ KREH+ G ++Y TKA     G+   + I+C   + D
Sbjct  135  GDLRKEALKKTGAVASICSAVLISKREHISGKRVYGTKAQFCDNGQIHDLRIECDANSND  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V++I HL+WKFRGN  I V+G P++V WDVH+WLF     G A+F F+
Sbjct  195  DPCLMVRVDAKTVMRINHLQWKFRGNYTILVDGLPVEVFWDVHNWLFGPSL-GSAVFMFQ  253



>ref|XP_004493685.1| PREDICTED: uncharacterized protein LOC101510231 [Cicer arietinum]
Length=305

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTR--ARHAGNGQALVLKREHVYGGKLYATKANVGGKER----RISIDCRV  586
            GD +KEA  K    +    +    + KREH++G + Y  KA    K +    RI  D  V
Sbjct  135  GDLKKEACKKIDRDSVSVKSDAIFIAKREHIFGKRFYCVKAQFCHKGKVHDVRIECDTYV  194

Query  585  AGDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALF  406
              +DP LV  +D K V+Q+K LKWKFRGN+ I V+GFP++V WDVH+WLF +   G A+F
Sbjct  195  GTNDPCLVIIIDSKMVMQVKQLKWKFRGNQTILVDGFPVEVFWDVHNWLFGNTM-GNAVF  253

Query  405  TFK  397
             F+
Sbjct  254  MFQ  256



>emb|CBI28703.3| unnamed protein product [Vitis vinifera]
Length=273

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEA  K  +    +   L+ KREH++G +LY  KA     G+   I I+C   G  
Sbjct  106  GDLKKEACKKINSPPVPSTAVLIAKREHLFGKRLYFAKAQFCDKGQMHDIMIECDTVGVT  165

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L+  +D K V+Q+K L+WKFRGN  I V+G PI+V WDVH+WLF  +  G A+F F+
Sbjct  166  EPCLLIRIDSKMVMQVKRLQWKFRGNHTILVDGLPIEVFWDVHNWLF-GNAIGNAVFMFQ  224



>ref|XP_010942142.1| PREDICTED: uncharacterized protein LOC105060228 [Elaeis guineensis]
Length=389

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 87/145 (60%), Gaps = 23/145 (16%)
 Frame = -2

Query  747  GDCQKEAYAKTRA-RHAGNGQALVLKREHVY-----GGKLYATKANVGGKERRISID--C  592
            GD  +EAY K++A R   +   L+ +REHV       G+ Y T A  GG+ER ISID   
Sbjct  145  GDLLEEAYRKSKAGRGNSSNPILISRREHVVLGDSGDGRSYKTMARFGGEEREISIDLGT  204

Query  591  RVAGDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVE-GFPIQVSWDVHSWLFDDDED--  421
            +    D G++  +D K+VLQ++ L WKFRG+ER+EVE G  IQVSWD+H+WLF   ++  
Sbjct  205  KERERDVGMLLGVDGKRVLQVRRLGWKFRGSERVEVEGGTRIQVSWDLHNWLFQPKDEPP  264

Query  420  ------------GYALFTFKFEKQS  382
                        G+A+F F+FE+++
Sbjct  265  ATASTAAAAAELGHAVFVFRFEREA  289



>ref|XP_003536115.1| PREDICTED: uncharacterized protein LOC100778089 [Glycine max]
 gb|KHN16187.1| hypothetical protein glysoja_012163 [Glycine soja]
Length=301

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ K+ A    +    V K+EHV+G K++  KA     G+   + I+C  +G  
Sbjct  134  GDLRKEAFKKSSAIPLPSNAVFVAKKEHVFGKKMFGNKAVFCDNGQIHDLVIECDTSGVS  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K LKWKFRGN  I V+G  ++V WDV++WLF     G A+F F+
Sbjct  194  DPCLIIRIDSKTVMQVKRLKWKFRGNHTILVDGLAVEVFWDVYNWLFGGTSLGNAVFMFR  253



>gb|KJB46029.1| hypothetical protein B456_007G344900 [Gossypium raimondii]
Length=318

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEAY KT A         V K+EHV+G +++ TKA     G+   + I+C   G +
Sbjct  151  GDMKKEAYKKTNASPVPLDALFVAKKEHVFGRRVFGTKAQFCDTGRIHDLVIECDTIGVN  210

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K ++Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  211  DPCLVIRVDGKSLMQVKRLRWKFRGNYTILVDGMAVEVYWDVHNWLFGSSV-GNAVFMFK  269



>ref|XP_003632331.1| PREDICTED: uncharacterized protein LOC100853449 [Vitis vinifera]
Length=300

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEA  K  +    +   L+ KREH++G +LY  KA     G+   I I+C   G  
Sbjct  133  GDLKKEACKKINSPPVPSTAVLIAKREHLFGKRLYFAKAQFCDKGQMHDIMIECDTVGVT  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L+  +D K V+Q+K L+WKFRGN  I V+G PI+V WDVH+WLF  +  G A+F F+
Sbjct  193  EPCLLIRIDSKMVMQVKRLQWKFRGNHTILVDGLPIEVFWDVHNWLF-GNAIGNAVFMFQ  251



>ref|XP_011032694.1| PREDICTED: uncharacterized protein LOC105131425 [Populus euphratica]
Length=285

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 71/120 (59%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDC-RVAGD  577
            GD  KEAY K  +         + +REH++G K Y  KA     G+   ++I+C  +   
Sbjct  131  GDMAKEAYKKIESDPVHINAIFIARREHIFGKKFYGAKAQFCDKGQMHDVTIECDTIDLK  190

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  191  DPCLVIRIDSKMVMQVKRLKWKFRGNYTILVDGLPVEVFWDVHNWLFGNSM-GNAVFMFQ  249



>ref|XP_003626413.1| hypothetical protein MTR_7g114790 [Medicago truncatula]
 gb|AES82631.1| plant/T24G3-80 protein [Medicago truncatula]
Length=306

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 7/111 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRARH---AGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVA  583
            GD +KEA+ KT A     + N   LV K+EHV+G KLYATKA     G+   + I+C  A
Sbjct  132  GDLRKEAFKKTNAVPLPCSSNAAVLVAKKEHVFGKKLYATKAVFCNNGQIHDLVIECDTA  191

Query  582  G--DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
                DP L+  +D K V+++K L+WKFRGN  I V+G  + V WDVH+WLF
Sbjct  192  SGVSDPSLIIRLDSKIVMEVKRLRWKFRGNHTILVDGLAVDVFWDVHNWLF  242



>emb|CAN64151.1| hypothetical protein VITISV_041021 [Vitis vinifera]
Length=305

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    + KRE+++G K++ TKA     G+   + I+C   G  
Sbjct  133  GDLRKEAFKKTNATPVPSNAVFIAKRENIFGKKVFRTKAQFCDNGQIHDLMIECDTIGVT  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF     G A+F FK
Sbjct  193  DPYLAIRVDSKIVMQVKQLRWKFRGNHTIAVDGLAVEVFWDVHNWLFSTTL-GNAVFLFK  251



>ref|XP_009124203.1| PREDICTED: uncharacterized protein LOC103849150 [Brassica rapa]
Length=286

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 78/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD  577
            GD +KEA+ KT A  + + G  ++ KREHV+G + + TKA     GK   + I+C V+  
Sbjct  129  GDMRKEAFKKTNAAPSSSLGAVIMAKREHVFGKRTFETKAQFSNDGKTHDLVIECDVSVS  188

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP LV  +D K ++++K + WKFRGN+ + V+   ++V WDVHSW F      G+A+F F
Sbjct  189  DPCLVVLVDGKVLMKVKRVHWKFRGNDTMVVDRISVEVIWDVHSWFFGLPSSPGHAVFMF  248

Query  399  KFEKQSV  379
            +  +Q V
Sbjct  249  RTCQQPV  255



>emb|CDY72112.1| BnaC05g52260D [Brassica napus]
Length=282

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 77/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD  577
            GD ++EA+ KT A  + + G  ++ KREHV+G + + TKA     GK   + IDC V+  
Sbjct  126  GDMRREAFKKTNAAPSSSLGAVIIAKREHVFGKRTFETKARFSNDGKTHDLVIDCDVSVS  185

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP LV  +D K  +++K + WKFRGN+ + V+   ++V WDVHSW F      G+A+F F
Sbjct  186  DPCLVVRVDGKVSMKVKRVHWKFRGNDTMVVDRVSVEVLWDVHSWFFGVPSSPGHAVFMF  245

Query  399  KFEKQSV  379
            +  +Q V
Sbjct  246  RTCQQPV  252



>ref|XP_011026156.1| PREDICTED: uncharacterized protein LOC105126841 [Populus euphratica]
Length=299

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEAY K  +    +    + +REH++G K Y+ KA     G+   I+I+C      
Sbjct  133  GDMKKEAYKKIESPPVHSKAIFIARREHIFGKKFYSAKAQFSDRGQMHDITIECDTFDLK  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D + V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F F+
Sbjct  193  DPCLVIRIDGEMVMQVKRLKWKFRGNYTILVDGLPVEVFWDVHNWLFGNAM-GNAVFMFQ  251



>ref|XP_003518919.1| PREDICTED: uncharacterized protein LOC100793503 [Glycine max]
 gb|KHN18875.1| hypothetical protein glysoja_028244 [Glycine soja]
Length=301

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 73/122 (60%), Gaps = 6/122 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN--GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG  580
            GD +KEA  K  +  A +  G   + KREH+ G K Y  KA     G+   ++I+C   G
Sbjct  133  GDLKKEACKKIESDCAFSHCGAVCIAKREHIIGKKFYGAKAQFCDKGQVHDVTIECDTLG  192

Query  579  -DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFT  403
              DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVHSWLF +   G A+F 
Sbjct  193  PSDPSLVIRIDSKTVMQVKRLKWKFRGNHTILVDGVPVEVFWDVHSWLFGNAM-GNAVFM  251

Query  402  FK  397
            F+
Sbjct  252  FQ  253



>emb|CAN61445.1| hypothetical protein VITISV_024138 [Vitis vinifera]
Length=416

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEA  K  +    +   L+ KREH++G +LY  KA     G+   I I+C   G  
Sbjct  133  GDLKKEACKKINSPPVPSTAVLIAKREHLFGKRLYFAKAQFCDKGQMHDIMIECDTVGVT  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L+  +D K V+Q+K L+WKFRGN  I V+G PI+V WDVH+WLF  +  G A+F F+
Sbjct  193  EPCLLIRIDSKMVMQVKRLQWKFRGNHTILVDGLPIEVFWDVHNWLF-GNAIGNAVFMFQ  251



>gb|KJB22972.1| hypothetical protein B456_004G079100 [Gossypium raimondii]
 gb|KJB22973.1| hypothetical protein B456_004G079100 [Gossypium raimondii]
Length=173

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 71/121 (59%), Gaps = 5/121 (4%)
 Frame = -2

Query  747  GDCQKEAYAKT-RARHAGNGQALVLKREHVYGGKLYATKANVGGKERR--ISIDC-RVAG  580
            GD +KEA  K   + H  +    + KREH+ G K Y  KA    K R   + I+C  V  
Sbjct  6    GDLKKEAIKKIDTSAHLNSNAVFIAKREHIVGKKFYGAKAQFCDKGRMHDVVIECDTVDL  65

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
             DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF  +  G A+F F
Sbjct  66   MDPCLVIRIDSKTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLF-GNALGNAVFMF  124

Query  399  K  397
            +
Sbjct  125  Q  125



>ref|XP_009387555.1| PREDICTED: uncharacterized protein LOC103974443 [Musa acuminata 
subsp. malaccensis]
Length=301

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVA-GD  577
            GD +K+AY KTR+R +     LV K+E+V+G K +A +    G  KE  I +   +A   
Sbjct  132  GDRKKKAYKKTRSRPSLEEATLVSKKENVFGKKCFAARVRFDGRNKEHDIVVANSIAEHK  191

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP +  S+D   ++ + HL+WKFRGNE + VE  P+QV WDVH WLF     G+ALF FK
Sbjct  192  DPEMWISIDGVILIHVNHLQWKFRGNETVWVEQVPVQVLWDVHDWLFRGPGSGHALFMFK  251



>ref|XP_002319062.1| hypothetical protein POPTR_0013s03440g [Populus trichocarpa]
 gb|EEE94985.1| hypothetical protein POPTR_0013s03440g [Populus trichocarpa]
Length=299

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREHV+G K + TKA     G+   + I+C   G  
Sbjct  133  GDMRKEAFKKTGATPIPSNTVFVAKREHVFGKKAFRTKAQFCDNGQIHDLVIECDTIGVS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  +++ WDVH+WLF     G A+F FK
Sbjct  193  DPCLLLRVDCKTVMQVKQLRWKFRGNHTILVDGLAVELFWDVHNWLFGTSV-GNAVFMFK  251



>emb|CDX76763.1| BnaC08g33490D [Brassica napus]
Length=349

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 107/195 (55%), Gaps = 31/195 (16%)
 Frame = -2

Query  690  QALVLKREHVYGGKLYATKANVGGKERRISIDCRVAGDDPGLVFSMDDKKVLQIKHLKWK  511
            Q LV + E+++G ++Y TK  + GK R I +D +V  DD  L FS+D+KKVL+I+ L+WK
Sbjct  173  QILVSRGENLFGNRVYHTKIKIKGKVREIGVDVKV-HDDATLRFSVDNKKVLKIEQLRWK  231

Query  510  FRGNERIEVEGFPIQVSWDVHSWLFDDDEDGY-----ALFTFKFEKQSVgedgggggfrg  346
            FRGN ++ ++   IQ+SWDV++W+F D +        A+F  +FE Q V           
Sbjct  232  FRGNAKVVIDDVTIQISWDVYNWMFVDKDKANLAKVPAVFLLRFENQEVE----------  281

Query  345  kmvnGCGLGFETMLMKK----GLlrssrsssssslsstsasssctSVMEWESAEENELKD  178
                    G + ++MKK     ++    +S   S  ++S     +SVMEW + +E + + 
Sbjct  282  --------GNDVLMMKKRERDCVVLGKENSRMLSFRASSYGHWSSSVMEWSTCKEEDERS  333

Query  177  ---PPGFSLLVYAWK  142
                  FSL+VYAW+
Sbjct  334  FGHKSWFSLVVYAWR  348



>ref|XP_004958096.1| PREDICTED: uncharacterized protein LOC101782767 [Setaria italica]
Length=284

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD  K+   +  +  + +   ++ ++EH+Y  K+Y+ KA     G+   ISI+C  AG  
Sbjct  130  GDLHKQEEHRVLSDASHSDAVMIARKEHIYAKKVYSAKARFLDIGQLHHISIECDTAGVR  189

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D KKVLQ+K L WKFRGN+ I V+G P++V WDVH WLF     G A+F F+
Sbjct  190  DPSLEIRIDKKKVLQVKRLAWKFRGNQTIYVDGLPVEVLWDVHDWLFTSS-SGCAVFLFR  248



>ref|XP_011005698.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
 ref|XP_011005699.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
 ref|XP_011005700.1| PREDICTED: uncharacterized protein LOC105111908 [Populus euphratica]
Length=299

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ KT A    +    V KREHV+G K + TKA     G+   + I+C   G  
Sbjct  133  GDMRKEAFKKTGATPIPSNAVFVAKREHVFGKKAFRTKARFCDNGQIHDLVIECDTIGVS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K L+WKFRGN  I V+G  +++ WDVH+WLF     G A+F FK
Sbjct  193  DPCLLLRVDCKTVMQVKQLRWKFRGNHTILVDGLAVELFWDVHNWLFGTSV-GNAVFMFK  251



>ref|XP_008451346.1| PREDICTED: uncharacterized protein LOC103492661 [Cucumis melo]
Length=317

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 5/105 (5%)
 Frame = -2

Query  687  ALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG--DDPGLVFSMDDKKVLQIKHL  520
              V +REHV+G KLY+ KA     G+   +SI+C  +G   +P LV  +D K  +QIK L
Sbjct  155  VFVARREHVFGKKLYSAKAQFSEKGETHNVSIECDTSGGLKEPSLVIRIDSKTAMQIKRL  214

Query  519  KWKFRGNERIEVEGFPIQVSWDVHSWLF-DDDEDGYALFTFKFEK  388
            KWKFRGN+RI V+G P++V WDVH+WLF +      A+F F+  K
Sbjct  215  KWKFRGNDRIVVDGIPVEVMWDVHNWLFGNSGALSSAVFMFQTHK  259



>ref|XP_002300838.1| hypothetical protein POPTR_0002s05250g [Populus trichocarpa]
 gb|EEE80111.1| hypothetical protein POPTR_0002s05250g [Populus trichocarpa]
Length=299

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +KEAY K  +    +    + +REH++G K Y+ KA     G+   ++I+C      
Sbjct  133  GDMKKEAYKKIESSPVHSKAIFIARREHIFGKKFYSAKAQFSDKGQMHDVTIECDTFDLK  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K LKWKFRGN  I V+  P++V WDVH+WLF +   G A+F F+
Sbjct  193  DPCLVIRIDSKMVMQVKRLKWKFRGNYTILVDELPVEVFWDVHNWLFGNAM-GNAVFMFQ  251



>ref|XP_010253022.1| PREDICTED: uncharacterized protein LOC104594441 [Nelumbo nucifera]
Length=326

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGD-  577
            GD +KEAY +T++R +     L+ K+++V+G K +AT+A      KE  I ++  + G  
Sbjct  147  GDHKKEAYKRTKSRPSLADATLIYKKDNVFGKKCFATRAKFDERRKEHDIVVEISITGPK  206

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP +  S+D   ++ + +L+WKFRGNE I V   P+QV WDVH WLF     G+ LF FK
Sbjct  207  DPEMWISIDGIVLIHVTNLQWKFRGNETIRVNTIPVQVFWDVHDWLFSGQPTGHGLFIFK  266



>ref|XP_007162443.1| hypothetical protein PHAVU_001G152600g [Phaseolus vulgaris]
 gb|ESW34437.1| hypothetical protein PHAVU_001G152600g [Phaseolus vulgaris]
Length=301

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 74/122 (61%), Gaps = 6/122 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAG--NGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG  580
            GD +KEA  K  + +A   +    + KREHV+G K Y  +A     G+   + I+C   G
Sbjct  133  GDLKKEACKKIDSDYACAHSEAVFIAKREHVFGKKFYGARAQFCDKGQVHDVRIECDTLG  192

Query  579  -DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFT  403
             +DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F 
Sbjct  193  PNDPCLVIRIDSKTVMQVKQLKWKFRGNHTILVDGLPVEVFWDVHNWLFGNAM-GNAVFM  251

Query  402  FK  397
            F+
Sbjct  252  FQ  253



>ref|XP_002520723.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41685.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 70/120 (58%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDC-RVAGD  577
            GD +KEAY K       +    + K+EH++G K Y  K      G+   I+I+C  V   
Sbjct  133  GDLKKEAYKKIEDAPLHSNAIFIAKKEHIFGKKFYGAKVQFCDKGQMHDIAIECDTVDLK  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF     G A+F F+
Sbjct  193  DPCLVIRIDSKMVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLFGSGM-GNAVFMFQ  251



>ref|XP_006408140.1| hypothetical protein EUTSA_v10021255mg [Eutrema salsugineum]
 ref|XP_006408141.1| hypothetical protein EUTSA_v10021255mg [Eutrema salsugineum]
 gb|ESQ49593.1| hypothetical protein EUTSA_v10021255mg [Eutrema salsugineum]
 gb|ESQ49594.1| hypothetical protein EUTSA_v10021255mg [Eutrema salsugineum]
Length=288

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGD  577
            GD +KEA+ KT A  + + G   + K+EHV+G + +ATKA   G  K   + I+C  +  
Sbjct  133  GDMKKEAFRKTNAAPSSSLGAVFIGKKEHVFGKRTFATKAQFSGDGKTHDLVIECDTSIS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP LV  +D K ++Q+K L WKFRGN+ I V    ++V WDVHSW F      G A+F F
Sbjct  193  DPCLVVRVDGKTLMQVKRLHWKFRGNDTIIVNRISVEVLWDVHSWFFGLPSSPGNAVFMF  252

Query  399  K  397
            +
Sbjct  253  R  253



>ref|XP_004955779.1| PREDICTED: uncharacterized protein LOC101785301 [Setaria italica]
Length=313

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG--  580
            GD +KEAY KT A        LV ++EHV   K+++ KA     G+   I I+C  AG  
Sbjct  157  GDMRKEAYRKTAADRPAVDALLVARKEHVVSKKVFSAKAQFSHHGRCHDIVIECDTAGAN  216

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
            DDP LV  +D + V++++ L WKFRGN+ + V+G P++V WDVH WLF       A+F F
Sbjct  217  DDPCLVIHIDRRPVMRVRRLAWKFRGNQTVLVDGLPVEVFWDVHGWLFGSAASS-AVFMF  275

Query  399  K  397
            +
Sbjct  276  Q  276



>ref|XP_004494682.1| PREDICTED: uncharacterized protein LOC101496846 [Cicer arietinum]
Length=302

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 67/111 (60%), Gaps = 7/111 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRA---RHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVA  583
            GD +KEA+ KT A       N   LV K+EHV+G KLY TKA     G+   + I+C   
Sbjct  130  GDLRKEAFKKTNAVPLPSNSNAAVLVAKKEHVFGKKLYGTKAVFCDNGQIHDLVIECDTT  189

Query  582  G--DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLF  436
                DP L+  +D K V+Q+K L+WKFRGN  I V+G  ++V WDVH+WLF
Sbjct  190  SGVSDPCLIIRIDSKIVMQVKRLRWKFRGNHTILVDGLAVEVFWDVHNWLF  240



>ref|XP_004146978.1| PREDICTED: uncharacterized protein LOC101203661 [Cucumis sativus]
Length=318

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -2

Query  675  KREHVYGGKLYATKANVG--GKERRISIDCRVAG--DDPGLVFSMDDKKVLQIKHLKWKF  508
            +REHV+G KLY+ KA     G+   +SI+C  +G   +P LV  +D K  +QIK LKWKF
Sbjct  164  RREHVFGKKLYSAKAQFSERGETHNVSIECDTSGGLKEPSLVIRIDSKTAMQIKRLKWKF  223

Query  507  RGNERIEVEGFPIQVSWDVHSWLF-DDDEDGYALFTFKFEK  388
            RGN+RI V+G P++V WDVH+WLF +      A+F F+  K
Sbjct  224  RGNDRIVVDGIPVEVMWDVHNWLFGNSGALSSAVFMFQTHK  264



>ref|XP_004158912.1| PREDICTED: uncharacterized protein LOC101227560 [Cucumis sativus]
 gb|KGN44806.1| hypothetical protein Csa_7G388390 [Cucumis sativus]
Length=319

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -2

Query  675  KREHVYGGKLYATKANVG--GKERRISIDCRVAG--DDPGLVFSMDDKKVLQIKHLKWKF  508
            +REHV+G KLY+ KA     G+   +SI+C  +G   +P LV  +D K  +QIK LKWKF
Sbjct  164  RREHVFGKKLYSAKAQFSERGETHNVSIECDTSGGLKEPSLVIRIDSKTAMQIKRLKWKF  223

Query  507  RGNERIEVEGFPIQVSWDVHSWLF-DDDEDGYALFTFKFEK  388
            RGN+RI V+G P++V WDVH+WLF +      A+F F+  K
Sbjct  224  RGNDRIVVDGIPVEVMWDVHNWLFGNSGALSSAVFMFQTHK  264



>gb|KHN10674.1| hypothetical protein glysoja_019105 [Glycine soja]
Length=304

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQA---LVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD +KEA  K  + +A    +    + KREH++G K Y  KA     G+   + I+C   
Sbjct  133  GDLKKEACKKIDSDYACADHSEAVFIAKREHIFGKKFYGAKAQFCDKGQVHDVRIECDTL  192

Query  582  G-DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALF  406
            G +DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F
Sbjct  193  GLNDPCLVIRIDSKTVMQVKQLKWKFRGNHTILVDGIPVEVFWDVHNWLFGNAM-GDAVF  251

Query  405  TFK  397
             F+
Sbjct  252  MFQ  254



>ref|XP_007144817.1| hypothetical protein PHAVU_007G186400g [Phaseolus vulgaris]
 gb|AGV54810.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW16811.1| hypothetical protein PHAVU_007G186400g [Phaseolus vulgaris]
Length=299

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ K+ A    +   +V K+EHV+G K++  KA     G+   + I+C  +G  
Sbjct  133  GDLRKEAFKKSSAIPLPSNAVIVAKKEHVFGKKMFGNKAVFCDNGQIHDLVIECDTSGVS  192

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K LKWKFRGN  I V+G  ++V WDV++WLF     G A+F F+
Sbjct  193  DPCLIIRIDSKTVMQVKRLKWKFRGNHTILVDGLAVEVFWDVYNWLFGTSL-GNAVFMFR  251



>gb|KJB22971.1| hypothetical protein B456_004G079100 [Gossypium raimondii]
Length=307

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 71/121 (59%), Gaps = 5/121 (4%)
 Frame = -2

Query  747  GDCQKEAYAKT-RARHAGNGQALVLKREHVYGGKLYATKANVGGKERR--ISIDC-RVAG  580
            GD +KEA  K   + H  +    + KREH+ G K Y  KA    K R   + I+C  V  
Sbjct  140  GDLKKEAIKKIDTSAHLNSNAVFIAKREHIVGKKFYGAKAQFCDKGRMHDVVIECDTVDL  199

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
             DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF  +  G A+F F
Sbjct  200  MDPCLVIRIDSKTVMQVKRLKWKFRGNHTILVDGLPVEVFWDVHNWLF-GNALGNAVFMF  258

Query  399  K  397
            +
Sbjct  259  Q  259



>ref|XP_002884475.1| hypothetical protein ARALYDRAFT_477757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60734.1| hypothetical protein ARALYDRAFT_477757 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGD  577
            GD +KEA+ KT A  + + G   + K+EHV+G + +ATKA   G  K   + I+C  +  
Sbjct  134  GDMKKEAFKKTNAAPSSSLGALFIAKKEHVFGKRTFATKAQFSGDGKTHDLVIECDTSIS  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP L+  +D K ++Q++ L WKFRGN+ I V    ++V WDVHSW F      G A+F F
Sbjct  194  DPCLIVRVDGKTLMQVQRLHWKFRGNDTIIVNRISVEVLWDVHSWFFGMPSSPGNAVFMF  253

Query  399  K  397
            +
Sbjct  254  R  254



>ref|XP_003521248.2| PREDICTED: uncharacterized protein LOC100799355 [Glycine max]
Length=313

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQA---LVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD +KEA  K  + +A    +    + KREH++G K Y  KA     G+   + I+C   
Sbjct  133  GDLKKEACKKIDSDYACADHSEAVFIAKREHIFGKKFYGAKAQFCDKGQVHDVRIECDTL  192

Query  582  G-DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALF  406
            G +DP LV  +D K V+Q+K LKWKFRGN  I V+G P++V WDVH+WLF +   G A+F
Sbjct  193  GLNDPCLVIRIDSKTVMQVKQLKWKFRGNHTILVDGIPVEVFWDVHNWLFGNAM-GDAVF  251

Query  405  TFK  397
             F+
Sbjct  252  MFQ  254



>gb|AAM65821.1| unknown [Arabidopsis thaliana]
Length=289

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGD  577
            GD +KEA+ KT A  + + G   + K+EHV+G + +ATKA   G  K   + I+C  +  
Sbjct  134  GDIKKEAFKKTNAAPSSSLGAVFIAKKEHVFGKRTFATKAQFSGDGKTHDLVIECDTSLS  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP L+  +D K ++Q++ L WKFRGN+ I V    ++V WDVHSW F      G A+F F
Sbjct  194  DPCLIVRVDGKILMQVQRLHWKFRGNDTIIVNRISVEVLWDVHSWFFGLPSSPGNAVFMF  253

Query  399  K  397
            +
Sbjct  254  R  254



>ref|XP_003556459.1| PREDICTED: uncharacterized protein LOC100802422 isoform 1 [Glycine 
max]
 gb|KHN04941.1| hypothetical protein glysoja_013848 [Glycine soja]
Length=300

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +KEA+ K+ A    +    V K+EHV+G K++  KA     G+   + I+C  +G  
Sbjct  134  GDLRKEAFKKSSAIPLPSNAVFVAKKEHVFGKKMFGNKAVFCDNGQIHDLVIECDTSGVS  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L+  +D K V+Q+K LKWKFRGN  I V+G  ++V WDV++WLF     G A+F F+
Sbjct  194  DPCLIIRIDSKTVMQVKRLKWKFRGNHTILVDGLAVEVFWDVYNWLFGTSL-GNAVFMFR  252



>ref|NP_566240.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51405.1|AC009465_5 unknown protein; 64727-65596 [Arabidopsis thaliana]
 gb|AAL27500.1|AF439828_1 AT3g04860/T9J14_19 [Arabidopsis thaliana]
 gb|AAM78072.1| AT3g04860/T9J14_19 [Arabidopsis thaliana]
 gb|AEE74147.1| uncharacterized protein AT3G04860 [Arabidopsis thaliana]
Length=289

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN-GQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGD  577
            GD +KEA+ KT A  + + G   + K+EHV+G + +ATKA   G  K   + I+C  +  
Sbjct  134  GDMKKEAFKKTNAAPSSSLGAVFIAKKEHVFGKRTFATKAQFSGDGKTHDLVIECDTSLS  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTF  400
            DP L+  +D K ++Q++ L WKFRGN+ I V    ++V WDVHSW F      G A+F F
Sbjct  194  DPCLIVRVDGKILMQVQRLHWKFRGNDTIIVNRISVEVLWDVHSWFFGLPSSPGNAVFMF  253

Query  399  K  397
            +
Sbjct  254  R  254



>gb|KHN43917.1| hypothetical protein glysoja_025956 [Glycine soja]
Length=243

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 76/121 (63%), Gaps = 4/121 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            GD +K+AY +T+++ + +  AL+ KR++VYG K++ T+A +  G  E  + I+  + G D
Sbjct  76   GDLEKDAYERTKSKPSLDEAALLCKRDNVYGKKMFCTRAILEDGKTEHDVVIEASLCGPD  135

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDED-GYALFTF  400
            DP +  S+D     +I +L W+FRGNE + V   P+Q+ WDVH WLF +D   G A F F
Sbjct  136  DPEMWISIDGMLASRIMNLHWRFRGNEILMVNNLPVQIFWDVHDWLFTNDLGLGPAFFVF  195

Query  399  K  397
            K
Sbjct  196  K  196



>gb|KJB10213.1| hypothetical protein B456_001G189700 [Gossypium raimondii]
Length=311

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%), Gaps = 3/119 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGGK--ERRISIDCRVAG-D  577
            GD +K+AY +T++R A     L  K+E+V+G K +ATK   G K  E  I ++   +G  
Sbjct  143  GDYKKKAYKRTKSRPALVEPLLYYKKENVFGKKSFATKVRFGKKRKEHDIIVESATSGLK  202

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
            DP +  SMD   ++ +K+L+WKFRGN+ + V+  P+QV WDVH WLF     G+ LF F
Sbjct  203  DPEMWISMDGVVLIHVKNLQWKFRGNQTVLVDKQPVQVMWDVHDWLFTSPGTGHGLFIF  261



>ref|XP_010532946.1| PREDICTED: uncharacterized protein LOC104808831 [Tarenaya hassleriana]
Length=303

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGD-  577
            GDC+K+A+ +T++R A    AL  K+E+V+G K ++T+A      KE  I ++   +G  
Sbjct  134  GDCKKKAFKRTKSRPALVDAALFYKKENVFGKKSFSTRAKFHDRKKEHEIVVESSASGPK  193

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P +  S+D   ++Q+K+L+WKFRGN+ + V+  PIQV WDV  WLF     G+ LF FK
Sbjct  194  EPEMWISIDGIVLVQVKNLQWKFRGNQTVLVDKQPIQVFWDVFDWLFSSPGTGHGLFIFK  253



>ref|XP_006298244.1| hypothetical protein CARUB_v10014305mg [Capsella rubella]
 gb|EOA31142.1| hypothetical protein CARUB_v10014305mg [Capsella rubella]
Length=289

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN--GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG  580
            GD +KEA+ KT A  + +  G   + K+EHV+G + +ATKA     GK   + I+C    
Sbjct  133  GDMRKEAFKKTSAAPSSSSLGAVFIAKKEHVFGKRSFATKAQFSDDGKTHDLLIECDTTL  192

Query  579  DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFT  403
             DP L+  +D K ++Q+  L WKFRGN+ I V    ++V WDVHSW F      G A+F 
Sbjct  193  SDPCLILRVDGKTLMQVNRLHWKFRGNDTIIVNRLSVEVLWDVHSWFFGLPSTAGNAVFM  252

Query  402  FKFEKQSV  379
            F+   QSV
Sbjct  253  FR-TTQSV  259



>emb|CDY30020.1| BnaC01g39880D [Brassica napus]
Length=282

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 76/126 (60%), Gaps = 5/126 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGDD  574
            GD +KEA+ KT A  + +    + K+EHV+G + +ATKA   G  +   + ++C  +  D
Sbjct  129  GDMKKEAFKKTNAASSLSA-VFIAKKEHVFGKRTFATKAQFSGDGETHDLVVECDTSISD  187

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFK  397
            P L+ S+D K ++++K L+WKFRGNE I V    ++V WDVHSW F      G  +F F+
Sbjct  188  PCLIVSVDGKTLMEVKRLRWKFRGNETIVVNRVSVEVLWDVHSWFFGVPSSPGNGVFMFR  247

Query  396  FEKQSV  379
              +Q+V
Sbjct  248  -TRQAV  252



>emb|CDY21108.1| BnaA01g33390D [Brassica napus]
Length=282

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGDD  574
            GD +KEA  KT+A  +  G   + K+EHV+G + +ATKA   G  +   + ++C  +  D
Sbjct  129  GDMKKEALKKTKA-ASSLGAVFIAKKEHVFGKRTFATKAQFSGDGETHDLVVECDTSVSD  187

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFK  397
            P LV  +D K ++++K L+WKFRGNE I V    ++V WDVHSW F      G  +F F+
Sbjct  188  PCLVVCVDGKTLMEVKRLRWKFRGNETIVVNRVSVEVLWDVHSWFFGVPSSPGNGVFMFR  247



>ref|XP_006857698.1| hypothetical protein AMTR_s00061p00168530 [Amborella trichopoda]
 gb|ERN19165.1| hypothetical protein AMTR_s00061p00168530 [Amborella trichopoda]
Length=286

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG---GKERRISIDCRVAGD  577
            GD +KEA+ KT+AR +     L+ KREHV+G + + T+A       K   I I+C V G 
Sbjct  137  GDLKKEAFKKTKARPSLTDAVLLSKREHVFGKRSFVTRARFDERVNKAHEIIIECPVNGI  196

Query  576  -DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTF  400
             +  L  S+D   ++Q+ +L+WKFRGN+ I V   P+QV WDVH W+F     G+ALF F
Sbjct  197  LNHELWISIDGMVLIQVNNLQWKFRGNDTIMVNKLPVQVFWDVHDWIFGIG-SGHALFIF  255

Query  399  K  397
            K
Sbjct  256  K  256



>ref|XP_011097721.1| PREDICTED: uncharacterized protein LOC105176569 [Sesamum indicum]
 ref|XP_011097722.1| PREDICTED: uncharacterized protein LOC105176569 [Sesamum indicum]
Length=295

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG-GKERRISIDCRVAGD-D  574
            GD QKEA  +T++R      +LV K+E V+  K + TK  +G  KE  I I+  ++G  D
Sbjct  132  GDQQKEALRRTKSRLPSEDASLVQKKEIVFAKKCFCTKTTLGQDKEHSIIIESSLSGPYD  191

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            P +  S+D  + +++ +L W+FRGNE I V+  P+Q+ WDVH WL++ +  G  +F F+
Sbjct  192  PEMWISVDGMESIRVPNLHWRFRGNETILVDNSPVQILWDVHDWLYNGNHSGVGIFVFR  250



>gb|EYU30508.1| hypothetical protein MIMGU_mgv1a010362mg [Erythranthe guttata]
Length=314

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 70/120 (58%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHA-GNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD  577
            GD +KEA  +T    +      LV KREH++G K++ TKA          ++I+C  + D
Sbjct  148  GDLRKEALKRTNCTPSLSRSVVLVSKREHIFGKKVFTTKAKFSDFTPAHDLAIECDNSMD  207

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P L   +D K V+ +K L+WKFRGN+ I V+G  ++V WDVH+WLF     G  +F FK
Sbjct  208  EPFLAIRLDSKLVVHVKRLRWKFRGNDTIRVDGVDVEVFWDVHNWLFGTTSFGNGVFMFK  267



>gb|EMT06649.1| hypothetical protein F775_13550 [Aegilops tauschii]
Length=283

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -2

Query  687  ALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGD-DPGLVFSMDDKKVLQIKHLK  517
            A++ ++EH YG K+Y TKA     G+   I+I+C  +G  DP L   +  K+VLQ+K L 
Sbjct  149  AMIARKEHTYGKKVYCTKARFSDIGQHHHITIECDTSGTKDPSLEIRIGKKRVLQVKRLA  208

Query  516  WKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            WKFRGN+   V+G P++V WDVH WLF    +G A+F F+
Sbjct  209  WKFRGNQTFYVDGLPVEVLWDVHDWLF-GSSNGCAVFLFQ  247



>ref|XP_011458574.1| PREDICTED: uncharacterized protein LOC101299437 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=292

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 70/120 (58%), Gaps = 5/120 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD ++E        H  N    V KREH++G KLY  KA     GK   ++I+C   G +
Sbjct  114  GDLKREVLGVKDPIHGSNA-VFVAKREHIFGKKLYGAKAQFCDKGKTHDVTIECETVGLN  172

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P LV  +D K V+++K L WKFRGN  I V+G  I+V WDVH+WLF +   G A+F F+
Sbjct  173  EPYLVICVDSKTVMKVKKLNWKFRGNHTILVDGLRIEVFWDVHNWLFGNSM-GDAVFMFQ  231



>ref|XP_003617887.1| Kinesin-4 [Medicago truncatula]
Length=1503

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  747   GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
             GD   +AY +T+++ +     L+ K+E+V G KL+ T+A +  G  E  + I+  ++G D
Sbjct  1338  GDLTNDAYVRTKSKPSSEEATLLCKKENVQGKKLFCTRAMLEEGKPEHDVVIETSLSGPD  1397

Query  576   DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
             DP +  S+D     +I +L WKFRGNE + V   P+Q+ WDVH WLF+D   G A+F FK
Sbjct  1398  DPEMWISIDGMLASRIMNLNWKFRGNEIVMVNNLPVQIFWDVHDWLFNDLGSGPAVFIFK  1457



>emb|CDY00849.1| BnaCnng00490D [Brassica napus]
Length=291

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAGD-  577
            GD +K+A+ +T++R A    AL  K+E+V+G K +AT+A      KE  I+++  ++G  
Sbjct  135  GDYKKKAFKRTKSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTK  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P +  S+D   ++Q+K+L+WKFRGN+ + V+  P+QV WDV+ WLF     G+ LF FK
Sbjct  195  EPEMWISIDGIVLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSAPGTGHGLFIFK  254



>emb|CDY27882.1| BnaA07g04720D [Brassica napus]
Length=291

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAGD-  577
            GD +K+A+ +T++R A    AL  K+E+V+G K +AT+A      KE  I+++  ++G  
Sbjct  135  GDYKKKAFKRTKSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTK  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P +  S+D   ++Q+K+L+WKFRGN+ + V+  P+QV WDV+ WLF     G+ LF FK
Sbjct  195  EPEMWISIDGIVLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSAPGTGHGLFIFK  254



>ref|XP_010419519.1| PREDICTED: uncharacterized protein LOC104705248 [Camelina sativa]
Length=291

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN---GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD +KEA+ KT A  + +   G   + K+EHV+G + +ATKA     GK   + I+C  +
Sbjct  134  GDMRKEAFKKTNAAPSSSSSLGAVFIAKKEHVFGKRTFATKAQFSDDGKTHDLVIECDTS  193

Query  582  GDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALF  406
              DP L+  +D K ++Q+  L WKFRGN+ I V    ++V WDVHSW F      G A+F
Sbjct  194  MSDPCLIVRVDGKILMQVNRLHWKFRGNDTIIVNRISVEVLWDVHSWFFGLPSMAGNAVF  253

Query  405  TFK  397
             F+
Sbjct  254  MFR  256



>ref|XP_004290606.1| PREDICTED: uncharacterized protein LOC101299437 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=315

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 70/120 (58%), Gaps = 5/120 (4%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD ++E        H  N    V KREH++G KLY  KA     GK   ++I+C   G +
Sbjct  137  GDLKREVLGVKDPIHGSNA-VFVAKREHIFGKKLYGAKAQFCDKGKTHDVTIECETVGLN  195

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P LV  +D K V+++K L WKFRGN  I V+G  I+V WDVH+WLF +   G A+F F+
Sbjct  196  EPYLVICVDSKTVMKVKKLNWKFRGNHTILVDGLRIEVFWDVHNWLFGNSM-GDAVFMFQ  254



>ref|XP_009763291.1| PREDICTED: uncharacterized protein LOC104215233 [Nicotiana sylvestris]
Length=302

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAG-D  577
            GD  KEA+ +T++R A     LV K+E VY  K + T+  +G   K+  I+I+C ++G  
Sbjct  139  GDQNKEAFKRTKSRPALMDVVLVHKKETVYAKKYFCTRTMLGQGKKQHDITIECVISGPS  198

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP +  S+D    ++I +L W+FRGNE + V+  P+++ WDVH WL+     G   F FK
Sbjct  199  DPAMWISVDGTVSIRITNLHWRFRGNETVFVDNVPVEIFWDVHDWLYSGPHSGPGTFIFK  258



>ref|XP_003544282.1| PREDICTED: uncharacterized protein LOC100810973 [Glycine max]
 gb|KHN40039.1| hypothetical protein glysoja_009416 [Glycine soja]
Length=305

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKA--NVGGKERRISIDCRVAG-D  577
            GD +K+AY +T++R A     ++LK+E+V   K ++TKA  N   K+  I +D    G  
Sbjct  138  GDYKKKAYKRTKSRPALVDAMMLLKKENVLAKKSFSTKARFNEKRKDSEIVVDSSTGGPS  197

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP +  S+D   ++ +K+L+WKFRGN+ + V   P+QV WDVH WLF     G+ LF FK
Sbjct  198  DPEMWISIDGIVLIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSGSGSGHGLFIFK  257



>gb|AET00846.2| kinesin heavy chain, putative [Medicago truncatula]
Length=1462

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  747   GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
             GD   +AY +T+++ +     L+ K+E+V G KL+ T+A +  G  E  + I+  ++G D
Sbjct  1297  GDLTNDAYVRTKSKPSSEEATLLCKKENVQGKKLFCTRAMLEEGKPEHDVVIETSLSGPD  1356

Query  576   DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
             DP +  S+D     +I +L WKFRGNE + V   P+Q+ WDVH WLF+D   G A+F FK
Sbjct  1357  DPEMWISIDGMLASRIMNLNWKFRGNEIVMVNNLPVQIFWDVHDWLFNDLGSGPAVFIFK  1416



>ref|XP_006452672.1| hypothetical protein CICLE_v10010821mg [Citrus clementina]
 gb|ESR65912.1| hypothetical protein CICLE_v10010821mg [Citrus clementina]
Length=292

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 71/120 (59%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG-GKERR-ISIDCRVAGD-  577
            GD   +AY +T+ R       L+ K+E+VYG KL+ T+A +G GKE   I I+  + G  
Sbjct  142  GDSPNDAYKRTKKRPTFPEATLLCKKENVYGKKLFCTRALLGDGKEEHDIVIENSLFGPG  201

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP +  S+D    ++I +L W+FRGNE I +    IQ+ WDVH WLF++    Y LF FK
Sbjct  202  DPEMWISIDGISTIRILNLNWRFRGNETISMNDTSIQIYWDVHDWLFNESSPSYGLFIFK  261



>ref|XP_010485871.1| PREDICTED: uncharacterized protein LOC104764117 [Camelina sativa]
Length=293

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN---GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD +KEA+ KT A  + +   G   + K+EHV+G + +ATKA     GK   + I+C  +
Sbjct  136  GDMRKEAFKKTNAAPSSSSSLGAVFIAKKEHVFGKRTFATKAQFSDDGKTHDLVIECDTS  195

Query  582  GDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALF  406
              DP L+  +D K ++Q+  L WKFRGN+ I V    ++V WDVHSW F      G A+F
Sbjct  196  MSDPCLIVRVDGKILMQVNRLHWKFRGNDTIIVNRISVEVLWDVHSWFFGLPSVAGNAVF  255

Query  405  TFK  397
             F+
Sbjct  256  MFR  258



>gb|AFG57306.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57307.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57308.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57309.1| hypothetical protein 0_630_01, partial [Pinus taeda]
 gb|AFG57310.1| hypothetical protein 0_630_01, partial [Pinus taeda]
Length=132

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -2

Query  687  ALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAGDD-PGLVFSMDDKKVLQIKHLK  517
             LV +++H+ G +  +T A  G  G+  ++SI+C   GDD P L  S+D K  +++  L 
Sbjct  4    VLVSRKQHIVGKECLSTVAQFGDGGRSHQVSIECCTRGDDDPALFISVDRKLAVEVNQLP  63

Query  516  WKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            WKFRGN+ I VEG P+Q+ WDVH WLF+    G+ALF FK
Sbjct  64   WKFRGNDTIYVEGVPVQILWDVHDWLFNPGI-GHALFIFK  102



>ref|XP_009102402.1| PREDICTED: uncharacterized protein LOC103828543 [Brassica rapa]
Length=302

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGD-  577
            GD +K+A+ +T++R A    AL  K+E+V+G K +AT+A      KE  I+++  ++G  
Sbjct  135  GDYKKKAFKRTKSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTK  194

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P +  S+D   ++Q+K+L+WKFRGN+ + V+  P+QV WDV+ WLF     G+ LF FK
Sbjct  195  EPEMWISIDGIVLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSAPGTGHGLFIFK  254



>ref|XP_009124977.1| PREDICTED: uncharacterized protein LOC103850026 [Brassica rapa]
Length=282

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 70/120 (58%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVGG--KERRISIDCRVAGDD  574
            GD +KEA+ KT    +  G   + K+EHV+G + +ATKA   G  +   + ++C  +  D
Sbjct  129  GDMKKEAFKKTNT-ASSLGAVFIAKKEHVFGKRTFATKARFSGDGETHDLVVECDTSVSD  187

Query  573  PGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALFTFK  397
            P LV  +D K ++++K L+WKFRGNE I V    ++V WDVHSW F      G  +F F+
Sbjct  188  PCLVVCVDGKTLMEVKRLRWKFRGNETIVVNRVSVEVLWDVHSWFFGVPSSPGNGVFMFR  247



>gb|KJB10781.1| hypothetical protein B456_001G224000 [Gossypium raimondii]
Length=309

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            GD +K+AY +T+AR A     L+ K+E+V+  K +AT+A      KE  I ++  + G  
Sbjct  143  GDYKKKAYKRTKARPALVQPFLIYKKENVFAKKSFATRARFDEKSKEHEIVVESSMTGIK  202

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            +P +  SMD   ++ +K+L+WKFRGN+ + V+  P+QV WDVH W+F     G+ +F FK
Sbjct  203  EPEMWISMDGVVLIHVKNLQWKFRGNQTVLVDKQPVQVMWDVHDWMFSSLGTGHGMFIFK  262



>ref|NP_001143196.1| uncharacterized protein LOC100275698 [Zea mays]
 gb|ACG29652.1| hypothetical protein [Zea mays]
Length=284

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANV--GGKERRISIDCRVAG-D  577
            G+  KE   +  +  +     ++ ++EH+Y  K+Y+ KA     G+   ISI+C +AG  
Sbjct  129  GNLSKEEDHRVLSDASHCDAVMIARKEHIYAKKMYSAKARFLDIGQIHHISIECDMAGVR  188

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D KKVL +K L WKFRGN+ I V+G P++V WDVH WLF    +G A+F F+
Sbjct  189  DPCLEIRIDKKKVLHLKRLAWKFRGNQTIYVDGLPVEVLWDVHDWLFGST-NGCAVFLFQ  247



>ref|XP_008651185.1| PREDICTED: uncharacterized protein LOC100275698 isoform X1 [Zea 
mays]
 gb|ACF82722.1| unknown [Zea mays]
 gb|ACN25273.1| unknown [Zea mays]
 tpg|DAA63241.1| TPA: hypothetical protein ZEAMMB73_389417 [Zea mays]
 tpg|DAA63242.1| TPA: hypothetical protein ZEAMMB73_389417 [Zea mays]
Length=284

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGNGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG-D  577
            G+  KE   +  +  +     ++ ++EH+Y  K+Y+ KA     G+   ISI+C +AG  
Sbjct  129  GNLSKEEDHRVLSDASHCDAVMIARKEHIYAKKMYSAKARFLDIGQIHHISIECDMAGVR  188

Query  576  DPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFTFK  397
            DP L   +D KKVL +K L WKFRGN+ I V+G P++V WDVH WLF    +G A+F F+
Sbjct  189  DPCLEIRIDKKKVLHLKRLAWKFRGNQTIYVDGLPVEVLWDVHDWLF-GSTNGCAVFLFQ  247



>gb|KHN33661.1| hypothetical protein glysoja_013667 [Glycine soja]
Length=247

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 72/122 (59%), Gaps = 6/122 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAG--NGQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVAG  580
            GD  KEA  K  + +A   +    + KREH++G K Y  KA     G+   + I+C   G
Sbjct  79   GDLTKEACKKIDSDYACAHSEAVFIAKREHIFGKKFYGAKAQFCDKGQVHDVRIECDTLG  138

Query  579  -DDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFDDDEDGYALFT  403
             +DP LV  +D K V+Q+K LKWKFRGN  I V+G  ++V WDVH+WLF +   G A+F 
Sbjct  139  LNDPCLVIRIDRKTVMQVKQLKWKFRGNHTIVVDGISVEVFWDVHNWLFGNAM-GNAVFM  197

Query  402  FK  397
            F+
Sbjct  198  FQ  199



>ref|XP_010463974.1| PREDICTED: uncharacterized protein LOC104744596 [Camelina sativa]
Length=293

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = -2

Query  747  GDCQKEAYAKTRARHAGN---GQALVLKREHVYGGKLYATKANVG--GKERRISIDCRVA  583
            GD +KEA+ KT A  + +   G   + K+EHV+G + +ATKA     GK   + I+C  +
Sbjct  136  GDMRKEAFKKTNAAPSSSSSLGAVFIAKKEHVFGKRTFATKAQFSDDGKTHDLVIECDTS  195

Query  582  GDDPGLVFSMDDKKVLQIKHLKWKFRGNERIEVEGFPIQVSWDVHSWLFD-DDEDGYALF  406
              DP L+  +D K ++Q+  L WKFRGN+ I V    ++V WDVHSW F      G A+F
Sbjct  196  LSDPCLIVRVDGKILMQVNRLHWKFRGNDTIIVNRISVEVLWDVHSWFFGLPSVAGNAVF  255

Query  405  TFK  397
             F+
Sbjct  256  MFR  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630