BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001O03

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004251994.1|  PREDICTED: acetolactate synthase small subun...    293   7e-93   Solanum lycopersicum
ref|XP_009782836.1|  PREDICTED: acetolactate synthase small subun...    290   3e-92   Nicotiana sylvestris
ref|XP_006353111.1|  PREDICTED: acetolactate synthase small subun...    290   9e-92   Solanum tuberosum [potatoes]
ref|XP_009782832.1|  PREDICTED: acetolactate synthase small subun...    290   1e-91   Nicotiana sylvestris
gb|EYU17620.1|  hypothetical protein MIMGU_mgv1a005378mg                289   2e-91   Erythranthe guttata [common monkey flower]
emb|CAN61470.1|  hypothetical protein VITISV_043824                     287   3e-91   Vitis vinifera
ref|XP_002279286.1|  PREDICTED: acetolactate synthase small subun...    288   4e-91   Vitis vinifera
ref|XP_010650733.1|  PREDICTED: acetolactate synthase small subun...    288   4e-91   Vitis vinifera
gb|KCW46077.1|  hypothetical protein EUGRSUZ_L00052                     285   5e-91   Eucalyptus grandis [rose gum]
gb|KCW59209.1|  hypothetical protein EUGRSUZ_H01869                     285   5e-91   Eucalyptus grandis [rose gum]
ref|XP_002529819.1|  acetolactate synthase, putative                    288   5e-91   Ricinus communis
ref|XP_003524233.1|  PREDICTED: acetolactate synthase small subun...    286   1e-90   Glycine max [soybeans]
ref|XP_010039380.1|  PREDICTED: acetolactate synthase small subun...    284   2e-90   
gb|KJB27748.1|  hypothetical protein B456_005G007600                    282   3e-90   Gossypium raimondii
ref|XP_010070426.1|  PREDICTED: acetolactate synthase small subun...    285   9e-90   Eucalyptus grandis [rose gum]
gb|KCW59207.1|  hypothetical protein EUGRSUZ_H01869                     285   1e-89   Eucalyptus grandis [rose gum]
ref|XP_007159564.1|  hypothetical protein PHAVU_002G248000g             284   1e-89   Phaseolus vulgaris [French bean]
ref|XP_007033634.1|  ACT domain-containing small subunit of aceto...    284   1e-89   
gb|KHN48087.1|  Acetolactate synthase small subunit                     284   1e-89   Glycine soja [wild soybean]
gb|EYU36664.1|  hypothetical protein MIMGU_mgv1a005401mg                284   2e-89   Erythranthe guttata [common monkey flower]
ref|XP_004504413.1|  PREDICTED: acetolactate synthase small subun...    282   2e-89   
ref|XP_010557052.1|  PREDICTED: acetolactate synthase small subun...    281   2e-89   Tarenaya hassleriana [spider flower]
ref|XP_003532793.1|  PREDICTED: acetolactate synthase small subun...    283   2e-89   Glycine max [soybeans]
emb|CDP08089.1|  unnamed protein product                                284   3e-89   Coffea canephora [robusta coffee]
ref|XP_004490063.1|  PREDICTED: acetolactate synthase small subun...    283   4e-89   Cicer arietinum [garbanzo]
ref|XP_009141188.1|  PREDICTED: acetolactate synthase small subun...    283   4e-89   Brassica rapa
ref|XP_002310395.2|  hypothetical protein POPTR_0007s00700g             283   4e-89   
ref|XP_006470698.1|  PREDICTED: acetolactate synthase small subun...    283   4e-89   Citrus sinensis [apfelsine]
ref|XP_006446198.1|  hypothetical protein CICLE_v10015044mg             282   5e-89   
ref|XP_011005277.1|  PREDICTED: acetolactate synthase small subun...    282   5e-89   Populus euphratica
ref|XP_006446199.1|  hypothetical protein CICLE_v10015044mg             283   6e-89   Citrus clementina [clementine]
emb|CDY15367.1|  BnaC04g42560D                                          282   8e-89   Brassica napus [oilseed rape]
gb|KJB27747.1|  hypothetical protein B456_005G007600                    282   8e-89   Gossypium raimondii
ref|XP_010557051.1|  PREDICTED: acetolactate synthase small subun...    282   9e-89   Tarenaya hassleriana [spider flower]
ref|XP_008344057.1|  PREDICTED: acetolactate synthase small subun...    274   1e-88   
ref|XP_009132818.1|  PREDICTED: acetolactate synthase small subun...    281   1e-88   Brassica rapa
gb|KDO50434.1|  hypothetical protein CISIN_1g047033mg                   283   1e-88   Citrus sinensis [apfelsine]
ref|XP_011047624.1|  PREDICTED: acetolactate synthase small subun...    283   1e-88   Populus euphratica
ref|XP_010469676.1|  PREDICTED: acetolactate synthase small subun...    281   2e-88   Camelina sativa [gold-of-pleasure]
ref|XP_010469674.1|  PREDICTED: acetolactate synthase small subun...    281   2e-88   Camelina sativa [gold-of-pleasure]
ref|NP_850172.1|  ACT domain-containing small subunit of acetolac...    281   2e-88   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35124.1|  hypothetical protein JCGZ_10658                         281   3e-88   Jatropha curcas
ref|XP_010414082.1|  PREDICTED: acetolactate synthase small subun...    281   3e-88   Camelina sativa [gold-of-pleasure]
ref|XP_009366239.1|  PREDICTED: acetolactate synthase small subun...    280   5e-88   Pyrus x bretschneideri [bai li]
ref|XP_010510152.1|  PREDICTED: acetolactate synthase small subun...    280   5e-88   Camelina sativa [gold-of-pleasure]
gb|AFK41430.1|  unknown                                                 280   6e-88   Lotus japonicus
ref|XP_011085048.1|  PREDICTED: acetolactate synthase small subun...    280   6e-88   Sesamum indicum [beniseed]
ref|XP_006410309.1|  hypothetical protein EUTSA_v10016569mg             280   6e-88   Eutrema salsugineum [saltwater cress]
ref|XP_010672487.1|  PREDICTED: acetolactate synthase small subun...    280   6e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008450270.1|  PREDICTED: acetolactate synthase small subun...    278   9e-88   Cucumis melo [Oriental melon]
gb|EPS72034.1|  hypothetical protein M569_02723                         277   1e-87   Genlisea aurea
ref|XP_006294093.1|  hypothetical protein CARUB_v10023086mg             279   1e-87   Capsella rubella
ref|XP_004504201.1|  PREDICTED: acetolactate synthase small subun...    278   2e-87   Cicer arietinum [garbanzo]
ref|XP_008354318.1|  PREDICTED: acetolactate synthase small subun...    278   3e-87   
ref|XP_008450269.1|  PREDICTED: acetolactate synthase small subun...    278   3e-87   Cucumis melo [Oriental melon]
ref|XP_008383599.1|  PREDICTED: acetolactate synthase small subun...    278   4e-87   
ref|XP_004159602.1|  PREDICTED: uncharacterized LOC101212902            275   7e-87   
ref|XP_007201965.1|  hypothetical protein PRUPE_ppa004716mg             277   8e-87   Prunus persica
ref|XP_003629945.1|  Acetolactate synthase small subunit                277   8e-87   Medicago truncatula
ref|XP_008243054.1|  PREDICTED: acetolactate synthase small subun...    277   9e-87   Prunus mume [ume]
ref|XP_008243055.1|  PREDICTED: acetolactate synthase small subun...    277   1e-86   Prunus mume [ume]
ref|XP_002879344.1|  hypothetical protein ARALYDRAFT_482103             277   1e-86   
ref|NP_850173.2|  ACT domain-containing small subunit of acetolac...    274   2e-86   Arabidopsis thaliana [mouse-ear cress]
emb|CDY19107.1|  BnaA04g18470D                                          276   2e-86   Brassica napus [oilseed rape]
ref|XP_009351614.1|  PREDICTED: acetolactate synthase small subun...    276   2e-86   Pyrus x bretschneideri [bai li]
dbj|BAD19594.1|  putative acetolactate synthase small subunit           271   2e-86   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047389.2|  Os02g0608600                                       271   2e-86   
ref|XP_010414083.1|  PREDICTED: acetolactate synthase small subun...    274   2e-86   
gb|KGN66639.1|  hypothetical protein Csa_1G652220                       266   3e-86   Cucumis sativus [cucumbers]
gb|KGN49589.1|  hypothetical protein Csa_5G013280                       274   4e-86   Cucumis sativus [cucumbers]
ref|XP_004149627.1|  PREDICTED: uncharacterized protein LOC101212902    275   4e-86   Cucumis sativus [cucumbers]
ref|XP_008383971.1|  PREDICTED: acetolactate synthase small subun...    275   6e-86   
ref|XP_007212091.1|  hypothetical protein PRUPE_ppa005063mg             272   4e-85   
gb|KFK31180.1|  hypothetical protein AALP_AA6G079200                    273   5e-85   Arabis alpina [alpine rockcress]
ref|XP_008225227.1|  PREDICTED: acetolactate synthase small subun...    272   5e-85   Prunus mume [ume]
ref|XP_002266924.2|  PREDICTED: acetolactate synthase small subun...    272   6e-85   Vitis vinifera
ref|XP_010242460.1|  PREDICTED: acetolactate synthase small subun...    272   7e-85   Nelumbo nucifera [Indian lotus]
ref|XP_008371723.1|  PREDICTED: acetolactate synthase small subun...    271   8e-85   
gb|KFK31179.1|  hypothetical protein AALP_AA6G079200                    273   1e-84   Arabis alpina [alpine rockcress]
ref|XP_009352938.1|  PREDICTED: acetolactate synthase small subun...    271   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_008349232.1|  PREDICTED: acetolactate synthase small subun...    268   2e-84   
ref|XP_009625351.1|  PREDICTED: acetolactate synthase small subun...    270   3e-84   Nicotiana tomentosiformis
ref|XP_008443657.1|  PREDICTED: acetolactate synthase small subun...    270   3e-84   Cucumis melo [Oriental melon]
ref|XP_004288733.1|  PREDICTED: acetolactate synthase small subun...    271   4e-84   Fragaria vesca subsp. vesca
ref|XP_004139096.1|  PREDICTED: uncharacterized protein LOC101208212    270   4e-84   Cucumis sativus [cucumbers]
ref|XP_008367825.1|  PREDICTED: acetolactate synthase small subun...    270   5e-84   
ref|XP_008394266.1|  PREDICTED: acetolactate synthase small subun...    270   6e-84   
ref|XP_009625350.1|  PREDICTED: acetolactate synthase small subun...    270   6e-84   Nicotiana tomentosiformis
ref|XP_006664907.1|  PREDICTED: acetolactate synthase small subun...    267   8e-84   Oryza brachyantha
ref|XP_002311270.2|  hypothetical protein POPTR_0008s07820g             269   2e-83   
emb|CAX48742.1|  acetohydroxyacid synthase regulatory subunit 1 p...    268   3e-83   Eupatorium cannabinum [hemp agrimony]
ref|XP_011010159.1|  PREDICTED: acetolactate synthase small subun...    268   4e-83   Populus euphratica
ref|XP_008800993.1|  PREDICTED: acetolactate synthase small subun...    267   6e-83   Phoenix dactylifera
ref|XP_011014712.1|  PREDICTED: acetolactate synthase small subun...    266   7e-83   Populus euphratica
ref|XP_008800984.1|  PREDICTED: acetolactate synthase small subun...    267   8e-83   
gb|EEC73569.1|  hypothetical protein OsI_08011                          268   9e-83   Oryza sativa Indica Group [Indian rice]
ref|XP_011014695.1|  PREDICTED: acetolactate synthase small subun...    266   1e-82   Populus euphratica
ref|XP_009406425.1|  PREDICTED: acetolactate synthase small subun...    266   1e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404280.1|  PREDICTED: acetolactate synthase small subun...    265   1e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006468633.1|  PREDICTED: acetolactate synthase small subun...    266   2e-82   Citrus sinensis [apfelsine]
ref|XP_010109954.1|  hypothetical protein L484_011796                   266   4e-82   Morus notabilis
ref|XP_009404279.1|  PREDICTED: acetolactate synthase small subun...    265   4e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316167.1|  hypothetical protein POPTR_0010s18560g             263   4e-82   
ref|XP_006448525.1|  hypothetical protein CICLE_v10015040mg             264   8e-82   Citrus clementina [clementine]
gb|EYU39756.1|  hypothetical protein MIMGU_mgv1a005187mg                265   8e-82   Erythranthe guttata [common monkey flower]
ref|XP_002514772.1|  acetolactate synthase, putative                    265   1e-81   
ref|NP_001168069.1|  uncharacterized protein LOC100381801               259   1e-81   Zea mays [maize]
emb|CDY42070.1|  BnaA05g11160D                                          263   1e-81   Brassica napus [oilseed rape]
gb|KJB78879.1|  hypothetical protein B456_013G024000                    256   2e-81   Gossypium raimondii
ref|XP_004250085.1|  PREDICTED: acetolactate synthase small subun...    263   2e-81   Solanum lycopersicum
emb|CDY34514.1|  BnaC04g12850D                                          263   2e-81   Brassica napus [oilseed rape]
ref|XP_006353245.1|  PREDICTED: acetolactate synthase small subun...    263   3e-81   Solanum tuberosum [potatoes]
ref|XP_007028127.1|  Valine-tolerant 1 isoform 2                        259   5e-81   
gb|KHG22544.1|  Acetolactate synthase small subunit                     261   1e-80   Gossypium arboreum [tree cotton]
ref|XP_010673855.1|  PREDICTED: acetolactate synthase small subun...    261   1e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009788611.1|  PREDICTED: acetolactate synthase small subun...    254   1e-80   Nicotiana sylvestris
ref|XP_006858758.1|  hypothetical protein AMTR_s00066p00141740          261   1e-80   Amborella trichopoda
ref|XP_011460628.1|  PREDICTED: acetolactate synthase small subun...    260   2e-80   Fragaria vesca subsp. vesca
ref|XP_006663345.1|  PREDICTED: acetolactate synthase small subun...    259   2e-80   
emb|CDX79442.1|  BnaC03g17780D                                          259   4e-80   
ref|XP_004953051.1|  PREDICTED: acetolactate synthase small subun...    259   8e-80   Setaria italica
ref|XP_008643958.1|  PREDICTED: uncharacterized protein LOC100381...    259   1e-79   Zea mays [maize]
ref|XP_007028126.1|  ACT domain-containing small subunit of aceto...    258   1e-79   
gb|EEC67965.1|  hypothetical protein OsI_35716                          258   1e-79   Oryza sativa Indica Group [Indian rice]
gb|AAX96859.1|  acetolactate synthase, small subunit, putative          258   1e-79   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151166.1|  acetolactate synthase/ amino acid binding pr...    258   1e-79   Zea mays [maize]
emb|CDX84757.1|  BnaA03g14730D                                          258   1e-79   
gb|KHG18039.1|  Acetolactate synthase small subunit                     258   2e-79   Gossypium arboreum [tree cotton]
ref|XP_003576101.1|  PREDICTED: acetolactate synthase small subun...    257   2e-79   Brachypodium distachyon [annual false brome]
gb|EEE57346.1|  hypothetical protein OsJ_07472                          256   3e-79   Oryza sativa Japonica Group [Japonica rice]
gb|KJB78878.1|  hypothetical protein B456_013G024000                    258   3e-79   Gossypium raimondii
emb|CDP04139.1|  unnamed protein product                                256   5e-79   Coffea canephora [robusta coffee]
gb|AAD32291.1|  putative acetolactate synthase                          257   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003572704.1|  PREDICTED: acetolactate synthase small subun...    256   1e-78   Brachypodium distachyon [annual false brome]
ref|XP_010524340.1|  PREDICTED: acetolactate synthase small subun...    255   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_002452423.1|  hypothetical protein SORBIDRAFT_04g025560          255   3e-78   Sorghum bicolor [broomcorn]
ref|XP_011084704.1|  PREDICTED: acetolactate synthase small subun...    254   8e-78   Sesamum indicum [beniseed]
ref|XP_011084705.1|  PREDICTED: acetolactate synthase small subun...    253   1e-77   Sesamum indicum [beniseed]
ref|XP_010558579.1|  PREDICTED: acetolactate synthase small subun...    251   3e-77   Tarenaya hassleriana [spider flower]
sp|Q9SMC2.1|ILVH_NICPL  RecName: Full=Acetolactate synthase small...    250   7e-77   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|EMT17230.1|  Acetolactate synthase small subunit                     249   3e-76   
dbj|BAJ92239.1|  predicted protein                                      249   3e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006400166.1|  hypothetical protein EUTSA_v10016107mg             249   6e-76   Eutrema salsugineum [saltwater cress]
ref|XP_006286863.1|  hypothetical protein CARUB_v10003921mg             240   2e-75   
emb|CDX85509.1|  BnaA02g03040D                                          245   1e-74   
ref|XP_009126106.1|  PREDICTED: acetolactate synthase small subun...    245   1e-74   Brassica rapa
emb|CDY38123.1|  BnaC02g06500D                                          245   2e-74   Brassica napus [oilseed rape]
ref|NP_197133.1|  acetolactate synthase small subunit 1                 245   2e-74   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19535.1|  AT5G16290                                              245   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011464846.1|  PREDICTED: LOW QUALITY PROTEIN: acetolactate...    240   4e-74   Fragaria vesca subsp. vesca
ref|XP_002871713.1|  hypothetical protein ARALYDRAFT_488480             243   7e-74   
ref|XP_008667813.1|  PREDICTED: uncharacterized protein LOC100279...    241   8e-74   Zea mays [maize]
ref|XP_006286862.1|  hypothetical protein CARUB_v10003921mg             242   2e-73   Capsella rubella
gb|KCW46078.1|  hypothetical protein EUGRSUZ_L00052                     239   2e-73   Eucalyptus grandis [rose gum]
gb|EAZ36982.1|  hypothetical protein OsJ_21322                          238   3e-73   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146158.1|  uncharacterized protein LOC100279727               241   4e-73   Zea mays [maize]
tpg|DAA41907.1|  TPA: hypothetical protein ZEAMMB73_831035              241   4e-73   
ref|XP_010420316.1|  PREDICTED: acetolactate synthase small subun...    241   6e-73   Camelina sativa [gold-of-pleasure]
gb|KCW46079.1|  hypothetical protein EUGRSUZ_L00052                     238   7e-73   Eucalyptus grandis [rose gum]
dbj|BAM75181.1|  B3-type transcription factor                           246   1e-72   Ricinus communis
ref|XP_010453787.1|  PREDICTED: acetolactate synthase small subun...    239   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010492512.1|  PREDICTED: acetolactate synthase small subun...    239   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009144046.1|  PREDICTED: acetolactate synthase small subun...    234   1e-71   
ref|XP_002449227.1|  hypothetical protein SORBIDRAFT_05g006620          236   3e-71   Sorghum bicolor [broomcorn]
ref|XP_006446200.1|  hypothetical protein CICLE_v10015044mg             235   8e-71   
ref|XP_009144045.1|  PREDICTED: acetolactate synthase small subun...    235   8e-71   Brassica rapa
ref|XP_004490062.1|  PREDICTED: acetolactate synthase small subun...    237   1e-70   
ref|XP_004169905.1|  PREDICTED: acetolactate synthase small subun...    223   8e-70   
ref|XP_010101349.1|  Acetolactate synthase small subunit                228   6e-69   
ref|NP_850174.1|  ACT domain-containing small subunit of acetolac...    224   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001773408.1|  predicted protein                                  220   1e-65   
ref|XP_002979412.1|  hypothetical protein SELMODRAFT_111081             217   2e-64   
ref|XP_006448524.1|  hypothetical protein CICLE_v10015040mg             218   4e-64   Citrus clementina [clementine]
ref|XP_002977907.1|  hypothetical protein SELMODRAFT_107328             211   5e-62   
gb|EMS53688.1|  Acetolactate synthase small subunit                     209   1e-61   Triticum urartu
gb|EMT12300.1|  Acetolactate synthase small subunit                     209   3e-61   
ref|XP_009144047.1|  PREDICTED: acetolactate synthase small subun...    203   7e-59   Brassica rapa
ref|XP_009123667.1|  PREDICTED: acetolactate synthase small subun...    178   4e-53   Brassica rapa
ref|WP_007304707.1|  acetolactate synthase                              179   2e-52   Crocosphaera watsonii
gb|KDO77101.1|  hypothetical protein CISIN_1g0114912mg                  175   4e-52   Citrus sinensis [apfelsine]
ref|XP_010910806.1|  PREDICTED: acetolactate synthase small subun...    181   1e-51   
ref|WP_015219133.1|  acetolactate synthase small subunit                176   2e-51   Cyanobacterium aponinum
ref|WP_015164258.1|  acetolactate synthase small subunit                174   1e-50   Pseudanabaena sp. PCC 7367
ref|XP_011014719.1|  PREDICTED: acetolactate synthase small subun...    181   3e-50   Populus euphratica
ref|WP_006527479.1|  acetolactate synthase, small subunit               172   4e-50   Gloeocapsa sp. PCC 73106
ref|WP_015227737.1|  acetolactate synthase small subunit                173   4e-50   Halothece sp. PCC 7418
ref|WP_013322899.1|  acetolactate synthase                              172   5e-50   Cyanothece sp. PCC 7822
ref|WP_015230978.1|  acetolactate synthase small subunit                172   7e-50   Dactylococcopsis salina
gb|ACB49979.1|  acetolactate synthase small subunit                     172   1e-49   Cyanothece sp. ATCC 51142
ref|WP_015167340.1|  acetolactate synthase small subunit                171   1e-49   Synechococcus sp. PCC 7502
ref|WP_036918354.1|  MULTISPECIES: acetolactate synthase                171   1e-49   Prochlorococcus
ref|WP_012195782.1|  acetolactate synthase                              171   1e-49   Prochlorococcus marinus
ref|WP_009547809.1|  MULTISPECIES: acetolactate synthase                171   2e-49   Cyanothece
ref|WP_025968180.1|  acetolactate synthase                              171   2e-49   
ref|WP_006453777.1|  acetolactate synthase                              171   2e-49   Synechococcus sp. PCC 7335
ref|NP_001067632.2|  Os11g0256000                                       169   2e-49   
ref|WP_011818754.1|  MULTISPECIES: acetolactate synthase                171   2e-49   Prochlorococcus
ref|WP_032518375.1|  acetolactate synthase                              171   2e-49   Prochlorococcus marinus
ref|WP_025930661.1|  acetolactate synthase                              171   2e-49   
ref|WP_038653708.1|  acetolactate synthase                              171   2e-49   Prochlorococcus sp. MIT 0801
ref|WP_011294852.1|  acetolactate synthase                              170   3e-49   Prochlorococcus marinus
ref|WP_025979293.1|  acetolactate synthase                              170   3e-49   
ref|XP_005648800.1|  acetolactate synthase                              182   3e-49   Coccomyxa subellipsoidea C-169
ref|WP_035798716.1|  acetolactate synthase                              170   4e-49   Cyanothece sp. CCY0110
ref|WP_011056724.1|  MULTISPECIES: acetolactate synthase                170   4e-49   Thermosynechococcus
gb|EAZ92294.1|  acetolactate synthase small subunit                     170   4e-49   Cyanothece sp. CCY0110
ref|WP_012008031.1|  MULTISPECIES: acetolactate synthase                170   4e-49   Prochlorococcus marinus
ref|WP_017294692.1|  acetolactate synthase                              170   5e-49   Geminocystis herdmanii
ref|NP_848948.1|  aceohydroxyacid synthase small subunit                169   7e-49   Cyanidioschyzon merolae strain 10D
ref|WP_023076484.1|  acetolactate small subunit                         169   7e-49   Leptolyngbya sp. Heron Island J
dbj|BAA22822.1|  acetolactate synthase                                  169   8e-49   Cyanidioschyzon merolae
ref|WP_025939160.1|  acetolactate synthase                              169   9e-49   
ref|WP_017303099.1|  acetolactate synthase                              169   9e-49   Spirulina subsalsa
ref|WP_025961335.1|  acetolactate synthase                              169   1e-48   
ref|WP_036902537.1|  acetolactate synthase                              169   1e-48   Prochlorococcus sp. MIT 0601
ref|WP_010477416.1|  MULTISPECIES: acetolactate synthase                169   1e-48   Acaryochloris
ref|WP_018397129.1|  acetolactate synthase                              169   1e-48   filamentous cyanobacterium ESFC-1
ref|WP_011132788.1|  acetolactate synthase                              169   1e-48   Prochlorococcus marinus
ref|WP_002732118.1|  acetolactate synthase                              169   1e-48   Microcystis
ref|WP_006910483.1|  acetolactate synthase                              169   1e-48   Cyanobium sp. PCC 7001
ref|WP_002743360.1|  MULTISPECIES: acetolactate synthase                169   1e-48   Microcystis
ref|WP_015154365.1|  acetolactate synthase small subunit                169   1e-48   Cyanobacteria [blue-green bacteria]
ref|WP_008188861.1|  acetolactate synthase                              169   2e-48   Moorea producens
ref|WP_039716657.1|  acetolactate synthase                              169   2e-48   
ref|WP_011125403.1|  MULTISPECIES: acetolactate synthase                168   2e-48   Prochlorococcus
ref|WP_024971071.1|  acetolactate synthase                              168   2e-48   Microcystis aeruginosa
emb|CCI18700.1|  Acetolactate synthase small subunit                    169   2e-48   Microcystis aeruginosa PCC 9807
dbj|GAL94295.1|  acetolactate synthase small subunit                    168   2e-48   Microcystis aeruginosa NIES-44
ref|WP_008314262.1|  acetolactate synthase, small subunit               168   2e-48   Leptolyngbya sp. PCC 6406
ref|WP_014407139.1|  acetolactate synthase                              168   3e-48   Synechocystis
ref|WP_041622928.1|  acetolactate synthase                              168   3e-48   Oscillatoria nigro-viridis
ref|WP_012626204.1|  acetolactate synthase                              168   3e-48   Cyanothece sp. PCC 7425
ref|WP_039887977.1|  acetolactate synthase                              168   3e-48   Microcoleus vaginatus
ref|XP_005851575.1|  hypothetical protein CHLNCDRAFT_29593              174   3e-48   Chlorella variabilis
ref|WP_043999720.1|  acetolactate synthase                              168   3e-48   Microcystis aeruginosa
ref|WP_019502773.1|  acetolactate synthase                              167   3e-48   Pseudanabaena sp. PCC 6802
dbj|BAM54375.1|  acetolactate synthase 3 regulatory subunit             168   3e-48   Bacillus subtilis BEST7613
gb|AFZ05551.1|  acetolactate synthase, small subunit                    168   3e-48   Oscillatoria nigro-viridis PCC 7112
gb|EGK83985.1|  acetolactate synthase, small subunit                    168   4e-48   Microcoleus vaginatus FGP-2
ref|WP_038545989.1|  acetolactate synthase                              168   4e-48   Synechococcus sp. KORDI-100
emb|CCI14937.1|  Acetolactate synthase small subunit                    168   4e-48   Microcystis aeruginosa PCC 9806
ref|WP_011376800.1|  acetolactate synthase                              167   4e-48   Prochlorococcus marinus
ref|WP_036020223.1|  acetolactate synthase                              167   5e-48   Leptolyngbya sp. PCC 7375
ref|WP_015195236.1|  acetolactate synthase, small subunit               167   5e-48   Stanieria cyanosphaera
ref|WP_028952581.1|  acetolactate synthase                              167   5e-48   Synechococcus sp. CC9616
ref|WP_026100701.1|  acetolactate synthase                              167   5e-48   Synechococcus sp. PCC 7336
gb|AII48755.1|  acetolactate synthase                                   167   6e-48   Synechococcus sp. KORDI-52
ref|WP_012598844.1|  acetolactate synthase                              167   6e-48   Cyanothece sp. PCC 7424
ref|WP_007100311.1|  acetolactate synthase                              167   6e-48   Synechococcus sp. RS9917
ref|WP_036920271.1|  acetolactate synthase                              167   6e-48   
ref|WP_015171191.1|  acetolactate synthase small subunit                167   7e-48   Geitlerinema sp. PCC 7407
ref|WP_012595734.1|  MULTISPECIES: acetolactate synthase                167   7e-48   Cyanothece
gb|EKV00810.1|  acetolactate synthase, small subunit                    167   7e-48   Leptolyngbya sp. PCC 7375
gb|AIA61091.1|  acetohydroxyacid synthase small subunit (chloropl...    167   8e-48   Cyanidiaceae sp. MX-AZ01
ref|WP_011364939.1|  acetolactate synthase                              167   8e-48   Synechococcus
ref|WP_010873502.1|  acetolactate synthase                              167   9e-48   
ref|WP_009767679.1|  acetolactate synthase, small subunit               167   1e-47   Oscillatoriales cyanobacterium JSC-12
ref|WP_038553682.1|  acetolactate synthase                              166   1e-47   Synechococcus sp. KORDI-52
dbj|BAA22831.1|  acetolactate synthase                                  166   2e-47   Cyanidium caldarium
ref|WP_011820626.1|  acetolactate synthase                              166   2e-47   Prochlorococcus marinus
ref|WP_017715305.1|  acetolactate synthase                              166   2e-47   Oscillatoria sp. PCC 10802
ref|WP_019474688.1|  acetolactate synthase                              166   2e-47   
ref|WP_026732404.1|  acetolactate synthase                              166   2e-47   Fischerella sp. PCC 9605
ref|WP_028946400.1|  acetolactate synthase                              166   2e-47   Synechocystis sp. PCC 6714
ref|WP_019487064.1|  MULTISPECIES: acetolactate synthase                166   2e-47   Kamptonema
ref|WP_017319158.1|  acetolactate synthase                              165   3e-47   Mastigocladopsis repens
ref|WP_017322778.1|  acetolactate synthase                              165   3e-47   cyanobacterium PCC 7702
ref|WP_040935206.1|  acetolactate synthase                              165   3e-47   
ref|WP_015116444.1|  acetolactate synthase small subunit                165   3e-47   Rivularia sp. PCC 7116
ref|WP_009631788.1|  acetolactate synthase, small subunit               165   3e-47   Synechocystis sp. PCC 7509
ref|WP_017286074.1|  acetolactate synthase                              165   3e-47   Leptolyngbya boryana
ref|WP_036532119.1|  acetolactate synthase                              165   4e-47   Neosynechococcus sphagnicola
ref|WP_036896778.1|  acetolactate synthase                              165   5e-47   
ref|WP_015223783.1|  acetolactate synthase small subunit                165   5e-47   
ref|WP_040931574.1|  acetolactate synthase                              165   5e-47   
emb|CBN54307.1|  acetolactate synthase 3 regulatory subunit [ [         165   5e-47   [Oscillatoria] sp. PCC 6506
ref|WP_015083282.1|  acetolactate synthase small subunit                164   5e-47   Anabaena sp. 90
ref|WP_015145546.1|  acetolactate synthase small subunit                164   6e-47   Pleurocapsales
ref|WP_006618438.1|  acetolactate synthase                              164   6e-47   Arthrospira platensis
gb|AHF64430.1|  acetolactate synthase, small subunit                    164   7e-47   
ref|WP_041040884.1|  acetolactate synthase                              164   7e-47   
ref|WP_039728011.1|  MULTISPECIES: acetolactate synthase                164   7e-47   
ref|WP_040688882.1|  acetolactate synthase                              164   8e-47   
ref|WP_035993822.1|  acetolactate synthase                              164   8e-47   
ref|WP_015125829.1|  acetolactate synthase small subunit                164   8e-47   
ref|WP_011141136.1|  acetolactate synthase                              164   9e-47   
ref|WP_019508465.1|  acetolactate synthase                              164   9e-47   
ref|WP_026073042.1|  acetolactate synthase                              164   1e-46   
ref|WP_006508477.1|  acetolactate synthase, small subunit               164   1e-46   
ref|WP_035996987.1|  acetolactate synthase                              164   1e-46   
dbj|BAI88928.1|  acetolactate synthase III small subunit                164   1e-46   
ref|WP_017660939.1|  acetolactate synthase                              164   1e-46   
gb|ELS31853.1|  acetolactate synthase, small subunit                    164   1e-46   
ref|WP_016870148.1|  acetolactate synthase                              164   1e-46   
ref|YP_007627456.1|  acetolactate synthase small subunit                164   1e-46   
ref|WP_007098346.1|  acetolactate synthase                              164   1e-46   
gb|KIJ82940.1|  acetolactate synthase                                   163   2e-46   
ref|YP_009051154.1|  acetohydroxyacid synthase small subunit            164   2e-46   
ref|WP_010302742.1|  acetolactate synthase                              163   2e-46   
ref|WP_015189621.1|  acetolactate synthase, small subunit               163   2e-46   
ref|WP_009342538.1|  acetolactate synthase                              163   2e-46   
ref|WP_028084672.1|  acetolactate synthase                              163   2e-46   
ref|WP_009756687.1|  MULTISPECIES: acetolactate synthase                163   2e-46   
ref|WP_015213275.1|  acetolactate synthase, small subunit               163   2e-46   
ref|XP_008677344.1|  PREDICTED: acetolactate synthase/ amino acid...    170   2e-46   
ref|WP_015180717.1|  acetolactate synthase small subunit                163   3e-46   
ref|WP_035832248.1|  acetolactate synthase                              163   3e-46   
sp|Q9MS98.1|ILVH_GALSU  RecName: Full=Acetolactate synthase small...    163   3e-46   
ref|WP_015108799.1|  acetolactate synthase small subunit                162   3e-46   
ref|WP_016859689.1|  acetolactate synthase                              162   4e-46   
ref|WP_015209539.1|  acetolactate synthase, small subunit               162   4e-46   
ref|WP_006277889.1|  acetolactate synthase                              162   4e-46   
ref|WP_017651464.1|  acetolactate synthase                              162   4e-46   
ref|WP_009790304.1|  acetolactate synthase                              162   4e-46   
ref|WP_011611481.1|  acetolactate synthase                              162   4e-46   
ref|WP_011618839.1|  acetolactate synthase                              162   4e-46   
ref|WP_012308298.1|  acetolactate synthase                              162   4e-46   
ref|WP_016875905.1|  acetolactate synthase                              162   5e-46   
ref|WP_041456726.1|  MULTISPECIES: acetolactate synthase                162   5e-46   
ref|WP_006852196.1|  acetolactate synthase                              162   5e-46   
ref|WP_011933543.1|  acetolactate synthase                              162   5e-46   
ref|NP_045137.1|  acetohydroxyacid synthase small subunit               162   6e-46   
ref|WP_006625441.1|  MULTISPECIES: acetolactate synthase                162   6e-46   
ref|WP_027843130.1|  acetolactate synthase                              162   7e-46   
ref|WP_011127547.1|  acetolactate synthase                              162   7e-46   
ref|WP_006196435.1|  acetolactate synthase                              162   7e-46   
dbj|BAB76326.1|  acetolactate synthase                                  162   7e-46   
ref|WP_006103562.1|  acetolactate synthase                              162   7e-46   
gb|ABB17340.1|  acetolactate synthase                                   162   7e-46   
ref|WP_011359483.1|  acetolactate synthase                              162   8e-46   
ref|YP_008144692.1|  acetolactate synthase small subunit                162   8e-46   
ref|WP_017313402.1|  MULTISPECIES: acetolactate synthase                161   1e-45   
ref|WP_015126609.1|  acetolactate synthase small subunit                161   1e-45   
ref|WP_015196808.1|  acetolactate synthase small subunit                161   1e-45   
ref|WP_030007373.1|  acetolactate synthase                              161   1e-45   
ref|WP_013190466.1|  acetolactate synthase                              161   1e-45   
ref|WP_012408560.1|  acetolactate synthase                              161   1e-45   
ref|WP_011432604.1|  acetolactate synthase                              161   1e-45   
ref|WP_011430944.1|  acetolactate synthase                              161   1e-45   
ref|WP_006041820.1|  acetolactate synthase                              161   1e-45   
ref|YP_007878297.1|  acetolactate synthase small subunit                161   1e-45   
ref|WP_029632809.1|  acetolactate synthase [                            161   1e-45   
ref|WP_024545091.1|  acetolactate synthase                              160   2e-45   
ref|WP_044106118.1|  acetolactate synthase                              161   2e-45   
ref|WP_035154634.1|  acetolactate synthase                              160   2e-45   
ref|WP_006171772.1|  acetolactate synthase                              161   2e-45   
ref|WP_026786440.1|  MULTISPECIES: acetolactate synthase                160   2e-45   
ref|WP_027403392.1|  acetolactate synthase                              160   2e-45   
ref|WP_011130547.1|  acetolactate synthase                              160   2e-45   
gb|AJH65993.1|  acetolactate synthase small subunit                     160   2e-45   
ref|WP_023175301.1|  acetolactate synthase 3 regulatory subunit         160   2e-45   
ref|WP_011825509.1|  acetolactate synthase                              160   3e-45   
ref|WP_016950575.1|  acetolactate synthase                              160   3e-45   
ref|WP_015146637.1|  acetolactate synthase small subunit                160   3e-45   
ref|WP_009787902.1|  acetolactate synthase                              160   3e-45   
ref|WP_036914369.1|  MULTISPECIES: acetolactate synthase                160   3e-45   
ref|WP_039747340.1|  acetolactate synthase                              160   4e-45   
ref|YP_001293521.1|  acetohydroxyacid synthetase small subunit          159   4e-45   
ref|WP_019492237.1|  acetolactate synthase                              159   5e-45   
ref|WP_044500522.1|  acetolactate synthase                              159   5e-45   
gb|AJO68499.1|  acetohydroxyacid synthase small subunit                 159   5e-45   
ref|WP_043692189.1|  acetolactate synthase                              159   5e-45   
ref|WP_017740695.1|  acetolactate synthase                              159   7e-45   
gb|AFY41657.1|  acetolactate synthase, small subunit                    159   8e-45   
ref|WP_036481766.1|  acetolactate synthase                              159   8e-45   
ref|YP_063674.1|  acetohydroxyacid synthase small subunit               158   2e-44   
ref|WP_015205120.1|  acetolactate synthase small subunit                158   2e-44   
gb|ABH11012.1|  acetolactate synthase, small subunit                    157   2e-44   
ref|WP_026099569.1|  acetolactate synthase                              158   2e-44   
gb|ERN42020.1|  acetolactate synthase, small subunit                    158   2e-44   
ref|WP_023066701.1|  acetolactate synthase, small subunit               158   2e-44   
ref|WP_040655402.1|  acetolactate synthase                              158   2e-44   
ref|XP_007033633.1|  Poly(A) polymerase 1                               168   3e-44   
ref|WP_011936109.1|  acetolactate synthase                              157   3e-44   
ref|WP_041763544.1|  acetolactate synthase                              157   3e-44   
gb|AFY38678.1|  acetolactate synthase, small subunit                    157   3e-44   
ref|XP_011400735.1|  Acetolactate synthase small subunit                165   4e-44   
ref|YP_002048700.1|  acetolactate synthase III small subunit            157   5e-44   
ref|WP_010315670.1|  acetolactate synthase                              157   6e-44   
ref|WP_044304865.1|  acetolactate synthase                              157   6e-44   
gb|KIE11579.1|  acetolactate synthase                                   156   7e-44   
emb|CCH67841.1|  Acetolactate synthase small subunit                    157   7e-44   
gb|AIA21465.1|  acetolactate synthase small subunit                     156   9e-44   
ref|YP_008965793.1|  acetolactate synthase small subunit                156   1e-43   
ref|WP_011243982.1|  MULTISPECIES: acetolactate synthase                156   1e-43   
ref|YP_009027514.1|  acetolactate synthase small subunit                156   1e-43   
ref|XP_002509130.1|  predicted protein                                  161   1e-43   
ref|WP_015139015.1|  acetolactate synthase small subunit                156   1e-43   
ref|XP_003081855.1|  Acetolactate synthase, small subunit (ISS)         164   2e-43   
ref|YP_007947759.1|  acetohydroxyacid synthase small subunit            155   2e-43   
emb|CEF99544.1|  Acetolactate synthase, small subunit, C-terminal       164   2e-43   
ref|NP_053840.1|  acetohydroxyacid synthase small subunit               155   2e-43   
ref|YP_536911.1|  acetohydroxyacid synthase small subunit               155   2e-43   
ref|WP_015158120.1|  acetolactate synthase, small subunit               154   4e-43   
ref|YP_003359223.1|  acetohydroxyacid synthase small subunit            154   4e-43   
ref|WP_037218077.1|  acetolactate synthase                              154   5e-43   
ref|XP_001700185.1|  acetolactate synthase, small subunit               162   8e-43   
gb|AIA21259.1|  acetolactate synthase small subunit                     154   8e-43   
gb|KIY94579.1|  hypothetical protein MNEG_13384                         153   9e-43   
gb|AFC39900.1|  acetohydroxyacid synthase small subunit                 154   1e-42   
ref|XP_003061628.1|  predicted protein                                  162   2e-42   
ref|XP_001420250.1|  predicted protein                                  160   2e-42   
ref|YP_009019682.1|  acetolactate synthase small subunit                152   3e-42   
ref|YP_003002120.1|  acetolactate synthase small subunit                152   3e-42   
ref|XP_002948458.1|  hypothetical protein VOLCADRAFT_73781              160   3e-42   
ref|NP_050708.1|  acetohydroxyacid synthase small subunit               150   2e-41   
gb|KDO77100.1|  hypothetical protein CISIN_1g0114912mg                  147   4e-41   
ref|YP_002327535.1|  acetolactate synthase small subunit                150   4e-41   
ref|YP_003002269.1|  acetolactate synthase small subunit                148   1e-40   
ref|XP_005705049.1|  [pt] acetolactate synthase I/III small subunit     148   1e-40   
ref|YP_001936325.1|  acetohydroxyacid synthase small subunit            148   2e-40   
gb|AFR24747.1|  acetolactate synthase small subunit                     147   2e-40   
gb|KDD76489.1|  hypothetical protein H632_c209p2                        152   2e-39   
gb|ADE76301.1|  unknown                                                 139   5e-38   
ref|WP_011832981.1|  acetolactate synthase                              140   8e-38   
ref|WP_025963786.1|  acetolactate synthase                              139   2e-37   
ref|WP_012547617.1|  acetolactate synthase                              139   3e-37   
ref|WP_012583549.1|  acetolactate synthase                              138   7e-37   
ref|XP_010911692.1|  PREDICTED: acetolactate synthase small subun...    140   8e-37   
ref|WP_025978977.1|  acetolactate synthase                              137   1e-36   
ref|WP_011498832.1|  acetolactate synthase                              137   1e-36   
ref|WP_013277625.1|  acetolactate synthase                              137   1e-36   
ref|WP_042698724.1|  acetolactate synthase                              137   3e-36   
ref|WP_012874144.1|  acetolactate synthase                              136   7e-36   
ref|WP_015051056.1|  acetolactate synthase                              134   2e-35   
ref|WP_013755931.1|  acetolactate synthase                              133   5e-35   
ref|WP_013328365.1|  acetolactate synthase                              133   5e-35   
gb|AJH65840.1|  acetolactate synthase small subunit                     133   6e-35   
gb|EEE39890.1|  acetolactate synthase, small subunit                    132   8e-35   
ref|WP_020264991.1|  hypothetical protein                               132   1e-34   
ref|WP_011843915.1|  acetolactate synthase                              132   2e-34   
gb|EFD24535.1|  acetolactate synthase, small subunit                    132   2e-34   
ref|WP_011393740.1|  acetolactate synthase                              132   2e-34   
ref|WP_040348260.1|  acetolactate synthase                              132   2e-34   
ref|WP_012618999.1|  acetolactate synthase                              131   3e-34   
ref|WP_018130638.1|  acetolactate synthase                              131   3e-34   
gb|ACN35790.1|  unknown                                                 131   3e-34   
ref|WP_011448263.1|  acetolactate synthase                              131   4e-34   
ref|WP_028051312.1|  acetolactate synthase                              131   4e-34   
ref|WP_038961368.1|  acetolactate synthase                              130   5e-34   
ref|WP_012037024.1|  acetolactate synthase                              130   8e-34   
ref|WP_013897834.1|  acetolactate synthase                              130   9e-34   
gb|KDE54705.1|  acetolactate synthase                                   130   9e-34   
ref|WP_018249315.1|  acetolactate synthase                              130   9e-34   
ref|WP_015325139.1|  acetolactate synthase, small subunit               130   1e-33   
ref|WP_027338794.1|  acetolactate synthase                              130   1e-33   
ref|WP_011343452.1|  acetolactate synthase                              130   1e-33   
ref|WP_013037303.1|  acetolactate synthase                              129   1e-33   
ref|XP_009604733.1|  PREDICTED: acetolactate synthase small subun...    135   2e-33   
ref|WP_004039165.1|  acetolactate synthase                              129   2e-33   
emb|CEO88936.1|  acetolactate synthase III, thiamin-dependent, sm...    129   2e-33   
ref|WP_003513130.1|  acetolactate synthase                              129   2e-33   
ref|WP_044664993.1|  acetolactate synthase                              129   3e-33   
ref|WP_004076959.1|  acetolactate synthase                              129   3e-33   
ref|XP_011014725.1|  PREDICTED: acetolactate synthase small subun...    134   3e-33   
gb|KDO77106.1|  hypothetical protein CISIN_1g0114911mg                  133   3e-33   
ref|WP_038290690.1|  acetolactate synthase [                            129   3e-33   
ref|WP_011305258.1|  acetolactate synthase                              128   4e-33   
ref|WP_013809503.1|  acetolactate synthase                              128   5e-33   
ref|WP_013074977.1|  acetolactate synthase                              128   5e-33   
ref|WP_031516768.1|  acetolactate synthase                              128   5e-33   
ref|WP_012674812.1|  acetolactate synthase                              129   5e-33   
ref|WP_035586966.1|  acetolactate synthase                              128   6e-33   
gb|KGK97747.1|  acetolactate synthase                                   128   6e-33   
ref|WP_018178951.1|  acetolactate synthase                              128   7e-33   
gb|KDO77103.1|  hypothetical protein CISIN_1g0114911mg                  133   7e-33   
ref|WP_015411261.1|  Acetolactate synthase small subunit                127   8e-33   
ref|WP_024385604.1|  acetolactate synthase                              127   8e-33   
gb|AFW62902.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    130   8e-33   
ref|WP_012514243.1|  acetolactate synthase                              128   9e-33   
ref|WP_015419787.1|  MULTISPECIES: acetolactate synthase, small s...    128   9e-33   
ref|XP_008394268.1|  PREDICTED: acetolactate synthase small subun...    133   9e-33   
ref|WP_041285150.1|  acetolactate synthase                              127   1e-32   
gb|AGL00152.1|  acetolactate synthase, small subunit                    127   1e-32   
ref|WP_013218120.1|  acetolactate synthase                              127   1e-32   
ref|WP_021010026.1|  MULTISPECIES: acetolactate synthase                127   1e-32   
ref|WP_027356889.1|  acetolactate synthase                              127   1e-32   
ref|WP_029520561.1|  acetolactate synthase                              128   1e-32   
ref|XP_008394267.1|  PREDICTED: acetolactate synthase small subun...    132   1e-32   
ref|WP_013840430.1|  acetolactate synthase                              127   1e-32   
ref|WP_033373502.1|  acetolactate synthase                              127   1e-32   
ref|WP_017873207.1|  hypothetical protein                               127   2e-32   
ref|WP_013277203.1|  acetolactate synthase                              127   2e-32   
ref|WP_008410933.1|  putative acetolactate synthase small subunit       127   2e-32   
ref|WP_003544157.1|  acetolactate synthase                              127   2e-32   
ref|WP_017889599.1|  hypothetical protein                               126   2e-32   
ref|WP_013009759.1|  acetolactate synthase                              127   2e-32   
ref|WP_009304310.1|  MULTISPECIES: acetolactate synthase                126   2e-32   
ref|WP_011876669.1|  acetolactate synthase                              127   2e-32   
gb|ADG81247.1|  acetolactate synthase, small subunit                    127   2e-32   
ref|WP_044602782.1|  acetolactate synthase                              126   2e-32   
ref|WP_042685047.1|  acetolactate synthase                              127   2e-32   
ref|WP_024418507.1|  acetolactate synthase                              126   2e-32   
ref|WP_024395365.1|  acetolactate synthase                              126   2e-32   
ref|WP_024376591.1|  acetolactate synthase                              126   2e-32   
ref|WP_026487036.1|  acetolactate synthase                              127   2e-32   
ref|WP_013823910.1|  acetolactate synthase                              127   2e-32   
ref|WP_018334921.1|  acetolactate synthase                              126   2e-32   
ref|WP_041587884.1|  acetolactate synthase                              126   3e-32   
ref|WP_041887896.1|  acetolactate synthase                              126   3e-32   



>ref|XP_004251994.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Solanum lycopersicum]
Length=481

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDES+SKLVQQL+KLVD+HEVRD THL
Sbjct  329  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDFTHL  388

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  389  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  448

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  449  PYGICEVARTGRLALVRESGVDSKYLRGYSYPL  481


 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  97   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVMEQLQKLVNVIKVEDLSKEP  154

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK++ +   R  ++ +  IFRAK VD+SDH++T+E+TGD  KMVA+QR L  
Sbjct  155  QVERELMLIKISADPKFRAEVMWLVDIFRAKIVDISDHSLTIEVTGDPGKMVAVQRNLSK  214

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  215  FGIREIARTGKIALRRE  231



>ref|XP_009782836.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=454

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDES+SKLVQQL+KLVD+HEVRD+TH 
Sbjct  302  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDITHH  361

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  362  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  421

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  422  PYGICEVARTGRLALVRESGVDSKYLRGYSYPL  454


 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  99   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVMEQLQKLVNVIKVEDLSKDP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK++ +   R  ++ +  +FRAK VD+SDH++T+E+TGD  KMVA+QR L  
Sbjct  157  QVERELMLIKISADPKYRTEVMWLVDVFRAKIVDISDHSLTIEVTGDPGKMVAVQRNLSK  216

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  217  FGIREIARTGKIALRRE  233



>ref|XP_006353111.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Solanum tuberosum]
Length=481

 Score =   290 bits (741),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDES+SKLVQQL+KLVD+HEVRD TH 
Sbjct  329  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDFTHH  388

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  389  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  448

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  449  PYGICEVARTGRLALVRESGVDSKYLRGYSYPL  481


 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  97   GVFARRGYNIESLAVGLNKDKAL--FTVVVSGTERVLQQVMEQLQKLVNVIKVEDLSKEP  154

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  ++ +  +FRAK VD+SDH++T+E+TGD  KMVA+QR L  
Sbjct  155  QVERELMLIKINADPKYRAEVMWLVDVFRAKIVDISDHSLTIEVTGDPGKMVAVQRNLSK  214

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  215  FGIREIARTGKIALRRE  231



>ref|XP_009782832.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=483

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDES+SKLVQQL+KLVD+HEVRD+TH 
Sbjct  331  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDITHH  390

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  391  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  450

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  451  PYGICEVARTGRLALVRESGVDSKYLRGYSYPL  483


 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  99   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVMEQLQKLVNVIKVEDLSKDP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK++ +   R  ++ +  +FRAK VD+SDH++T+E+TGD  KMVA+QR L  
Sbjct  157  QVERELMLIKISADPKYRTEVMWLVDVFRAKIVDISDHSLTIEVTGDPGKMVAVQRNLSK  216

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  217  FGIREIARTGKIALRRE  233



>gb|EYU17620.1| hypothetical protein MIMGU_mgv1a005378mg [Erythranthe guttata]
Length=486

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGH+EVEGLSRITTVVPGTDESI KLVQQL+KLVDLHEVRDLTHL
Sbjct  334  TGVFARRGYNIQSLAVGHSEVEGLSRITTVVPGTDESIGKLVQQLYKLVDLHEVRDLTHL  393

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  394  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  453

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  454  PYGICEVARTGRIALVRESGVDSRYLRGYSYPL  486


 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  +  +++QL KLV++ +V D++  P
Sbjct  102  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLHHVMEQLQKLVNVLKVEDISQDP  159

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  ++ +  IFRAK VD+SDH++T+E+TGD  KMVA+QR L  
Sbjct  160  QVERELMLIKINADPNHRAEVMWLVDIFRAKIVDISDHSLTIEVTGDPGKMVAVQRNLSK  219

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  220  FGIREIARTGKIALRRE  236



>emb|CAN61470.1| hypothetical protein VITISV_043824 [Vitis vinifera]
Length=451

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESI+KLVQQL KL+DLH+VRD+THL
Sbjct  297  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINKLVQQLKKLIDLHDVRDITHL  356

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKA+DVSDHTITLELTG L KMVALQRLLE
Sbjct  357  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAIDVSDHTITLELTGALDKMVALQRLLE  416

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDSNYLRGYAFPL
Sbjct  417  PYGICEVARTGRVALVRESGVDSNYLRGYAFPL  449


 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI SLAVG  + + L   T VV GT+  + ++V+QLHKLV++ +V D++  P
Sbjct  65   GVFARRGYNIDSLAVGLNKDKAL--FTIVVSGTERVLQQVVEQLHKLVNVLKVEDISTEP  122

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  N   R  I+ + +IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  123  HVERELMLIKVNANPQYRAEIMWLVNIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  182

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  183  FGIREIARTGKIALRRE  199



>ref|XP_002279286.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI24729.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESI+KLVQQL KL+DLH+VRD+THL
Sbjct  328  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINKLVQQLKKLIDLHDVRDITHL  387

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKA+DVSDHTITLELTG L KMVALQRLLE
Sbjct  388  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAIDVSDHTITLELTGALDKMVALQRLLE  447

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDSNYLRGYAFPL
Sbjct  448  PYGICEVARTGRVALVRESGVDSNYLRGYAFPL  480


 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI SLAVG  + + L   T VV GT+  + ++V+QLHKLV++ +V D++  P
Sbjct  96   GVFARRGYNIDSLAVGLNKDKAL--FTIVVSGTERVLQQVVEQLHKLVNVLKVEDISTEP  153

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  N   R  I+ + +IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  154  HVERELMLIKVNANPQYRAEIMWLVNIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  213

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  214  FGIREIARTGKIALRRE  230



>ref|XP_010650733.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Vitis vinifera]
Length=480

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESI+KLVQQL KL+DLH+VRD+THL
Sbjct  326  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINKLVQQLKKLIDLHDVRDITHL  385

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKA+DVSDHTITLELTG L KMVALQRLLE
Sbjct  386  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAIDVSDHTITLELTGALDKMVALQRLLE  445

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDSNYLRGYAFPL
Sbjct  446  PYGICEVARTGRVALVRESGVDSNYLRGYAFPL  478


 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI SLAVG  + + L   T VV GT+  + ++V+QLHKLV++ +V D++  P
Sbjct  94   GVFARRGYNIDSLAVGLNKDKAL--FTIVVSGTERVLQQVVEQLHKLVNVLKVEDISTEP  151

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  N   R  I+ + +IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  152  HVERELMLIKVNANPQYRAEIMWLVNIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  211

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  212  FGIREIARTGKIALRRE  228



>gb|KCW46077.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=391

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGH+EVEGLSRITTVVPGTDESISKLVQQL+KLVDLHEV+DLTH+
Sbjct  239  TGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHI  298

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  299  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  358

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGYAFP+
Sbjct  359  PYGICEVARTGRIALVRESGVDSKHLRGYAFPV  391


 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  7    GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVEDLSKEP  64

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV      R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  65   QVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  124

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  125  FGIREIARTGKIALRREKMGASAPFWR  151



>gb|KCW59209.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=391

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGH+EVEGLSRITTVVPGTDESISKLVQQL+KLVDLHEV+DLTH+
Sbjct  239  TGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHI  298

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  299  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  358

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGYAFP+
Sbjct  359  PYGICEVARTGRIALVRESGVDSKHLRGYAFPV  391


 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  7    GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVEDLSKEP  64

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  N   R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  65   QVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  124

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  125  FGIREIARTGKIALRREKMGASAPFWR  151



>ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis]
 gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis]
Length=493

 Score =   288 bits (737),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T +FARRGYN+QSLAVGH+E EGLSRITTVVPGTDESISKLVQQL+KL+DLHEVRDLTHL
Sbjct  341  TGIFARRGYNVQSLAVGHSETEGLSRITTVVPGTDESISKLVQQLYKLIDLHEVRDLTHL  400

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  401  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  460

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FP+
Sbjct  461  PYGICEVARTGRIALVRESGVDSKYLRGYSFPI  493


 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++V+QL KLV++ +V DL+  P
Sbjct  109  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVVEQLQKLVNVMKVEDLSSEP  166

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  + + R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  167  QVERELMLIKVNADPSYRAEIMWLVGIFRAKIVDISEHSLTIEVTGDPGKMVAVQRNLSK  226

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  227  FGIREIARTGKIALRRE  243



>ref|XP_003524233.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Glycine max]
Length=476

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSR+TTVVPGTDESISKLVQQL+KLV+LHEVRD+THL
Sbjct  324  TGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHL  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  384  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  444  PYGICEVARTGRIALVRESGVDSKYLRGYSYPL  476


 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E   L   T VV GTD+ + ++++QL KLV++ +V DL+  P
Sbjct  92   GVFARRGYNIESLAVGLNEDRAL--FTIVVSGTDKVLRQVMEQLQKLVNVLKVEDLSREP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +      +  +  IFRAK VD+S+H++T+E+TGD  KM A+QR    
Sbjct  150  QVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISEHSVTIEVTGDPGKMAAVQRNFSK  209

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  210  FGIKEIARTGKIALRREKMGASAPFWR  236



>ref|XP_010039380.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Eucalyptus grandis]
Length=423

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGH+EVEGLSRITTVVPGTDESISKLVQQL+KLVDLHEV+DLTH+
Sbjct  271  TGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHI  330

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  331  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  390

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGYAFP+
Sbjct  391  PYGICEVARTGRIALVRESGVDSKHLRGYAFPV  423


 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  39   GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVEDLSKEP  96

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV      R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  97   QVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  156

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  157  FGIREIARTGKIALRREKMGASAPFWR  183



>gb|KJB27748.1| hypothetical protein B456_005G007600 [Gossypium raimondii]
Length=371

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYN+QSLAVGHAEVEGLSRITTVVPGTDESISKLVQQL+KLVD+HEVRDLT L
Sbjct  219  TGVFARRGYNLQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLYKLVDMHEVRDLTQL  278

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIA+IFRAKAVDVSDHT+TLELTGDL KMVALQRLLE
Sbjct  279  PFAERELMLIKIAVNAAARRDVLDIANIFRAKAVDVSDHTVTLELTGDLDKMVALQRLLE  338

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+ PL
Sbjct  339  PYGICEVARTGRLALVRESGVDSRYLRGYSLPL  371


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++V+QL KLV++ +V DL++ P
Sbjct  95   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLQQVVEQLQKLVNVWKVEDLSNEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTG  373
              ERELMLIKV  +   R  I+ +  IFRAK VD+S+H++T+E +G
Sbjct  153  QVERELMLIKVNADPKFRAEIMWLVDIFRAKIVDISEHSLTIETSG  198



>ref|XP_010070426.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW59208.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=487

 Score =   285 bits (728),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGH+EVEGLSRITTVVPGTDESISKLVQQL+KLVDLHEV+DLTH+
Sbjct  335  TGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHI  394

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  395  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  454

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGYAFP+
Sbjct  455  PYGICEVARTGRIALVRESGVDSKHLRGYAFPV  487


 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  103  GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVEDLSKEP  160

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  N   R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  161  QVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  220

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  221  FGIREIARTGKIALRREKMGASAPFWR  247



>gb|KCW59207.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=487

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGH+EVEGLSRITTVVPGTDESISKLVQQL+KLVDLHEV+DLTH+
Sbjct  335  TGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHI  394

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  395  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  454

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGYAFP+
Sbjct  455  PYGICEVARTGRIALVRESGVDSKHLRGYAFPV  487


 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  103  GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVEDLSKEP  160

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  N   R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  161  QVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  220

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  221  FGIREIARTGKIALRREKMGASAPFWR  247



>ref|XP_007159564.1| hypothetical protein PHAVU_002G248000g [Phaseolus vulgaris]
 gb|ESW31558.1| hypothetical protein PHAVU_002G248000g [Phaseolus vulgaris]
Length=473

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSR+TTVVPGTDE+ISKLVQQL+KLV+LHEVRD+THL
Sbjct  321  TGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDETISKLVQQLYKLVELHEVRDITHL  380

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA+AVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  381  PFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLE  440

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGYA+P+
Sbjct  441  PYGICEVARTGRIALIRESGVDSKYLRGYAYPV  473


 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E   L   T VV GTD+ + ++++QL KLV++ +V DL+  P
Sbjct  89   GVFARRGYNIESLAVGLNEDRAL--FTIVVSGTDKVLLQVMEQLQKLVNVLKVEDLSREP  146

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +      +  +  IFRAK VD+S+H++T+E+TGD  KM A+QR L  
Sbjct  147  QVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISEHSVTIEVTGDPGKMAAVQRNLSK  206

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  207  FGIKEIARTGKIALRREKMGASAPFWR  233



>ref|XP_007033634.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Theobroma cacao]
 gb|EOY04560.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Theobroma cacao]
Length=478

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVPGTDESISKLVQQL+KLVDLHEVRDLT+L
Sbjct  326  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVRDLTYL  385

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIA+IFRAKAVDVS HTITLELTGDL KMVALQRLLE
Sbjct  386  PFAERELMLIKIAVNAAARRDVLDIANIFRAKAVDVSGHTITLELTGDLDKMVALQRLLE  445

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FP+
Sbjct  446  PYGICEVARTGRVALVRESGVDSKYLRGYSFPV  478


 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++V+QL KLV++ +V DL++ P
Sbjct  94   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVVEQLQKLVNVWKVEDLSNEP  151

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +      I  +  IFRA+ VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  152  QVERELMLIKVNADPKFGAEIKWLVDIFRAQIVDISEHSLTIEVTGDPGKMVAVQRNLSK  211

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  212  FGIKEIARTGKIALRREKMGASAPFWR  238



>gb|KHN48087.1| Acetolactate synthase small subunit [Glycine soja]
Length=471

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSR+TTVVPGTDESISKLVQQL+KLV+LHEVRD+THL
Sbjct  319  TGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHL  378

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVS HTITLELTGDL KMVALQRLLE
Sbjct  379  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSGHTITLELTGDLDKMVALQRLLE  438

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  439  PYGICEVARTGRIALVRESGVDSKYLRGYSYPL  471


 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E   L   T VV GTD+ + ++++QL KLV++ +V DL+  P
Sbjct  87   GVFARRGYNIESLAVGLNEDRAL--FTIVVSGTDKVLRQVMEQLQKLVNVLKVEDLSREP  144

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +      +  +  IFRAK VD+S H++T+E+TGD  KM A+QR    
Sbjct  145  QVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISQHSVTIEVTGDPGKMAAVQRNFSK  204

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  205  FGIKEIARTGKIALRREKMGASAPFWR  231



>gb|EYU36664.1| hypothetical protein MIMGU_mgv1a005401mg [Erythranthe guttata]
Length=485

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE+EGLSRITTVVPGTDESISKL+QQL KL DLHEVRD THL
Sbjct  333  TGVFARRGYNIQSLAVGHAEIEGLSRITTVVPGTDESISKLLQQLRKLNDLHEVRDFTHL  392

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KM+ALQRLLE
Sbjct  393  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLDKMIALQRLLE  452

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY++PL
Sbjct  453  PYGICEVARTGRVALVRESGVDSRYLRGYSYPL  485


 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ I ++++QL KLV++ +V D++  P
Sbjct  102  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVIQQVMEQLKKLVNVLKVEDISKEP  159

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  ++ +  IFRA+ VD SDH++T+E+TGD  KMVA+QR L  
Sbjct  160  QVERELMLIKINADPQHRAEVMWLMDIFRAQIVDTSDHSLTIEVTGDPGKMVAVQRNLSK  219

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  220  FGIREIARTGKIALRRE  236



>ref|XP_004504413.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Cicer arietinum]
Length=424

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGH+EVEG+SR+TTVVPGTDESISKLVQQL+KLV+LHEVRD+TH+
Sbjct  272  TGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHV  331

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA+AVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  332  PFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLE  391

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL R+SGVDS YLRGY+FPL
Sbjct  392  PYGICEVARTGRIALVRDSGVDSRYLRGYSFPL  424


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 70/104 (67%), Gaps = 2/104 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L  I  VV GT+  + ++V+QL KLV++ +V DL++ P
Sbjct  91   GVFARRGYNIESLAVGLNQDRALFSI--VVSGTNRVLQQVVEQLQKLVNVLKVEDLSNEP  148

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLEL  379
              ERELML+KV  +   R  I  +   FR K VD+S++++T+E+
Sbjct  149  QVERELMLLKVHADPQNRAEIKWLVDTFRGKIVDISENSVTIEV  192



>ref|XP_010557052.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=417

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EG SRITTV+P TDESISKLVQQL+KLVD+HEVRDLTHL
Sbjct  265  TGVFARRGYNIQSLAVGHAETEGRSRITTVIPATDESISKLVQQLYKLVDVHEVRDLTHL  324

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN   RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  325  PFAERELMLIKIAVNTVARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  384

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  385  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  417


 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = -2

Query  687  VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPF  508
            +FARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P 
Sbjct  34   IFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQ  91

Query  507  AERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPY  328
             ERELML+KV  +   R  I+ +   FR+K VD+S+H +T+E+TGD  KM A++R L  +
Sbjct  92   VERELMLVKVNAHPESRAEIMWLVDTFRSKIVDISEHALTIEVTGDPGKMNAVERNLRKF  151

Query  327  GICEVARTGRVALARE  280
            GI E+ARTG++AL RE
Sbjct  152  GIREIARTGKIALRRE  167



>ref|XP_003532793.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Glycine max]
Length=474

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSR+TTVVPGTDESISKLVQQL+KLV+LHEVRD+THL
Sbjct  322  TGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHL  381

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVS HTITLELTGDL KMVALQRLLE
Sbjct  382  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSGHTITLELTGDLDKMVALQRLLE  441

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  442  PYGICEVARTGRIALVRESGVDSKYLRGYSYPL  474


 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E   L   T VV GTD+ + ++++QL KLV++ +V DL+  P
Sbjct  90   GVFARRGYNIESLAVGLNEDRAL--FTIVVSGTDKVLRQVMEQLQKLVNVLKVEDLSREP  147

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +      +  +  IFRAK VD+S H++T+E+TGD  KM A+QR    
Sbjct  148  QVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISQHSVTIEVTGDPGKMAAVQRNFSK  207

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  208  FGIKEIARTGKIALRREKMGASAPFWR  234



>emb|CDP08089.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTD SISKLVQQL KLV+LHEVRDLTH+
Sbjct  354  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDASISKLVQQLSKLVELHEVRDLTHM  413

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  414  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  473

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++P+
Sbjct  474  PYGICEVARTGRIALVRESGVDSRYLRGYSYPV  506


 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++++QL KLV++ +V D++  P
Sbjct  122  GVFARRGYNIESLAVGLNKDKAL--FTIVVCGTDTVLQQVMEQLQKLVNVIKVEDISKEP  179

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+K+  +   R  ++ +   FRAK VD+SD+++T+E+TGD  K+VA+QR L  
Sbjct  180  QVERELMLVKINSDPDYRAEVMWLVDTFRAKIVDLSDYSLTIEVTGDPGKLVAVQRNLSK  239

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  240  FGIREIARTGKIALRRE  256



>ref|XP_004490063.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=475

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGH+EVEG+SR+TTVVPGTDESISKLVQQL+KLV+LHEVRD+TH+
Sbjct  323  TGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHV  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA+AVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  383  PFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLE  442

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL R+SGVDS YLRGY+FPL
Sbjct  443  PYGICEVARTGRIALVRDSGVDSRYLRGYSFPL  475


 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L  I  VV GT+  + ++V+QL KLV++ +V DL++ P
Sbjct  91   GVFARRGYNIESLAVGLNQDRALFSI--VVSGTNRVLQQVVEQLQKLVNVLKVEDLSNEP  148

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I  +   FR K VD+S++++T+E+TGD  KMVA+QR L  
Sbjct  149  QVERELMLLKVNADPQNRAEIKWLVDTFRGKIVDISENSVTIEVTGDPGKMVAVQRSLSK  208

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E++RTG++AL RE  G  + + R
Sbjct  209  FGIKEISRTGKIALRREKMGASAPFWR  235



>ref|XP_009141188.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=487

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EG+SRITTVVP TDES+SKLVQQL+KL+D+HEV DLTH+
Sbjct  333  TGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLIDVHEVHDLTHM  392

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  393  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  452

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  453  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  485


 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  101  GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  158

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L  
Sbjct  159  QVERELMLVKVNAHPESRAQIMWLVDTFRARIVDIAEHALTIEVTGDPGKMIAVERNLRK  218

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  219  FQIREIVRTGKIALRREKMGAPAPFWR  245



>ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa]
 gb|EEE90845.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa]
Length=490

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVPGTDESI+KLVQQL+KLV++HEVRDLTH+
Sbjct  338  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITKLVQQLYKLVEIHEVRDLTHV  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA AVDVSDHT+TLELTGDL KMVALQRLLE
Sbjct  398  PFAERELMLIKIAVNAAARRDVLDIASIFRANAVDVSDHTVTLELTGDLDKMVALQRLLE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FP+
Sbjct  458  PYGICEVARTGRIALTRESGVDSKYLRGYSFPV  490


 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 103/150 (69%), Gaps = 6/150 (4%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + +   T VV GT+  + ++V+QL KLV++ +V DL++ P
Sbjct  103  GVFARRGYNIESLAVGLNKDKAM--FTIVVSGTERVLQQVVEQLQKLVNVLKVEDLSNEP  160

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +  IFRAK VD+S+HT+T+E+TGD  K+ A+QR L  
Sbjct  161  QVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISEHTVTIEVTGDPGKIAAVQRNLSK  220

Query  330  YGICEVARTGRV---ALARES-GVDSNYLR  253
            +GI E+ARTG+V   AL RE  G  + + R
Sbjct  221  FGIREIARTGKVVLIALRREKMGASAPFWR  250



>ref|XP_006470698.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Citrus sinensis]
Length=488

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVP TDESISKL+QQL+KL+DLHEVRDLTHL
Sbjct  336  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHL  395

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN   RR +LDIA+IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  396  PFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  455

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  456  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  488


 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ + ++++QL KLV++ +V DL++ P
Sbjct  105  GVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +   R  I  +  IFRAK VD+S++++T+E+TGD  KMVA+QR L  
Sbjct  163  QVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  223  FGIREIARTGKIALRREKLGASAPFWR  249



>ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59438.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=471

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVP TDESISKL+QQL+KL+DLHEVRDLTHL
Sbjct  319  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHL  378

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN   RR +LDIA+IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  379  PFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  438

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  439  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  471


 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 91/147 (62%), Gaps = 20/147 (14%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+                 V DL++ P
Sbjct  105  GVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDK-----------------VEDLSNEP  145

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +   R  I  +  IFRAK VD+S++++T+E+TGD  KMVA+QR L  
Sbjct  146  QVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSK  205

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  206  FGIREIARTGKIALRREKLGASAPFWR  232



>ref|XP_011005277.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, 
partial [Populus euphratica]
Length=475

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVPGTDESI+KLVQQL+KLV++HEVRDLTH+
Sbjct  323  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITKLVQQLYKLVEIHEVRDLTHV  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA AVDVSDHT+TLELTGDL KMVALQRLLE
Sbjct  383  PFAERELMLIKIAVNAAARRDVLDIASIFRANAVDVSDHTVTLELTGDLDKMVALQRLLE  442

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FP+
Sbjct  443  PYGICEVARTGRIALTRESGVDSKYLRGYSFPV  475


 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + +   T VV GT+  + ++V+QL KLV++ +V DL++ P
Sbjct  91   GVFARRGYNIESLAVGLNKDKAI--FTIVVSGTERVLQQVVEQLQKLVNVLKVEDLSNEP  148

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +  IFRAK VD+S+HT+T+E+TGD  K+ A+QR L  
Sbjct  149  QVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISEHTVTIEVTGDPGKIAAVQRNLSK  208

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  209  FGIREIARTGKIALRREKMGASAPFWR  235



>ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59439.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=488

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVP TDESISKL+QQL+KL+DLHEVRDLTHL
Sbjct  336  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHL  395

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN   RR +LDIA+IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  396  PFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  455

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  456  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  488


 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ + ++++QL KLV++ +V DL++ P
Sbjct  105  GVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +   R  I  +  IFRAK VD+S++++T+E+TGD  KMVA+QR L  
Sbjct  163  QVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  223  FGIREIARTGKIALRREKLGASAPFWR  249



>emb|CDY15367.1| BnaC04g42560D [Brassica napus]
Length=487

 Score =   282 bits (722),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGHAE EG+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTH+
Sbjct  333  TGVFSRRGYNIQSLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHM  392

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  393  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  452

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  453  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  485


 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  101  GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  158

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L  
Sbjct  159  QVERELMLVKVNAHPESRAQIMWLVDTFRARIVDIAEHALTIEVTGDPGKMIAVERNLRK  218

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  219  FQIREIVRTGKIALRREKMGATAPFWR  245



>gb|KJB27747.1| hypothetical protein B456_005G007600 [Gossypium raimondii]
Length=479

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYN+QSLAVGHAEVEGLSRITTVVPGTDESISKLVQQL+KLVD+HEVRDLT L
Sbjct  327  TGVFARRGYNLQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLYKLVDMHEVRDLTQL  386

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIA+IFRAKAVDVSDHT+TLELTGDL KMVALQRLLE
Sbjct  387  PFAERELMLIKIAVNAAARRDVLDIANIFRAKAVDVSDHTVTLELTGDLDKMVALQRLLE  446

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+ PL
Sbjct  447  PYGICEVARTGRLALVRESGVDSRYLRGYSLPL  479


 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++V+QL KLV++ +V DL++ P
Sbjct  95   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLQQVVEQLQKLVNVWKVEDLSNEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +   R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  153  QVERELMLIKVNADPKFRAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKMVAVQRNLSK  212

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  213  FGIKEIARTGKIALRREKMGASAPFWR  239



>ref|XP_010557051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=489

 Score =   282 bits (722),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EG SRITTV+P TDESISKLVQQL+KLVD+HEVRDLTHL
Sbjct  337  TGVFARRGYNIQSLAVGHAETEGRSRITTVIPATDESISKLVQQLYKLVDVHEVRDLTHL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN   RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  397  PFAERELMLIKIAVNTVARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  457  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  489


 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FR+K VD+S+H +T+E+TGD  KM A++R L  
Sbjct  163  QVERELMLVKVNAHPESRAEIMWLVDTFRSKIVDISEHALTIEVTGDPGKMNAVERNLRK  222

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  223  FGIREIARTGKIALRRE  239



>ref|XP_008344057.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=251

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EGLSRITTVVPGTDESISKLVQQL+KLVD+H+V+DLT+L
Sbjct  99   TGVFARRGYNIQSLAVGXAEAEGLSRITTVVPGTDESISKLVQQLYKLVDVHDVQDLTNL  158

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDI +IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  159  PFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  218

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FPL
Sbjct  219  PYGICEVARTGRIALVRESGVDSKYLRGYSFPL  251



>ref|XP_009132818.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=480

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTHL
Sbjct  326  TGVFARRGYNIQSLAVGHAEAQGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHL  385

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  386  PFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  445

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  446  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  478


 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  94   GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  151

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  152  QVERELMLVKVNAHPEYRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKK  211

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  212  FEIREIVRTGKIALRREKMGATAPFWR  238



>gb|KDO50434.1| hypothetical protein CISIN_1g047033mg, partial [Citrus sinensis]
Length=514

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVP TDESISKL+QQL+KL+DLHEVRDLTHL
Sbjct  362  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHL  421

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN   RR +LDIA+IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  422  PFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  481

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  482  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  514


 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 15/159 (9%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ + ++++QL KLV++ +V DL++ P
Sbjct  119  GVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEP  176

Query  510  FAERELMLIKVAVNAAVRRTIL------------DIASIFRAKAVDVSDHTITLELTGDL  367
              ERELMLIKV  +   R  I              +  IFRAK VD+S++++T+E+TGD 
Sbjct  177  QVERELMLIKVNADPKFRAEIFLFPCLGVHLQIRWLVDIFRAKIVDISEYSLTIEVTGDP  236

Query  366  HKMVALQRLLEPYGICEVARTGRVALARES-GVDSNYLR  253
             KMVA+QR L  +GI E+ARTG++AL RE  G  + + R
Sbjct  237  GKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPFWR  275



>ref|XP_011047624.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Populus euphratica]
Length=521

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVPGTDESI+KLVQQL+KLV++HEVRDLTH+
Sbjct  369  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITKLVQQLYKLVEIHEVRDLTHV  428

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA AVDVSDHT+TLELTGDL KMVALQRLLE
Sbjct  429  PFAERELMLIKIAVNAAARRDVLDIASIFRANAVDVSDHTVTLELTGDLDKMVALQRLLE  488

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FP+
Sbjct  489  PYGICEVARTGRIALTRESGVDSKYLRGYSFPV  521


 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + +   T VV GT+  + ++V+QL KLV++ +V DL++ P
Sbjct  137  GVFARRGYNIESLAVGLNKDKAI--FTIVVSGTERVLQQVVEQLQKLVNVLKVEDLSNEP  194

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +  IFRAK VD+S+HT+T+E+TGD  K+ A+QR L  
Sbjct  195  QVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISEHTVTIEVTGDPGKIAAVQRNLSK  254

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  255  FGIREIARTGKIALRREKMGASAPFWR  281



>ref|XP_010469676.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=491

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTHL
Sbjct  337  TGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQR LE
Sbjct  397  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRFLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  457  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  489


 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  163  QVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  223  FQIREIVRTGKIALRREKMGATAPFWR  249



>ref|XP_010469674.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010469675.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=492

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTHL
Sbjct  338  TGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHL  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQR LE
Sbjct  398  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRFLE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  458  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  490


 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  106  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  163

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  164  QVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKK  223

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  224  FQIREIVRTGKIALRREKMGATAPFWR  250



>ref|NP_850172.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 sp|Q93YZ7.1|ILVH2_ARATH RecName: Full=Acetolactate synthase small subunit 2, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24267.1| At2g31810/F20M17.15 [Arabidopsis thaliana]
 gb|AAM65359.1| At2g31810/F20M17.15 [Arabidopsis thaliana]
 gb|AEC08586.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=491

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTV+P TDES+SKLVQQL+KLVD+HEV DLTHL
Sbjct  337  TGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  397  PFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  457  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  489


 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  163  QVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLKK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  223  FQIREIVRTGKIALRREKMGATAPFWR  249



>gb|KDP35124.1| hypothetical protein JCGZ_10658 [Jatropha curcas]
Length=483

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGH+E EG+SRITTVVPGTDESISKLVQQL+KLV+LHEV+DLTHL
Sbjct  331  TGVFARRGYNIQSLAVGHSETEGISRITTVVPGTDESISKLVQQLYKLVELHEVQDLTHL  390

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA+AVDVSDHT+TLELTGDL KMVALQRLLE
Sbjct  391  PFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHTVTLELTGDLDKMVALQRLLE  450

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGYAFP+
Sbjct  451  PYGICEVARTGRIALVRESGVDSKHLRGYAFPI  483


 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL KLV++ +V DL+  P
Sbjct  99   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLQQVVEQLQKLVNVLKVEDLSSEP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +   R  I  +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L+ 
Sbjct  157  QVERELMLIKVNADPNYRAEIKWLVEIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLKK  216

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  217  FGIREIARTGKIALRRE  233



>ref|XP_010414082.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=492

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTHL
Sbjct  338  TGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHL  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNA  RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  398  PFAERELMLIKIAVNATARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  458  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  490


 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  106  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  163

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  164  QVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKK  223

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  224  FQIREIVRTGKIALRREKMGATAPFWR  250



>ref|XP_009366239.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Pyrus x bretschneideri]
Length=489

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVPGTDESISKLVQQL+KLVD+H+V+DLT+L
Sbjct  337  TGVFARRGYNIQSLAVGHAEAEGLSRITTVVPGTDESISKLVQQLYKLVDIHDVQDLTNL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NAA RR +LDI +IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  397  PFAERELMLIKIAANAAARRDVLDIGNIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FPL
Sbjct  457  PYGICEVARTGRIALVRESGVDSKYLRGYSFPL  489


 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  +  +++QL+KLV++ +V DL+  P
Sbjct  105  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVLRLVIEQLNKLVNVMKVEDLSIEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  + +    I  + SIFRAK VD+S+H++T+E+TGD  KMVALQR    
Sbjct  163  QVERELMLIKVNADPSYHAEIKWLVSIFRAKIVDISEHSVTIEVTGDPGKMVALQRNFSK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI EVARTG++AL RE  G  + + R
Sbjct  223  FGIREVARTGKIALRREKLGASAPFWR  249



>ref|XP_010510152.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Camelina sativa]
 ref|XP_010510153.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Camelina sativa]
Length=492

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTVVP TDES+SKLVQQL+KLVD+H V DLTHL
Sbjct  338  TGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSKLVQQLNKLVDVHAVHDLTHL  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  398  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  458  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  490


 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  106  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  163

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  164  QVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKK  223

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  224  FQIREIVRTGKIALRREKMGATAPFWR  250



>gb|AFK41430.1| unknown [Lotus japonicus]
Length=478

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGH+EVEG+SR+TTVVPGTDESI KL+QQL+KL+D HEVRDLTH+
Sbjct  326  TGVFSRRGYNIQSLAVGHSEVEGISRLTTVVPGTDESIGKLLQQLYKLIDQHEVRDLTHM  385

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDI SIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  386  PFAERELMLIKIAVNAAARRDVLDIGSIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  445

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FPL
Sbjct  446  PYGICEVARTGRIALVRESGVDSKYLRGYSFPL  478


 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRG+NI+SLAVG  E + L   T VV GT   + ++V+QL KL ++ +V DL++ P
Sbjct  94   GVFARRGFNIESLAVGLNEDKAL--FTIVVSGTGTVLRQVVEQLQKLANVLKVEDLSNEP  151

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV      R  +  +  IFRAK VD+S+H++T+E+TGD  K+VA+QR L  
Sbjct  152  QVERELMLIKVHAEPQNRAELKWLVDIFRAKIVDISEHSVTIEVTGDPGKLVAVQRNLSK  211

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  212  FGIKEIARTGKIALRREKMGASAPFWR  238



>ref|XP_011085048.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Sesamum indicum]
Length=476

 Score =   280 bits (715),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEG SRITTVVPGTDESI KLVQQL+KLVD+HEVRDLTHL
Sbjct  324  TGVFARRGYNIQSLAVGHAEVEGHSRITTVVPGTDESIRKLVQQLYKLVDVHEVRDLTHL  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVS HTITLELTGDL KMVALQRLLE
Sbjct  384  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSGHTITLELTGDLDKMVALQRLLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  444  PYGICEVARTGRLALIRESGVDSRYLRGYSYPL  476


 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  93   GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVEDISKEP  150

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  ++ +  IFRAK VD+SDH++T+E+TGD  KMVA+QR L  
Sbjct  151  QVERELMLIKINADPKYRAEVMWLVDIFRAKIVDISDHSLTIEVTGDPGKMVAVQRNLSK  210

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  211  FGIREIARTGKIALRRE  227



>ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum]
 gb|ESQ51762.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum]
Length=491

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EG+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTHL
Sbjct  337  TGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA AVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  397  PFAERELMLIKIAVNAAARRDVLDIASIFRAIAVDVSDHTITLQLTGDLDKMVALQRLLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  457  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  489


 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L  
Sbjct  163  QVERELMLVKVNAHPESRPEIMWLVDTFRARIVDIAEHALTIEVTGDPGKMIAVERNLRK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  223  FQIREIVRTGKIALRREKMGATAPFWR  249



>ref|XP_010672487.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=486

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T  FARRGYNIQSLAVGHAE +GLSRITTVV GTDESISKLVQQ++KLVD+HEV+DLTHL
Sbjct  334  TGAFARRGYNIQSLAVGHAETKGLSRITTVVTGTDESISKLVQQIYKLVDIHEVKDLTHL  393

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELML+KVAVN A RR +LDIASIFRAKAVDVSDHTITLELTGD++KMVALQRLLE
Sbjct  394  PFAERELMLVKVAVNTAARREVLDIASIFRAKAVDVSDHTITLELTGDVNKMVALQRLLE  453

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FP+
Sbjct  454  PYGICEVARTGRVALARESGVDSRYLRGYSFPV  486


 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++++QL KL+++ +V D++  P
Sbjct  102  GVFARRGYNIESLAVGLNEDKAL--FTIVVSGTDKVLHQVMEQLQKLLNVLKVEDISREP  159

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  + + R  ++ +  IFRAK VD+S+  +T+E+TGD  KMVA+ R L  
Sbjct  160  QVERELMLVKVGADQSSRGELMWLVDIFRAKIVDISEEYLTVEVTGDPGKMVAVLRNLSK  219

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  220  FGIREIARTGKIALRRE  236



>ref|XP_008450270.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Cucumis melo]
Length=443

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T +FARRGYNIQSLAVGHAE EG+SRITTVVPGTDESI KLVQQL++L D+HEVRDLTHL
Sbjct  291  TGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYKLVQQLYRLADVHEVRDLTHL  350

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+A N + RR +LDIA IFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  351  PFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  410

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  411  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  443


 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++++QLHKLV++ +V DL+ + 
Sbjct  110  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLEQVIEQLHKLVNVLKVEDLSSVQ  167

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I  +  +FRAK VD+SD ++T+E+TGD  KMVA QR L  
Sbjct  168  QVERELMLIKINADPTYRAEIKRLVDVFRAKIVDISDDSVTIEVTGDPGKMVAFQRNLSK  227

Query  330  YGICEVARTGR  298
            +GI E+ARTG+
Sbjct  228  FGIREIARTGK  238



>gb|EPS72034.1| hypothetical protein M569_02723, partial [Genlisea aurea]
Length=408

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +GLSRITTVVPGTDESI+KL++QL+KL+DLH V DLTHL
Sbjct  253  TGVFARRGYNIQSLAVGHAETDGLSRITTVVPGTDESIAKLLKQLNKLIDLHAVEDLTHL  312

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVNAA RR +LDIASIFRAKAVDVSDHTITLELTGD  KMVALQRLLE
Sbjct  313  PFAERELMLIKVAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDFDKMVALQRLLE  372

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY++PL
Sbjct  373  PYGICEVARTGRVALLRESGVDSRYLRGYSYPL  405


 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  +  +++QL KLV++ +V D++  P
Sbjct  22   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLHHVMEQLKKLVNVLKVEDISREP  79

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + A R  ++ +  IFRAK VD++D ++T+E+TGD  KMVA+QR L  
Sbjct  80   QVERELMLIKINADPAYRAEVMWLVDIFRAKIVDIADMSLTIEVTGDPGKMVAVQRNLSK  139

Query  330  YGICEVARTGRVALARE  280
            +G+ E+ARTG++AL RE
Sbjct  140  FGVREIARTGKIALRRE  156



>ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Capsella rubella]
 gb|EOA26991.1| hypothetical protein CARUB_v10023086mg [Capsella rubella]
Length=492

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRIT VVP TDES+SKLVQQL+KLVD+HEV DLTHL
Sbjct  338  TGVFARRGYNIQSLAVGHAETKGISRITLVVPATDESVSKLVQQLNKLVDVHEVHDLTHL  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  398  PFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  458  PYGICEVARTGRVALARESGVDSKYLRGYSFPL  490


 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  106  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLLKLVNVLKVEDISSEP  163

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  N   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R LE 
Sbjct  164  QVERELMLVKVNANPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLEK  223

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  224  FQIREIVRTGKIALRREKMGATAPFWR  250



>ref|XP_004504201.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Cicer arietinum]
Length=475

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSL VGH+EVEG+ R+TTVVPGTDESISKLVQQL+KLV+LHEVRD+TH+
Sbjct  323  TGVFARRGYNIQSLVVGHSEVEGIYRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHV  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA+AVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  383  PFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLE  442

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL R+SGVDS YLRGY+FPL
Sbjct  443  PYGICEVARTGRIALVRDSGVDSRYLRGYSFPL  475


 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             V A+RGYNI+SLAVG  + + L  ++ VV GTD  + ++V+QL KLV++ +V DL++ P
Sbjct  91   GVLAKRGYNIESLAVGLNQDKAL--LSIVVSGTDRGLQQVVEQLQKLVNVLKVEDLSYEP  148

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I  +   FR   VDVS++++T+E+TGD  KMVA+QR L  
Sbjct  149  QVERELMLLKVHADPQNRAEIKWLVDTFRGNIVDVSENSVTIEVTGDPGKMVAVQRSLRR  208

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI EV+RTG++AL RE  G  + + R
Sbjct  209  FGIKEVSRTGKIALRREKMGASAPFWR  235



>ref|XP_008354318.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=489

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVPGTDESISKLVQQL+KLVD+H+V+DLT+L
Sbjct  337  TGVFARRGYNIQSLAVGHAEAEGLSRITTVVPGTDESISKLVQQLYKLVDVHDVQDLTNL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDI +IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  397  PFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FPL
Sbjct  457  PYGICEVARTGRIALVRESGVDSKYLRGYSFPL  489


 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  +  +++QL+KLV++ +V DL+  P
Sbjct  105  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVLRLVIEQLNKLVNVMKVEDLSIEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  + +    I  +  IFRAK VD+S+H++T+E+TGD  KMVALQR L  
Sbjct  163  QVERELMLIKVNADPSYHAEIKWLVXIFRAKIVDISEHSVTIEVTGDPGKMVALQRNLSK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  223  FGIREIARTGKIALRREKLGASAPFWR  249



>ref|XP_008450269.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Cucumis melo]
Length=495

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T +FARRGYNIQSLAVGHAE EG+SRITTVVPGTDESI KLVQQL++L D+HEVRDLTHL
Sbjct  343  TGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYKLVQQLYRLADVHEVRDLTHL  402

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+A N + RR +LDIA IFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  403  PFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  462

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  463  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  495


 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++++QLHKLV++ +V DL+ + 
Sbjct  110  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLEQVIEQLHKLVNVLKVEDLSSVQ  167

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I  +  +FRAK VD+SD ++T+E+TGD  KMVA QR L  
Sbjct  168  QVERELMLIKINADPTYRAEIKRLVDVFRAKIVDISDDSVTIEVTGDPGKMVAFQRNLSK  227

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  228  FGIREIARTGKIALRREKLGASAPFWR  254



>ref|XP_008383599.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Malus domestica]
Length=478

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AEVEGLSRITTVVPGTD+SISKLVQQLHKL+DLHEVRD++HL
Sbjct  326  TGVLSRRGYNIQSLAVGPAEVEGLSRITTVVPGTDDSISKLVQQLHKLIDLHEVRDISHL  385

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN   RR +LDIASIFRAKAVDVSDHTITLELTGDL+KMVALQ+LLE
Sbjct  386  PFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQKLLE  445

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  PL
Sbjct  446  PYGICEVARTGRVALQRESGVDSTYLRGYPLPL  478


 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 98/152 (64%), Gaps = 12/152 (8%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V D++  P
Sbjct  93   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLRQVVEQLNKLVNVIKVEDISREP  150

Query  510  FAERELMLIKVAVNAAVRRTI--LDIASIFRAKAVDVSDHTITL---ELTGDLHKMVALQ  346
              ERELMLIK+  + + R  +    I  IF  K++    HT  +   ++TGD  K+VA+Q
Sbjct  151  QVERELMLIKLNADPSTRAEVNFWIIQPIFGYKSI----HTYKISSSQITGDPGKVVAVQ  206

Query  345  RLLEPYGICEVARTGRVALARES-GVDSNYLR  253
            R L  +GI E+ARTG++AL RE  G  + + R
Sbjct  207  RNLSKFGIKELARTGKIALRREKMGATAPFWR  238



>ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cucumis sativus]
Length=412

 Score =   275 bits (703),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T +FARRGYNIQSLAVGHAE EG+SRITTVVPGTDESI KLVQ L++L D+HEVRDLTH+
Sbjct  260  TGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYKLVQHLYRLADVHEVRDLTHI  319

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+A N + RR +LDIA IFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  320  PFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  379

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  380  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  412


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L  +T VV GT++ + ++++QLHKLV++ +V DL+ + 
Sbjct  104  GVFARRGYNIESLAVGLNKDKAL--LTIVVSGTEKVLEQVIEQLHKLVNVLKVEDLSSVQ  161

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLE-LTGDLHKM  358
              ERELMLIK+      R  I  +  +FRAK VD+SD ++T+E + GD++ +
Sbjct  162  QVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDDSVTIETVKGDVYPV  213



>ref|XP_007201965.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica]
 gb|EMJ03164.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica]
Length=494

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQL+KL D+H+V+DLT+L
Sbjct  342  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLYKLADIHDVQDLTNL  401

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDI +IFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  402  PFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  461

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGY+FPL
Sbjct  462  PYGICEVARTGRIALVRESGVDSKHLRGYSFPL  494


 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL+KLV++ +V DL++ P
Sbjct  110  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVLRQVIEQLNKLVNVLKVEDLSNEP  167

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  + + R  I  + +IFRAK VD+S+H++T+E+TGD  KMVALQR    
Sbjct  168  QVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDISEHSVTIEVTGDPGKMVALQRNFSK  227

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI EVARTG++AL RE  G  + + R
Sbjct  228  FGIKEVARTGKIALRREKLGASAPFWR  254



>ref|XP_003629945.1| Acetolactate synthase small subunit [Medicago truncatula]
 gb|AET04421.1| acetolactate synthase, small subunit [Medicago truncatula]
Length=478

 Score =   277 bits (708),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGH+EVEG+SR+TTVVPGTDESISKLVQQL+KLV+L EVRD+THL
Sbjct  326  TGVFARRGYNIQSLAVGHSEVEGISRLTTVVPGTDESISKLVQQLYKLVELREVRDITHL  385

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  386  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  445

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+ L RESGVDS +LRGY+ PL
Sbjct  446  PYGICEVARTGRIGLVRESGVDSKHLRGYSLPL  478


 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GTD  + ++V+QL KLV++ +V DL+  P
Sbjct  94   GVFARRGYNIESLAVGLNQDRAL--FTIVVSGTDRVLRQVVEQLQKLVNVLKVEDLSREP  151

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I  +   FRAK VD+S+H++T+E+TGD  KMVA+QR    
Sbjct  152  QVERELMLVKVHADPQNRAEIKWLVDTFRAKIVDISEHSVTIEVTGDPGKMVAVQRNFGK  211

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  212  FGIKEIARTGKIALRREKMGASAPFWR  238



>ref|XP_008243054.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Prunus mume]
Length=495

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQL+KL D+H+V+DLT+L
Sbjct  343  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLYKLADIHDVQDLTNL  402

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDI +IFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  403  PFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  462

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGY+FPL
Sbjct  463  PYGICEVARTGRIALVRESGVDSKHLRGYSFPL  495


 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL+KLV++ +V DL++ P
Sbjct  111  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVLRQVIEQLNKLVNVLKVEDLSNEP  168

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  + + R  I  + +IFRAK VD+S+H++T+E+TGD  KMVALQR    
Sbjct  169  QVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDISEHSVTIEVTGDPGKMVALQRNFSK  228

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI EVARTG++AL RE  G  + + R
Sbjct  229  FGIKEVARTGKIALRREKLGASAPFWR  255



>ref|XP_008243055.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Prunus mume]
Length=494

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQL+KL D+H+V+DLT+L
Sbjct  342  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLYKLADIHDVQDLTNL  401

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDI +IFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  402  PFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  461

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGY+FPL
Sbjct  462  PYGICEVARTGRIALVRESGVDSKHLRGYSFPL  494


 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL+KLV++ +V DL++ P
Sbjct  110  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVLRQVIEQLNKLVNVLKVEDLSNEP  167

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  + + R  I  + +IFRAK VD+S+H++T+E+TGD  KMVALQR    
Sbjct  168  QVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDISEHSVTIEVTGDPGKMVALQRNFSK  227

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI EVARTG++AL RE  G  + + R
Sbjct  228  FGIKEVARTGKIALRREKLGASAPFWR  254



>ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55603.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = -2

Query  693  TAVFARRGYNIQS-LAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTH  517
            T VFARRGYNIQ+ LAVGHAE +G+SRITTVVP TDESISKLVQQL+KLVD+HEV DLTH
Sbjct  337  TGVFARRGYNIQAYLAVGHAETKGISRITTVVPATDESISKLVQQLYKLVDVHEVHDLTH  396

Query  516  LPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLL  337
            LPFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLL
Sbjct  397  LPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLL  456

Query  336  EPYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            EPYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  457  EPYGICEVARTGRVALARESGVDSKYLRGYSFPL  490


 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L  
Sbjct  163  QVERELMLVKVNAHPEFRAEIMWLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLRK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  223  FQIREIVRTGKIALRREKMGATAPFWR  249



>ref|NP_850173.2| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 gb|AEC08587.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=421

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = -2

Query  693  TAVFARRGYNIQS-LAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTH  517
            T VFARRGYNIQ+ LAVGHAE +G+SRITTV+P TDES+SKLVQQL+KLVD+HEV DLTH
Sbjct  266  TGVFARRGYNIQAYLAVGHAETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTH  325

Query  516  LPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLL  337
            LPF+ERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLL
Sbjct  326  LPFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLL  385

Query  336  EPYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            EPYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  386  EPYGICEVARTGRVALARESGVDSKYLRGYSFPL  419


 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 99/146 (68%), Gaps = 3/146 (2%)
 Frame = -2

Query  687  VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPF  508
            VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P 
Sbjct  35   VFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQ  92

Query  507  AERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPY  328
             ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L+ +
Sbjct  93   VERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLKKF  152

Query  327  GICEVARTGRVALARES-GVDSNYLR  253
             I E+ RTG++AL RE  G  + + R
Sbjct  153  QIREIVRTGKIALRREKMGATAPFWR  178



>emb|CDY19107.1| BnaA04g18470D [Brassica napus]
Length=488

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = -2

Query  693  TAVFARRGYNIQS-LAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTH  517
            T VF+RRGYNIQ+ LAVGHAE EG+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTH
Sbjct  333  TGVFSRRGYNIQAFLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTH  392

Query  516  LPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLL  337
            +PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLL
Sbjct  393  MPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLL  452

Query  336  EPYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            EPYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  453  EPYGICEVARTGRVALARESGVDSKYLRGYSFPL  486


 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  101  GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  158

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L  
Sbjct  159  QVERELMLVKVNAHPESRAQIMWLVDTFRARIVDIAEHALTIEVTGDPGKMIAVERNLRK  218

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  219  FQIREIVRTGKIALRREKMGATAPFWR  245



>ref|XP_009351614.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=479

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTVVPGT++SISKLVQQLHKL+DLHEVRD+THL
Sbjct  327  TGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTEDSISKLVQQLHKLIDLHEVRDITHL  386

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNA  RR +LDIASIFRAKAVDVSDHT+TLELTGDL+KMVALQ+LLE
Sbjct  387  PFAERELMLIKIAVNATARRDVLDIASIFRAKAVDVSDHTVTLELTGDLNKMVALQKLLE  446

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  PL
Sbjct  447  PYGICEVARTGRVALERESGVDSTYLRGYPLPL  479


 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V D++  P
Sbjct  95   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLRQVVEQLNKLVNVIKVEDISREP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD+S+ ++T+E+TGD  K+VA+QR L  
Sbjct  153  QVERELMLIKLNADPSTRAEIMWLVDIFRAKIVDISEQSLTVEVTGDPGKVVAVQRNLSK  212

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  213  FGIKELARTGKIALRREKMGATAPFWR  239



>dbj|BAD19594.1| putative acetolactate synthase small subunit [Oryza sativa Japonica 
Group]
 dbj|BAD20154.1| putative acetolactate synthase small subunit [Oryza sativa Japonica 
Group]
Length=323

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE  GLSRITTV PGTDESI KLVQQL+KLVD+HEV+D+THL
Sbjct  171  TGVFARRGYNIQSLAVGPAEKSGLSRITTVAPGTDESIEKLVQQLNKLVDVHEVQDITHL  230

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+VN A RR ILDIA IFRAK+VDVSDHT+TL+LTGDL KMVALQRLLE
Sbjct  231  PFAERELMLIKVSVNTAARRDILDIAEIFRAKSVDVSDHTVTLQLTGDLDKMVALQRLLE  290

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  291  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  323


 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  MLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEV  313
            MLIK+ V    R  ++ +  IFRAK VD+S++T+T+E+TGD  K+VA+QR L  +GI E+
Sbjct  1    MLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKIVAVQRNLSKFGIKEI  60

Query  312  ARTGRVALARE  280
             RTG++AL RE
Sbjct  61   CRTGKIALRRE  71



>ref|NP_001047389.2| Os02g0608600 [Oryza sativa Japonica Group]
 dbj|BAF09303.2| Os02g0608600, partial [Oryza sativa Japonica Group]
Length=340

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE  GLSRITTV PGTDESI KLVQQL+KLVD+HEV+D+THL
Sbjct  188  TGVFARRGYNIQSLAVGPAEKSGLSRITTVAPGTDESIEKLVQQLNKLVDVHEVQDITHL  247

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+VN A RR ILDIA IFRAK+VDVSDHT+TL+LTGDL KMVALQRLLE
Sbjct  248  PFAERELMLIKVSVNTAARRDILDIAEIFRAKSVDVSDHTVTLQLTGDLDKMVALQRLLE  307

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  308  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  340


 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  537  EVRDLTHLPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKM  358
            +V DL+  P  ERELMLIK+ V    R  ++ +  IFRAK VD+S++T+T+E+TGD  K+
Sbjct  3    QVEDLSKEPQVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKI  62

Query  357  VALQRLLEPYGICEVARTGRVALARE  280
            VA+QR L  +GI E+ RTG++AL RE
Sbjct  63   VAVQRNLSKFGIKEICRTGKIALRRE  88



>ref|XP_010414083.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=415

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = -2

Query  693  TAVFARRGYNIQS-LAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTH  517
            T VFARRGYNIQ+ LAVGHAE +G+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTH
Sbjct  260  TGVFARRGYNIQAYLAVGHAETKGISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTH  319

Query  516  LPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLL  337
            LPFAERELMLIK+AVNA  RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLL
Sbjct  320  LPFAERELMLIKIAVNATARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLL  379

Query  336  EPYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            EPYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  380  EPYGICEVARTGRVALARESGVDSKYLRGYSFPL  413


 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 99/146 (68%), Gaps = 3/146 (2%)
 Frame = -2

Query  687  VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPF  508
            VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P 
Sbjct  29   VFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQ  86

Query  507  AERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPY  328
             ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L+ +
Sbjct  87   VERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKKF  146

Query  327  GICEVARTGRVALARES-GVDSNYLR  253
             I E+ RTG++AL RE  G  + + R
Sbjct  147  QIREIVRTGKIALRREKMGATAPFWR  172



>gb|KGN66639.1| hypothetical protein Csa_1G652220 [Cucumis sativus]
Length=218

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T + +RRGYNIQSLAVGHAE EGLSRITTV+PGTDESI KLVQQLHKL+DLHEVRDLTHL
Sbjct  66   TGIISRRGYNIQSLAVGHAEREGLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDLTHL  125

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDIA IFRAKAVDVS HTITL+LTGDL+KMVALQRLLE
Sbjct  126  PFAERELMLIKIAANATARRDVLDIADIFRAKAVDVSGHTITLQLTGDLNKMVALQRLLE  185

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            P+GICEVARTGRVAL RESGVDS YLRGY  P+
Sbjct  186  PFGICEVARTGRVALERESGVDSAYLRGYPLPI  218



>gb|KGN49589.1| hypothetical protein Csa_5G013280 [Cucumis sativus]
Length=436

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T +FARRGYNIQSLAVGHAE EG+SRITTVVPGTDESI KLVQ L++L D+HEVRDLTH+
Sbjct  284  TGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYKLVQHLYRLADVHEVRDLTHI  343

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+A N + RR +LDIA IFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  344  PFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  403

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  404  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  436


 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L  +T VV GT++ + ++++QLHKLV++ +V DL+ + 
Sbjct  51   GVFARRGYNIESLAVGLNKDKAL--LTIVVSGTEKVLEQVIEQLHKLVNVLKVEDLSSVQ  108

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+      R  I  +  +FRAK VD+SD ++T+E+TGD  KMVA QR L  
Sbjct  109  QVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDDSVTIEVTGDPGKMVAFQRNLSK  168

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  169  FGIREIARTGKIALRREKLGASAPFWR  195



>ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212902 [Cucumis sativus]
Length=489

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T +FARRGYNIQSLAVGHAE EG+SRITTVVPGTDESI KLVQ L++L D+HEVRDLTH+
Sbjct  337  TGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYKLVQHLYRLADVHEVRDLTHI  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+A N + RR +LDIA IFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  397  PFSERELMLIKIAANPSARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+FPL
Sbjct  457  PYGICEVARTGRVALVRESGVDSKYLRGYSFPL  489


 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L  +T VV GT++ + ++++QLHKLV++ +V DL+ + 
Sbjct  104  GVFARRGYNIESLAVGLNKDKAL--LTIVVSGTEKVLEQVIEQLHKLVNVLKVEDLSSVQ  161

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+      R  I  +  +FRAK VD+SD ++T+E+TGD  KMVA QR L  
Sbjct  162  QVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDDSVTIEVTGDPGKMVAFQRNLSK  221

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  222  FGIREIARTGKIALRREKLGASAPFWR  248



>ref|XP_008383971.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=489

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EGLSRITTVVPGTDESISKLVQQL+KLVD+H+V+DLT+L
Sbjct  337  TGVFARRGYNIQSLAVGXAEAEGLSRITTVVPGTDESISKLVQQLYKLVDVHDVQDLTNL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDI +IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  397  PFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+FPL
Sbjct  457  PYGICEVARTGRIALVRESGVDSKYLRGYSFPL  489


 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  +  +++QL+KLV++ +V DL+  P
Sbjct  105  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVLRLVIEQLNKLVNVMKVEDLSIEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  + +    I  +  IFRAK VD+S+H++T+E+TGD  KMVALQR L  
Sbjct  163  QVERELMLIKVNADPSYHAEIKWLVXIFRAKIVDISEHSVTIEVTGDPGKMVALQRNLSK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  223  FGIREIARTGKIALRREKLGASAPFWR  249



>ref|XP_007212091.1| hypothetical protein PRUPE_ppa005063mg [Prunus persica]
 gb|EMJ13290.1| hypothetical protein PRUPE_ppa005063mg [Prunus persica]
Length=479

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTVVPGTD+SI+KLVQQLHKL+DLHEVRD+THL
Sbjct  327  TGVMSRRGYNIQSLAVGPAEKEGLSRITTVVPGTDDSITKLVQQLHKLIDLHEVRDITHL  386

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN   RR +LDIASIFRAKAVDVSDHTITLELTGD++KMVALQ+LLE
Sbjct  387  PFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHTITLELTGDINKMVALQKLLE  446

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  P+
Sbjct  447  PYGICEVARTGRVALERESGVDSTYLRGYPLPV  479


 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V D++   
Sbjct  95   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLRQVVEQLNKLVNVIKVEDISKEE  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + +    I+ +  IFRAK VD+S+H++T+E+TGD  K+VA+QR L  
Sbjct  153  HVERELMLIKLNADPSTLAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKVVAVQRNLSK  212

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  213  FGIKELARTGKIALRRE  229



>gb|KFK31180.1| hypothetical protein AALP_AA6G079200 [Arabis alpina]
Length=491

 Score =   273 bits (697),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTV+P TDES+SKLVQQL+KLVD+HEV DLTH 
Sbjct  337  TGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHF  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA AVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  397  PFAERELMLIKIAVNAAARRDVLDIASIFRAIAVDVSDHTITLQLTGDLDKMVALQRLLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS  LRGY+FPL
Sbjct  457  PYGICEVARTGRVALARESGVDSKSLRGYSFPL  489


 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L  
Sbjct  163  QVERELMLVKVNAHPESRAEIMWLLDTFRAKIVDIAEHALTIEVTGDPGKMIAVERNLRK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  223  FQIREIVRTGKIALRREKMGATAPFWR  249



>ref|XP_008225227.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Prunus mume]
Length=479

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTVVPGTD+SI+KLVQQLHKL+DLHEVRD+THL
Sbjct  327  TGVMSRRGYNIQSLAVGPAEKEGLSRITTVVPGTDDSITKLVQQLHKLIDLHEVRDITHL  386

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN   RR +LDIASIFRAKAVDVSDHTITLELTGD++KMVALQ+LLE
Sbjct  387  PFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHTITLELTGDINKMVALQKLLE  446

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  P+
Sbjct  447  PYGICEVARTGRVALERESGVDSTYLRGYPLPV  479


 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V D++   
Sbjct  95   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLRQVVEQLNKLVNVIKVEDISKEE  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + +    I+ +  IFRAK VD+S+H++T+E+TGD  K+VA+QR L  
Sbjct  153  HVERELMLIKLNADPSTLAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKVVAVQRNLSK  212

Query  330  YGICEVARTGRVALARE  280
            +GI EVARTG++AL RE
Sbjct  213  FGIKEVARTGKIALRRE  229



>ref|XP_002266924.2| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 ref|XP_010646454.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 ref|XP_010646455.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 emb|CBI23353.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RR YNIQSLAVG AE+EG S ITTVVPGTDESISKLVQQL KL+DLHEVRD+TH+
Sbjct  324  TGVISRRSYNIQSLAVGPAEMEGRSHITTVVPGTDESISKLVQQLQKLIDLHEVRDITHM  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN A RR +LDIASIFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  384  PFAERELMLIKIAVNTAARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGYA PL
Sbjct  444  PYGICEVARTGRVALVRESGVDSTYLRGYALPL  476


 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 102/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GT+  + ++V+QL+KLV++ +V+DL+  P
Sbjct  92   GVFARRGYNIESLAVGLNEDKAL--FTIVVSGTETVLRQVVEQLNKLVNVLKVKDLSREP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  150  QVERELMLIKLNADPSKRAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKMVAVQRNLSK  209

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  210  FGIKELARTGKIALRRE  226



>ref|XP_010242460.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Nelumbo nucifera]
Length=482

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EG+SRITTVVPGTDESI KLVQQL+KL+++HEV+D+THL
Sbjct  330  TGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTDESIGKLVQQLYKLINIHEVQDITHL  389

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN   RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  390  PFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  449

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+ P 
Sbjct  450  PYGICEVARTGRVALVRESGVDSTYLRGYSLPF  482


 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT+  + ++V+QL KLV++ +V D++  P
Sbjct  99   GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVVEQLLKLVNVLKVEDISKEP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+K+  + + R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  157  QVERELMLVKLNADPSNRAEIMWLVDIFRAKVVDISEHSLTIEVTGDPGKMVAVQRNLSK  216

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  217  FGIKELARTGKIALRRE  233



>ref|XP_008371723.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like, 
partial [Malus domestica]
Length=472

 Score =   271 bits (694),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE  GLSRITTVVPGT++SISKLVQQLHKL+DLHEVRD+TH 
Sbjct  320  TGVISRRGYNIQSLAVGPAEKXGLSRITTVVPGTEDSISKLVQQLHKLIDLHEVRDITHX  379

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNA  RR +LDIASIFRAKAVDVSDHT+TLELTGDL+KMVALQ+LLE
Sbjct  380  PFAERELMLIKIAVNATARRDVLDIASIFRAKAVDVSDHTVTLELTGDLNKMVALQKLLE  439

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  PL
Sbjct  440  PYGICEVARTGRVALERESGVDSTYLRGYPLPL  472


 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT + + ++V+QL+KLV++ +V D++  P
Sbjct  88   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTGKVLRQVVEQLNKLVNVIKVEDISREP  145

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD+S+ ++T+E+TGD  K+VA+QR L  
Sbjct  146  QVERELMLIKLNADPSTRAEIMWLVDIFRAKIVDISEQSLTVEVTGDPGKVVAVQRNLSK  205

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  206  FGIKELARTGKIALRREKMGATAPFWR  232



>gb|KFK31179.1| hypothetical protein AALP_AA6G079200 [Arabis alpina]
Length=521

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTV+P TDES+SKLVQQL+KLVD+HEV DLTH 
Sbjct  367  TGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHF  426

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA AVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  427  PFAERELMLIKIAVNAAARRDVLDIASIFRAIAVDVSDHTITLQLTGDLDKMVALQRLLE  486

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS  LRGY+FPL
Sbjct  487  PYGICEVARTGRVALARESGVDSKSLRGYSFPL  519


 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  135  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  192

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L  
Sbjct  193  QVERELMLVKVNAHPESRAEIMWLLDTFRAKIVDIAEHALTIEVTGDPGKMIAVERNLRK  252

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  253  FQIREIVRTGKIALRREKMGATAPFWR  279



>ref|XP_009352938.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=477

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE+EGLSRITTVVPGTD+SISKLVQQLHKL+DLHEVRD++HL
Sbjct  325  TGVLSRRGYNIQSLAVGPAEMEGLSRITTVVPGTDDSISKLVQQLHKLIDLHEVRDISHL  384

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN   RR +LDIASIFRAKAVDVSDHTITLELTGDL+KMVALQ+LLE
Sbjct  385  PFAERELMLIKIAVNTTARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQKLLE  444

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS +LRGY   L
Sbjct  445  PYGICEVARTGRVALQRESGVDSTFLRGYPLQL  477


 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++  V D++   
Sbjct  93   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLRQVVEQLNKLVNVINVEDISREQ  150

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD+S+ ++T+E+TGD  K+VA+QR L  
Sbjct  151  QVERELMLIKLDADPSTRAEIMWLVDIFRAKIVDISEQSLTVEVTGDPGKVVAVQRNLSK  210

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  211  FGIKELARTGKIALRREKMGATAPFWR  237



>ref|XP_008349232.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Malus domestica]
Length=412

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE+EGLSRITTVVPGTD+SISKLVQQLHKL+DLHEVRD++HL
Sbjct  260  TGVLSRRGYNIQSLAVGPAEMEGLSRITTVVPGTDDSISKLVQQLHKLIDLHEVRDISHL  319

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+      RR +LDIASIFRAKAVDVSDHTITLELTGDL+KMVALQ+LLE
Sbjct  320  PFAERELMLIKIXXXXTARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQKLLE  379

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  PL
Sbjct  380  PYGICEVARTGRVALQRESGVDSTYLRGYPLPL  412


 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V D++  P
Sbjct  28   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLRQVVEQLNKLVNVIKVEDISREP  85

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD+S+ ++T+E+TGD  K+VA+QR L  
Sbjct  86   QVERELMLIKLNADPSTRAEIMWLVDIFRAKIVDISEQSLTVEITGDPGKVVAVQRNLSK  145

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  146  FGIKELARTGKIALRREKMGATAPFWR  172



>ref|XP_009625351.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=454

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDES+SKLVQQL+KLVD+HEVRD+TH 
Sbjct  302  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDITHH  361

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NAA RR +LDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  362  PFAERELMLIKIAANAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  421

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            P GICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  422  PCGICEVARTGRLALVRESGVDSKYLRGYSYPL  454


 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  99   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVMEQLQKLVNVIKVEDLSKEP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK++ +   R  ++ +  +FRAK VD+SDH++T+E+TGD  KMVA+QR L  
Sbjct  157  QVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDHSLTIEVTGDPGKMVAVQRNLSK  216

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  217  FGIREIARTGKIALRRE  233



>ref|XP_008443657.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Cucumis melo]
Length=480

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T + +RRGYNIQSLAVGHAE +GLSRITTV+PGTDESI KLVQQLHKL+DLHEVRDLTHL
Sbjct  328  TGIISRRGYNIQSLAVGHAERQGLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDLTHL  387

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NAA RR +LDIA IFRAKAVDVS HTITL+LTGDL+KMVALQRLLE
Sbjct  388  PFAERELMLIKIAANAAARRDVLDIADIFRAKAVDVSGHTITLQLTGDLNKMVALQRLLE  447

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            P+GICEVARTGRVAL RESGVDS YLRGY  P+
Sbjct  448  PFGICEVARTGRVALERESGVDSAYLRGYPLPI  480


 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++V+QL+KLV++ +V D++  P
Sbjct  97   GVFARRGYNIESLAVGLNKDKAL--FTIVVTGTENVLRQVVEQLNKLVNVIKVEDISRQP  154

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              EREL+L+K+  +++ R  I+ +  IFR K VD+S+H++T+E+TGD  K+VA++R    
Sbjct  155  QVERELVLMKLNADSSTRAEIMWLVDIFRGKIVDISEHSVTIEVTGDPGKLVAVERNFSK  214

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  215  FGIRELARTGKIALRRE  231



>ref|XP_004288733.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=510

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AEVEG SRITTVVP TDESISKLVQQL+KLVD+H+VRDLT+L
Sbjct  358  TGVFARRGYNIQSLAVGRAEVEGQSRITTVVPATDESISKLVQQLYKLVDVHDVRDLTNL  417

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDI +IFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  418  PFAERELMLIKIAANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  477

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS YLRGY+ PL
Sbjct  478  PYGICEVARTGRIALVRESGVDSRYLRGYSLPL  510


 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 3/148 (2%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + VFARRGYNI+SLAVG  + + L   T VV GTD  + ++++QLHKLV++ +V DL+  
Sbjct  125  SGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDTVLRQVIEQLHKLVNVLKVEDLSSE  182

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            P  ERELMLIKV  +      I  I +IFRAK VD+SDH++T+E+TGD  KMVALQR L 
Sbjct  183  PQVERELMLIKVTAHPDYLAEIRWIVNIFRAKIVDISDHSVTIEVTGDPGKMVALQRNLS  242

Query  333  PYGICEVARTGRVALARES-GVDSNYLR  253
             +GI E+ARTG++AL RE  G  + + R
Sbjct  243  KFGIREIARTGKIALRREKLGASAPFWR  270



>ref|XP_004139096.1| PREDICTED: uncharacterized protein LOC101208212 [Cucumis sativus]
Length=480

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T + +RRGYNIQSLAVGHAE EGLSRITTV+PGTDESI KLVQQLHKL+DLHEVRDLTHL
Sbjct  328  TGIISRRGYNIQSLAVGHAEREGLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDLTHL  387

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDIA IFRAKAVDVS HTITL+LTGDL+KMVALQRLLE
Sbjct  388  PFAERELMLIKIAANATARRDVLDIADIFRAKAVDVSGHTITLQLTGDLNKMVALQRLLE  447

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            P+GICEVARTGRVAL RESGVDS YLRGY  P+
Sbjct  448  PFGICEVARTGRVALERESGVDSAYLRGYPLPI  480


 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++V+QL+KLV++ +V D++  P
Sbjct  97   GVFARRGYNIESLAVGLNKDKAL--FTIVVTGTENVLRQVVEQLNKLVNVIKVEDISRQP  154

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              EREL+L+K+  +++ R  I+ +  IFR K VD+S+H++T+E+TGD  K+VA++R    
Sbjct  155  QVERELVLMKLNADSSTRAEIMWLVDIFRGKIVDISEHSVTIEVTGDPGKLVAVERNFSK  214

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  215  FGIRELARTGKIALRRE  231



>ref|XP_008367825.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=492

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEG SRITTVVPGTDESISKLVQQL+KLVD+H V+DLT+L
Sbjct  340  TGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISKLVQQLYKLVDIHNVQDLTNL  399

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A +A  RR +LDI  IFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  400  PFAERELMLIKIAXDAVARRDVLDIGKIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  459

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGY+ PL
Sbjct  460  PYGICEVARTGRIALVRESGVDSKHLRGYSLPL  492


 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL+KLV++ +V D+++ P
Sbjct  108  GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLRQVIEQLNKLVNVIKVEDISNEP  165

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              EREL+LIKV  +      I  + SIFRAK VD+S+H++T+E+TGD  KMVALQR L  
Sbjct  166  QVERELVLIKVNSDPRYHAEIKWLVSIFRAKIVDISEHSVTIEVTGDPGKMVALQRNLSK  225

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI EVARTG++AL RE  G  + + R
Sbjct  226  FGIREVARTGKIALRREKLGASAPFWR  252



>ref|XP_008394266.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Malus domestica]
Length=492

 Score =   270 bits (690),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEG SRITTVVPGTDESISKLVQQL+KLVD+H V+DLT+L
Sbjct  340  TGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISKLVQQLYKLVDIHNVQDLTNL  399

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A +A  RR +LDI  IFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  400  PFAERELMLIKIAXDAVARRDVLDIGKIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  459

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGY+ PL
Sbjct  460  PYGICEVARTGRIALVRESGVDSKHLRGYSLPL  492


 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL+KLV++ +V D+++ P
Sbjct  108  GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLRQVIEQLNKLVNVXKVEDISNEP  165

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              EREL+LIKV  +      I  + SIFRAK VD+S+H++T+E+TGD  KMVALQ  L  
Sbjct  166  QVERELVLIKVNSDPRYHAEIKWLVSIFRAKIVDISEHSVTIEVTGDPGKMVALQXNLSK  225

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI EVARTG++AL RE  G  + + R
Sbjct  226  FGIREVARTGKIALRREKLGASAPFWR  252



>ref|XP_009625350.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=483

 Score =   270 bits (689),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDES+SKLVQQL+KLVD+HEVRD+TH 
Sbjct  331  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDITHH  390

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NAA RR +LDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE
Sbjct  391  PFAERELMLIKIAANAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  450

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            P GICEVARTGR+AL RESGVDS YLRGY++PL
Sbjct  451  PCGICEVARTGRLALVRESGVDSKYLRGYSYPL  483


 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  99   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVMEQLQKLVNVIKVEDLSKEP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK++ +   R  ++ +  +FRAK VD+SDH++T+E+TGD  KMVA+QR L  
Sbjct  157  QVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDHSLTIEVTGDPGKMVAVQRNLSK  216

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  217  FGIREIARTGKIALRRE  233



>ref|XP_006664907.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Oryza brachyantha]
Length=412

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE  GLSRITTV+PGTDESI KLVQQL+KLVD+HEV+D+TH 
Sbjct  260  TGVFARRGYNIQSLAVGPAEKAGLSRITTVIPGTDESIEKLVQQLYKLVDVHEVQDITHW  319

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+VN A RR ILDIA IFRAK VDVSDHT+TL+LTGDL KMVALQRLLE
Sbjct  320  PFAERELMLIKVSVNTAARRDILDIAEIFRAKPVDVSDHTVTLQLTGDLDKMVALQRLLE  379

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  380  PYGICEVARTGRVALVRESGVDSKYLRGYSLPL  412


 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + +   T VV GTD  ++++++QL+KLV++  V DL+  P
Sbjct  26   GVFARRGYNIESLAVGLNKDKAM--FTIVVSGTDRVLNQVIEQLNKLVNVLNVEDLSKEP  83

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+S++T+T+E+TGD  K+VA+QR L  
Sbjct  84   QVERELMLIKLNVEPYQRPEVMVLVDIFRAKVVDISENTLTVEVTGDPGKIVAVQRNLSK  143

Query  330  YGICEVARTGRVALARE  280
            +GI E+ RTG++AL RE
Sbjct  144  FGIKEICRTGKIALRRE  160



>ref|XP_002311270.2| hypothetical protein POPTR_0008s07820g [Populus trichocarpa]
 gb|EEE88637.2| hypothetical protein POPTR_0008s07820g [Populus trichocarpa]
Length=490

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTV+PGTDESI KLVQQLHKL+DLHEVRD+TH 
Sbjct  338  TGVISRRGYNIQSLAVGPAEEEGLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDITHS  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A N+A RR +LDIA IFRAKAVDVSDHTITLELTGD +KMVALQR+LE
Sbjct  398  PFAERELMLIKIAANSAARRDVLDIARIFRAKAVDVSDHTITLELTGDFNKMVALQRILE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRG+  PL
Sbjct  458  PYGICEVARTGRVALVRESGVDSTYLRGFPLPL  490


 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++V+QL+KLV++ +V D++  P
Sbjct  98   GVFARRGYNIESLAVGLNKDKAL--FTIVVCGTENVLRQVVEQLNKLVNVIKVDDISREP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK   + + R  ++ +  IFRAK VD+S++++T+E+TGD  KM A+QR L  
Sbjct  156  QVERELMLIKFNADPSTRAEVMWLVDIFRAKIVDISENSLTIEVTGDPGKMAAIQRNLSK  215

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  216  FGIKELARTGKIALRRE  232



>emb|CAX48742.1| acetohydroxyacid synthase regulatory subunit 1 precursor [Eupatorium 
cannabinum]
Length=475

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF RRGYNIQSLAVGHAEVEG SRITTVVPGTDESI KLVQQL+KL+D+HEV DLT +
Sbjct  323  TGVFTRRGYNIQSLAVGHAEVEGRSRITTVVPGTDESIRKLVQQLYKLIDVHEVIDLTLM  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN+  RR +LDIASIFRAKAVDVSDHTITLE+TGD++KMVALQRLLE
Sbjct  383  PFAERELMLIKVAVNSMARRNVLDIASIFRAKAVDVSDHTITLEVTGDVNKMVALQRLLE  442

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            P GICEVARTGRVAL RESGVDS+YLRGY++P+
Sbjct  443  PCGICEVARTGRVALTRESGVDSSYLRGYSYPV  475


 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  92   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLEQVMKQLLKLVNVLKVEDISKEP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  +  +  IFRAK VD+SDH+IT+E+TGD  KMVA+QR L  
Sbjct  150  QVERELMLIKINADPRYRLEVKWLVDIFRAKIVDISDHSITIEVTGDPGKMVAVQRNLSK  209

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI EVARTG++AL RE  G D+ + R
Sbjct  210  FGIQEVARTGKIALRRERMGEDAPFWR  236



>ref|XP_011010159.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Populus euphratica]
Length=490

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTV+PGTD+SI KLVQQLHKL+DLHEVRD+TH 
Sbjct  338  TGVISRRGYNIQSLAVGPAEEEGLSRITTVIPGTDDSIGKLVQQLHKLIDLHEVRDITHS  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A N+A RR +LDIA IFRAKAVDVSDHTITLELTGD +KMVALQR+LE
Sbjct  398  PFAERELMLIKIAANSAARRDVLDIARIFRAKAVDVSDHTITLELTGDFNKMVALQRILE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRG+  PL
Sbjct  458  PYGICEVARTGRVALVRESGVDSTYLRGFPLPL  490


 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V D++  P
Sbjct  98   GVFARRGYNIESLAVGLNKDKAL--FTIVVCGTEKVLRQVVEQLNKLVNVIKVDDISREP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK   +++ R  ++ +  IFRAK VD+S++++T+E+TGD  KM A+QR L  
Sbjct  156  QVERELMLIKFNADSSTRAEVMWLVDIFRAKIVDISENSLTIEVTGDPGKMAAIQRNLSK  215

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  216  FGIKELARTGKIALRRE  232



>ref|XP_008800993.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=488

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG  E EG+SRITTVVPGTDESI KLVQQL+KLVD+HEV+D+THL
Sbjct  336  TGVFSRRGYNIQSLAVGPEEKEGISRITTVVPGTDESIGKLVQQLYKLVDVHEVQDITHL  395

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN A RR ILDIA IFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  396  PFAERELMLIKVAVNTAARRDILDIADIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  455

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS +LRGY+ P+
Sbjct  456  PYGICEVARTGRVALVRESGVDSKHLRGYSLPV  488


 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 106/147 (72%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++V+QLHKLV++ +V DL+  P
Sbjct  106  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLRQVVEQLHKLVNVLKVEDLSKEP  163

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R+ ++ +  IFRAK VD+S+H++T+E+TGD  K+VA++R L  
Sbjct  164  QVERELMLIKLNVGPERRQEVMGLVDIFRAKIVDISEHSLTIEVTGDPGKVVAVRRNLNK  223

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G ++ + R
Sbjct  224  FGIKEIARTGKIALRREKMGENAPFWR  250



>ref|XP_011014712.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=467

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVGHAE EGLSRITTV+PGTDESI KLVQQLHKL+D HEVRD+TH 
Sbjct  315  TGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGKLVQQLHKLIDFHEVRDITHS  374

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAEREL LIK+A N+A RR +LDIA IFRAKAVDVSDHTITLELTGD +KMVALQR+LE
Sbjct  375  PFAERELTLIKIAANSAARRDVLDIARIFRAKAVDVSDHTITLELTGDFNKMVALQRILE  434

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS +LRG+  PL
Sbjct  435  PYGICEVARTGRVALERESGVDSTHLRGFPLPL  467


 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 25/138 (18%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGY+I+SLAVG  + + L   T VV GT+E + ++V+QL+KLV + +V D++  P
Sbjct  98   GVFARRGYSIESLAVGLNKDKAL--FTIVVCGTEEVLRQVVEQLNKLVTVIKVEDISRDP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  N + R                        E+TGD  KM A+QR L  
Sbjct  156  QVERELMLIKLNANPSTR-----------------------AEVTGDPGKMAAVQRNLSK  192

Query  330  YGICEVARTGRVALARES  277
            +GI E+ARTG++AL RE+
Sbjct  193  FGIKELARTGKIALRRET  210



>ref|XP_008800984.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=502

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG  E EG+SRITTVVPGTDESI KLVQQL+KLVD+HEV+D+THL
Sbjct  350  TGVFSRRGYNIQSLAVGPEEKEGISRITTVVPGTDESIGKLVQQLYKLVDVHEVQDITHL  409

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN A RR ILDIA IFRAKAVDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  410  PFAERELMLIKVAVNTAARRDILDIADIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLE  469

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS +LRGY+ P+
Sbjct  470  PYGICEVARTGRVALVRESGVDSKHLRGYSLPV  502


 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 106/161 (66%), Gaps = 17/161 (11%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++V+QLHKLV++ +V DL+  P
Sbjct  106  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLRQVVEQLHKLVNVLKVEDLSKEP  163

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLE--------------LTG  373
              ERELMLIK+ V    R+ ++ +  IFRAK VD+S+H++T+E              +TG
Sbjct  164  QVERELMLIKLNVGPERRQEVMGLVDIFRAKIVDISEHSLTIEVTPVEPSLIDNRMQVTG  223

Query  372  DLHKMVALQRLLEPYGICEVARTGRVALARES-GVDSNYLR  253
            D  K+VA++R L  +GI E+ARTG++AL RE  G ++ + R
Sbjct  224  DPGKVVAVRRNLNKFGIKEIARTGKIALRREKMGENAPFWR  264



>gb|EEC73569.1| hypothetical protein OsI_08011 [Oryza sativa Indica Group]
Length=554

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE  GLSRITTV PGTDESI KLVQQL+KLVD+HEV+D+THL
Sbjct  402  TGVFARRGYNIQSLAVGPAEKSGLSRITTVAPGTDESIEKLVQQLYKLVDVHEVQDITHL  461

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+VN A RR ILDIA IFRAK+VDVSDHT+TL+LTGDL KMVALQRLLE
Sbjct  462  PFAERELMLIKVSVNTAARRDILDIAEIFRAKSVDVSDHTVTLQLTGDLDKMVALQRLLE  521

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+F L
Sbjct  522  PYGICEVARTGRVALVRESGVDSKYLRGYSFSL  554


 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + +   T VV GTD  ++++++QL+KLV++  V DL+  P
Sbjct  7    GVFARRGYNIESLAVGLNKDKAM--FTIVVSGTDRVLNQVIEQLNKLVNVLNVEDLSKEP  64

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+S++T+T+E+TGD  K+VA+QR L  
Sbjct  65   QVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKIVAVQRNLSK  124

Query  330  YGICEVARTGRVALARE  280
            +GI E+ RTG++AL RE
Sbjct  125  FGIKEICRTGKIALRRE  141


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -2

Query  606  VVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKVAVNAAVRRTILDIASIF  427
            V P    S+++++     ++D  +V DL+  P  ERELMLIK+ V    R  ++ +  IF
Sbjct  194  VEPYEGSSMNQVLDAHWGVLDDEDVEDLSKEPQVERELMLIKINVEPDQRPEVMVLVDIF  253

Query  426  RAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRVALARE  280
            RAK VD+S++T+T+E+TGD  K+VA+QR L  +GI E+ RTG++AL RE
Sbjct  254  RAKVVDISENTLTIEVTGDPGKIVAVQRNLSKFGIKEICRTGKIALRRE  302



>ref|XP_011014695.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Populus euphratica]
 ref|XP_011014703.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=490

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVGHAE EGLSRITTV+PGTDESI KLVQQLHKL+D HEVRD+TH 
Sbjct  338  TGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGKLVQQLHKLIDFHEVRDITHS  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAEREL LIK+A N+A RR +LDIA IFRAKAVDVSDHTITLELTGD +KMVALQR+LE
Sbjct  398  PFAERELTLIKIAANSAARRDVLDIARIFRAKAVDVSDHTITLELTGDFNKMVALQRILE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS +LRG+  PL
Sbjct  458  PYGICEVARTGRVALERESGVDSTHLRGFPLPL  490


 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGY+I+SLAVG  + + L   T VV GT+E + ++V+QL+KLV + +V D++  P
Sbjct  98   GVFARRGYSIESLAVGLNKDKAL--FTIVVCGTEEVLRQVVEQLNKLVTVIKVEDISRDP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  N + R  I+ +  IFRA  VD+S+H++T+E+TGD  KM A+QR L  
Sbjct  156  QVERELMLIKLNANPSTRAEIMWLVDIFRATIVDISEHSLTIEVTGDPGKMAAVQRNLSK  215

Query  330  YGICEVARTGRVALARES  277
            +GI E+ARTG++AL RE+
Sbjct  216  FGIKELARTGKIALRRET  233



>ref|XP_009406425.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=487

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EG+SRITTVVPGTD SI KLVQQL+KL+D+HEV+D+THL
Sbjct  335  TGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTDGSIGKLVQQLYKLIDVHEVQDITHL  394

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN   RR ILDIA IFRAKAVDVSDHT+TL+LTGDL KMVALQRLLE
Sbjct  395  PFAERELMLIKVAVNTTARRDILDIADIFRAKAVDVSDHTVTLQLTGDLDKMVALQRLLE  454

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+ P 
Sbjct  455  PYGICEVARTGRVALVRESGVDSKYLRGYSLPF  487


 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 102/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++++QL+KLV++ +V DL+  P
Sbjct  102  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTNKVLQQVMEQLNKLVNVLKVEDLSREP  159

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V+   R  ++ +  +FRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  160  QVERELMLIKLNVDPDKRPEVMGLVDVFRAKVVDISEHSLTIEVTGDPGKMVAVQRNLSK  219

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  220  FGINEIARTGKIALRRE  236



>ref|XP_009404280.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG+SRITTVVPGTDE+I KLVQQ++KL+D+HEV D+THL
Sbjct  308  TGVFSRRGYNIQSLAVGPAEKEGISRITTVVPGTDETIEKLVQQIYKLIDVHEVHDITHL  367

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN A RR ILDIA IFRAKAVDVS HTI LELTGDL+KMVALQRLLE
Sbjct  368  PFAERELMLIKVAVNTAARRDILDIAEIFRAKAVDVSGHTIALELTGDLNKMVALQRLLE  427

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGV+SNYLRGYA P+
Sbjct  428  PYGICEVARTGRIALIRESGVNSNYLRGYALPI  460


 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 83/137 (61%), Gaps = 30/137 (22%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T  V GT++ + ++V+QL+KLV++ +V       
Sbjct  105  GVFARRGYNIESLAVGLNTDKAL--FTISVSGTEKVLQQVVEQLYKLVNVLKV-------  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
                                 L +  IFRAK VD+S+++IT+E+TGD  K+VA+QR L  
Sbjct  156  ---------------------LGLVDIFRAKVVDISENSITIEVTGDPGKIVAVQRSLSK  194

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  195  FGIKEIARTGKIALRRE  211



>ref|XP_006468633.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Citrus sinensis]
Length=484

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTVVPGTDESI KLVQ LHKL+DLHEV+D+THL
Sbjct  332  TGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGKLVQLLHKLIDLHEVQDITHL  391

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAEREL+LIK+AVN A RR +LDIA IFRA+AVDVSDHTITLELTGDL+K++ALQRLLE
Sbjct  392  PFAERELILIKIAVNTAARRDVLDIAKIFRARAVDVSDHTITLELTGDLNKIIALQRLLE  451

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  PL
Sbjct  452  PYGICEVARTGRVALVRESGVDSTYLRGYPLPL  484


 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 103/149 (69%), Gaps = 2/149 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++V+QL+KLV++ +V D+++ P
Sbjct  98   GVFARRGYNIESLAVGLNVDKAL--FTIVVSGTERVLRQVVEQLNKLVNVIKVEDISNEP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + +    I+ +  IFRAK VD+S+H +T+E+TGD  KMVA+QR L  
Sbjct  156  HVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHALTIEVTGDPGKMVAVQRNLSK  215

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +GI E+ARTG++AL RE   D+     ++
Sbjct  216  FGIKELARTGKIALRREKLGDTAPFWNFS  244



>ref|XP_010109954.1| hypothetical protein L484_011796 [Morus notabilis]
 gb|EXC24930.1| hypothetical protein L484_011796 [Morus notabilis]
Length=512

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 141/165 (85%), Gaps = 12/165 (7%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQ------------QLHKL  550
            T V +RRGYNIQSL VGHAEVEGLSRITTV+PGTDESI KLVQ            QL  L
Sbjct  346  TGVISRRGYNIQSLTVGHAEVEGLSRITTVIPGTDESIGKLVQEVLNFLKAAQVQQLPGL  405

Query  549  VDLHEVRDLTHLPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGD  370
            +DLHEVRD+THLPFAERELMLIK+AVN A RR +LDIA+IFRAKAVDVSDHTITLELTGD
Sbjct  406  IDLHEVRDITHLPFAERELMLIKIAVNTAARRDVLDIATIFRAKAVDVSDHTITLELTGD  465

Query  369  LHKMVALQRLLEPYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            L+KMVALQ+LLEPYGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  466  LNKMVALQKLLEPYGICEVARTGRVALVRESGVDSTYLRGYSLPL  510


 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V D++  P
Sbjct  115  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLRQVVEQLNKLVNVIKVEDISREP  172

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I+ +  IFR + VD+S+ T+T+E+TGD  KMVA+ R L  
Sbjct  173  QVERELMLIKLNADPNTRAEIMWLVDIFRGRIVDISESTLTIEVTGDPGKMVAVLRNLMK  232

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  233  FGIKEIARTGKIALRRE  249



>ref|XP_009404279.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=488

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG+SRITTVVPGTDE+I KLVQQ++KL+D+HEV D+THL
Sbjct  336  TGVFSRRGYNIQSLAVGPAEKEGISRITTVVPGTDETIEKLVQQIYKLIDVHEVHDITHL  395

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN A RR ILDIA IFRAKAVDVS HTI LELTGDL+KMVALQRLLE
Sbjct  396  PFAERELMLIKVAVNTAARRDILDIAEIFRAKAVDVSGHTIALELTGDLNKMVALQRLLE  455

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGV+SNYLRGYA P+
Sbjct  456  PYGICEVARTGRIALIRESGVNSNYLRGYALPI  488


 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T  V GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  105  GVFARRGYNIESLAVGLNTDKAL--FTISVSGTEKVLQQVVEQLYKLVNVLKVEDLSREP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK++V+   R  +L +  IFRAK VD+S+++IT+E+TGD  K+VA+QR L  
Sbjct  163  QVERELMLIKLSVDHHRRPEVLGLVDIFRAKVVDISENSITIEVTGDPGKIVAVQRSLSK  222

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  223  FGIKEIARTGKIALRRE  239



>ref|XP_002316167.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa]
 gb|EEF02338.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa]
Length=414

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVGHAE EGLSRITTV+PGTDESI KLVQQLHK +D HEVRD+TH 
Sbjct  262  TGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGKLVQQLHKSIDFHEVRDITHS  321

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAEREL LIK+A N+A RR +LDIA IFRAKAVD SDHTITLELTGDL+KMVALQR+LE
Sbjct  322  PFAERELTLIKIAANSAARRDVLDIARIFRAKAVDFSDHTITLELTGDLNKMVALQRILE  381

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS++LRG+  PL
Sbjct  382  PYGICEVARTGRVALVRESGVDSSHLRGFPLPL  414


 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 107/149 (72%), Gaps = 2/149 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGY+I+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V D++  P
Sbjct  22   GVFARRGYSIESLAVGLNKDKAL--FTIVVCGTEKVLRQVVEQLNKLVNVIKVEDISRDP  79

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  N + R  I+ +  IFRAK VD+S+H++T+E+TGD  KM A+QR L  
Sbjct  80   QVERELMLIKLNANPSTRAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKMAAVQRNLSK  139

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +GI E+ARTG++AL RE+  ++    G++
Sbjct  140  FGIKELARTGKIALKRETMGETAPFWGFS  168



>ref|XP_006448525.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
 gb|ESR61765.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
Length=484

 Score =   264 bits (675),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTVVPGTDESI KLVQ LHKL+DLHEV+D+THL
Sbjct  332  TGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGKLVQLLHKLIDLHEVQDITHL  391

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAEREL+LIK+AVN A RR +LD A IFRA+AVDVSDHTITLELTGDL+K++ALQRLLE
Sbjct  392  PFAERELILIKIAVNTAARRDVLDTAKIFRARAVDVSDHTITLELTGDLNKIIALQRLLE  451

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  PL
Sbjct  452  PYGICEVARTGRVALVRESGVDSTYLRGYPLPL  484


 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 103/149 (69%), Gaps = 2/149 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++V+QL+KLV++ +V D+++ P
Sbjct  98   GVFARRGYNIESLAVGLNVDKAL--FTIVVSGTERVLRQVVEQLNKLVNVIKVEDISNEP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + +    I+ +  IFRAK VD+S+H +T+E+TGD  KMVA+QR L  
Sbjct  156  HVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHALTIEVTGDPGKMVAVQRNLSK  215

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +GI E+ARTG++AL RE   D+     ++
Sbjct  216  FGIKELARTGKIALRREKLGDTAPFWNFS  244



>gb|EYU39756.1| hypothetical protein MIMGU_mgv1a005187mg [Erythranthe guttata]
Length=494

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EG+SRITTVVPGTDESI KLVQQ +KLVD+HEV+D+THL
Sbjct  342  TGVISRRGYNIQSLAVGPAESEGISRITTVVPGTDESIGKLVQQFYKLVDIHEVQDMTHL  401

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA+ RR +LDIA+IFRAK VDVSDHT+TLE+TGD +KM+ALQ LLE
Sbjct  402  PFAERELMLIKIAANASARRDVLDIANIFRAKPVDVSDHTVTLEVTGDFNKMLALQNLLE  461

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVALARESGVDS YLRGY+ PL
Sbjct  462  PYGICEVARTGRVALARESGVDSRYLRGYSIPL  494


 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+   
Sbjct  106  GVFARRGYNIESLAVGLNQDKAL--FTIVVSGTEKVLQQVVEQLNKLVNVLKVEDLSKEA  163

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  ++  +  I+ +  IFRA  VD+S+HT+T+E+TGD  KM A+ R L+ 
Sbjct  164  QVERELMLIKLNADSNTKGEIMWLVDIFRASVVDISEHTLTIEVTGDPGKMAAVLRNLKK  223

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  224  FGIKELARTGKIALRRE  240



>ref|XP_002514772.1| acetolactate synthase, putative [Ricinus communis]
 gb|EEF47326.1| acetolactate synthase, putative [Ricinus communis]
Length=531

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTV+PGT+ESI KLV QLHKL+D+HEVRD+TH+
Sbjct  379  TGVISRRGYNIQSLAVGSAEREGLSRITTVIPGTNESIGKLVLQLHKLIDMHEVRDITHV  438

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVN A RR +LDIASIFRAKAVDVSDHTITLELTGDL+KM ALQ +LE
Sbjct  439  PFAERELMLIKIAVNTAARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMAALQTVLE  498

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  PL
Sbjct  499  PYGICEVARTGRVALVRESGVDSTYLRGYPLPL  531


 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRG+NI+SLAV   E + L   T VV GTD  + ++V+QL+KLV + +V D++  P
Sbjct  144  GVFARRGFNIESLAVCLNEDKAL--FTIVVRGTDNVLRQVVEQLNKLVSVIKVEDISREP  201

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I+ +  IFRAK VD+S+HT+T+E+TGD  KM A+ R L  
Sbjct  202  QVERELMLIKLNADPMTRHEIMWLVDIFRAKVVDISEHTLTIEVTGDPGKMAAVLRNLSK  261

Query  330  YGICEVARTGRVALARE  280
            + I E++RTG++AL RE
Sbjct  262  FRIKELSRTGKIALRRE  278



>ref|NP_001168069.1| uncharacterized protein LOC100381801 [Zea mays]
 gb|ACN26993.1| unknown [Zea mays]
Length=353

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EG+SRITTVVPGT ESI KLVQQL+KL+D+HEV D+TH 
Sbjct  201  TGVFARRGYNIQSLAVGSAEKEGISRITTVVPGTVESIGKLVQQLYKLIDVHEVHDITHS  260

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+VN A RR ILDIA IFRAK +DVSDHT+TL+LTGDL KMVALQRLLE
Sbjct  261  PFAERELMLIKVSVNTAARREILDIAEIFRAKPIDVSDHTVTLQLTGDLDKMVALQRLLE  320

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RES VDS YLRGY+ PL
Sbjct  321  PYGICEVARTGRVALVRESKVDSKYLRGYSLPL  353


 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = -2

Query  582  ISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVS  403
            ++++++QL+KLV++H V DL+  P  ERELMLIK+ V    R  ++ +  IFRAK VD+S
Sbjct  3    LNQVIEQLNKLVNVHSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDIS  62

Query  402  DHTITLELTGDLHKMVALQRLLEPYGICEVARTGRVALARES-GVDSNYLR  253
            + T+T+E+ GD  K+ A+QR L  +GI E+ RTG++AL RE  G  + + R
Sbjct  63   EKTLTIEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRREKIGATARFWR  113



>emb|CDY42070.1| BnaA05g11160D [Brassica napus]
Length=469

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  657  SLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKV  478
            SLAVGHAE EG+SRITTVVP TDES+SKLVQQL+KLVD+HEVRDLTHLPFAERELMLIK+
Sbjct  327  SLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKI  386

Query  477  AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGR  298
            AVNAA RR +LDIAS+FRAK VDVSDHTITL+LTGDL KMVALQRLLEPYGICEVARTGR
Sbjct  387  AVNAAARRDVLDIASVFRAKTVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGR  446

Query  297  VALARESGVDSNYLRGYAFPL  235
            VALARESGVDSNYLRGY+FPL
Sbjct  447  VALARESGVDSNYLRGYSFPL  467


 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNIQSLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  96   GVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  153

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ + + FRA+ VD+S+H +T+E+TGD  KM+A++R L  
Sbjct  154  QVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHALTIEVTGDPGKMIAVERNLRK  213

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  214  FQIREIVRTGKIALRREKMGATAPFWR  240



>gb|KJB78879.1| hypothetical protein B456_013G024000 [Gossypium raimondii]
Length=249

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE +GLSRITTV+PGTDE+++KL QQL KLVDL+EV+D+TH 
Sbjct  97   TGVISRRGYNIQSLAVGPAEKDGLSRITTVIPGTDETLAKLFQQLRKLVDLYEVQDMTHS  156

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAV+ A RR ILDIA+IFRAKAVDV DHTITLELTGDL+KMVALQ+LLE
Sbjct  157  PFAERELMLIKVAVSPAARRDILDIANIFRAKAVDVCDHTITLELTGDLNKMVALQKLLE  216

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  P 
Sbjct  217  PYGICEVARTGRVALVRESGVDSTYLRGYPLPF  249



>ref|XP_004250085.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Solanum lycopersicum]
Length=490

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + V +RRGYN+QSLAVG AE EGLSRITTVVPGTDE+I KLV+Q +KL+D+HEVRD+THL
Sbjct  338  SGVISRRGYNVQSLAVGPAETEGLSRITTVVPGTDETIGKLVKQFNKLIDVHEVRDITHL  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA NAA RR +LDIASIFRAK VDVSDHT+TLELTGD +K++ALQRLLE
Sbjct  398  PFAERELMLIKVASNAAARRDVLDIASIFRAKPVDVSDHTVTLELTGDFNKLLALQRLLE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFP  238
            PYGICEVARTGRVAL RESGVDS YLRGYA P
Sbjct  458  PYGICEVARTGRVALIRESGVDSTYLRGYALP  489


 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  108  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLQQVVEQLNKLVNVWKVEDLSREP  165

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +A  +  I+ +  IFR K VD+SDH +T+E+TGD  KM A+ R L  
Sbjct  166  QVERELMLIKLNADATTKAEIMWLVDIFRGKIVDISDHFLTIEVTGDPGKMAAVLRNLSK  225

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G D+ + R
Sbjct  226  FGISELARTGKIALRREKMGEDAPFWR  252



>emb|CDY34514.1| BnaC04g12850D [Brassica napus]
Length=468

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  657  SLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKV  478
            SLAVGHAE EG+SRITTVVP TDES+SKLVQQL+KLVD+HEVRDLTHLPFAERELMLIK+
Sbjct  326  SLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKI  385

Query  477  AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGR  298
            AVNAA RR +LDIAS+FRAK VDVSDHTITL+LTGDL KMVALQRLLEPYGICEVARTGR
Sbjct  386  AVNAAARRDVLDIASVFRAKTVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGR  445

Query  297  VALARESGVDSNYLRGYAFPL  235
            VALARESGVDSNYLRGY+FPL
Sbjct  446  VALARESGVDSNYLRGYSFPL  466


 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNIQSLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  95   GVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ + + FRA+ VD+S+H +T+E+TGD  KM+A++R L  
Sbjct  153  QVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHALTIEVTGDPGKMIAVERNLRK  212

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  213  FQIREIVRTGKIALRREKMGATAPFWR  239



>ref|XP_006353245.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Solanum tuberosum]
Length=490

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + V +RRGYN+QSLAVG AE EGLSRITTVVPGTDE+I KLV+Q +KL+D+HEV+D+THL
Sbjct  338  SGVISRRGYNVQSLAVGPAETEGLSRITTVVPGTDETIGKLVKQFNKLIDVHEVQDITHL  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA NAA RR +LDIASIFRAK VDVSDHT+TLELTGD +K++ALQRLLE
Sbjct  398  PFAERELMLIKVAANAAARRDVLDIASIFRAKPVDVSDHTVTLELTGDFNKLLALQRLLE  457

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFP  238
            PYGICEVARTGRVAL RESGVDS YLRGYA P
Sbjct  458  PYGICEVARTGRVALVRESGVDSTYLRGYALP  489


 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  108  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLQQVVEQLNKLVNVWKVEDLSREP  165

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +A  +  I+ +  IFR K VD+S+H +T+E+TGD  KM A+ R L  
Sbjct  166  QVERELMLIKLNADATTKAEIMWLVDIFRGKIVDISEHFLTIEVTGDPGKMAAVLRNLSK  225

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G D+ + R
Sbjct  226  FGISELARTGKIALRREKMGEDAPFWR  252



>ref|XP_007028127.1| Valine-tolerant 1 isoform 2 [Theobroma cacao]
 gb|EOY08629.1| Valine-tolerant 1 isoform 2 [Theobroma cacao]
Length=402

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE + LSRITTVVPGT+E+I KLVQQL KLVDL+EV+D+THL
Sbjct  250  TGVISRRGYNIQSLAVGPAERDELSRITTVVPGTNETIGKLVQQLQKLVDLYEVQDMTHL  309

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELML+KVAVN A RR +LDIASIFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  310  PFAERELMLVKVAVNTAARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  369

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEV RTGRVAL RESGVDS  LRGY+ P 
Sbjct  370  PYGICEVTRTGRVALVRESGVDSTSLRGYSLPF  402


 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 98/145 (68%), Gaps = 7/145 (5%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + +   T VV GT+  + ++V+QL+KLV++ +V D++  P
Sbjct  98   GVFARRGYNIESLAVGLNKDKAI--FTIVVSGTEMILRQVVEQLNKLVNVIKVEDISKEP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +A  R  ++ +  IFRAK VD S+  +T+E+TGD  KM A+QR L  
Sbjct  156  HVERELMLIKLHADADTRAEVMWLVDIFRAKIVDTSEQFLTIEVTGDPGKMAAVQRNLSK  215

Query  330  YGICEVARTGRVALARESGVDSNYL  256
            +GI E+ARTG     + SG+ S+ L
Sbjct  216  FGIKELARTG-----KSSGLQSHTL  235



>gb|KHG22544.1| Acetolactate synthase small subunit [Gossypium arboreum]
Length=469

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  657  SLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKV  478
            SLAVGHAEVEGLSRITTVVPGTDESISKLVQQL+KLVD+HEVRDLT LPFAERELMLIK+
Sbjct  329  SLAVGHAEVEGLSRITTVVPGTDESISKLVQQLYKLVDMHEVRDLTQLPFAERELMLIKI  388

Query  477  AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGR  298
            AVNA  RR +LDIA+IFRAKAVDVSDHT+TLELTGDL KMVALQRLLEPYGICEVARTGR
Sbjct  389  AVNATARRDVLDIANIFRAKAVDVSDHTVTLELTGDLDKMVALQRLLEPYGICEVARTGR  448

Query  297  VALARESGVDSNYLRGYAFPL  235
            +AL RESGVDS YLRGY+FPL
Sbjct  449  LALVRESGVDSKYLRGYSFPL  469


 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++V+QL KLV++ +V DL++ P
Sbjct  95   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLQQVVEQLQKLVNVWKVEDLSNEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +   R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  153  QVERELMLIKVNADPKFRAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKMVAVQRNLSK  212

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  213  FGIKEIARTGKIALRREKMGASAPFWR  239



>ref|XP_010673855.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=477

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTVVPG DESI KLVQQL KLVDLHE++DLTHL
Sbjct  323  TGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGNDESIGKLVQQLSKLVDLHEIQDLTHL  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA N + RR +LDIA+IFRAKAVDVSDHTITL+L+GDL KMVALQRLLE
Sbjct  383  PFAERELMLIKVAANTSARRDVLDIANIFRAKAVDVSDHTITLQLSGDLDKMVALQRLLE  442

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RES VDS  LRGYA PL
Sbjct  443  PYGICEVARTGRVALTRESRVDSALLRGYALPL  475


 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 93/137 (68%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             V +RRGYNI+SLAVG  + + L   T VV GTD+ + ++++QL+KLV + +V DL+  P
Sbjct  92   GVISRRGYNIESLAVGLNKDKAL--FTIVVCGTDKVLRQVMEQLNKLVSVLKVEDLSREP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+K+  +A     I  +  IFRAK VDVSD  +T+E+TGD  KM A+ R    
Sbjct  150  QVERELMLVKLNADANTHTEIKWLVEIFRAKIVDVSDSLVTVEVTGDPGKMAAVLRNFSK  209

Query  330  YGICEVARTGRVALARE  280
            +GI EVARTG++AL RE
Sbjct  210  FGIKEVARTGKIALRRE  226



>ref|XP_009788611.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=276

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYN+QSLAVG AE EGLSRITTV+PGTDE+I KLV+Q +KLVD+HEV+D+THL
Sbjct  124  TGVISRRGYNVQSLAVGPAESEGLSRITTVIPGTDETIGKLVKQFYKLVDIHEVQDITHL  183

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA NA  RR +LDIASIFRAK VDVSDHT+ LELTGD +K++ALQRLLE
Sbjct  184  PFAERELMLIKVAANATARRDVLDIASIFRAKPVDVSDHTVALELTGDFNKLLALQRLLE  243

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS  LRGY  PL
Sbjct  244  PYGICEVARTGRIALVRESGVDSTSLRGYPLPL  276



>ref|XP_006858758.1| hypothetical protein AMTR_s00066p00141740 [Amborella trichopoda]
 gb|ERN20225.1| hypothetical protein AMTR_s00066p00141740 [Amborella trichopoda]
Length=496

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T  F+RRGYNIQSLAVG +E EG+SRI TVVP TDESISKLV+QL+KL+D+HEVRD+THL
Sbjct  344  TGCFSRRGYNIQSLAVGPSEREGISRIMTVVPATDESISKLVRQLYKLIDVHEVRDITHL  403

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA+RELMLIK+AVN A RR +L+IASIFRAKAVDVSDHTITLELTGDL K+VA+QRLLE
Sbjct  404  PFAQRELMLIKIAVNTAARREVLEIASIFRAKAVDVSDHTITLELTGDLGKLVAIQRLLE  463

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+ALARESGVDS YLRG++ PL
Sbjct  464  PYGICEVARTGRIALARESGVDSRYLRGFSIPL  496


 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI SLAVG    + L   T VV GT+  + ++  QL+KLV++ +V DL+  P
Sbjct  109  GVFARRGYNIDSLAVGLNSDKAL--FTIVVSGTERVLRQVTNQLYKLVNVLKVEDLSKEP  166

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV V+   R  +L +  IFRA+ VDVSD  +T+E+TGD  K+VA++R+L  
Sbjct  167  QVERELMLIKVNVDHNKRAEVLGLVDIFRARVVDVSDDLLTIEVTGDPGKIVAVERILRK  226

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  227  FGIREIARTGKIALRREKMGATAPFWR  253



>ref|XP_011460628.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=479

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG +E EGLSRITTVVPGTD++I+KLVQQL KL+DLHEVRD+THL
Sbjct  327  TGVISRRGYNIQSLAVGPSEKEGLSRITTVVPGTDDTITKLVQQLRKLIDLHEVRDITHL  386

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNA  RR +LDIA IFRAKAVDVSDHTITLELTGDL+KMVALQ+LLE
Sbjct  387  PFAERELMLIKIAVNANARRDVLDIAGIFRAKAVDVSDHTITLELTGDLNKMVALQKLLE  446

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYG+CE+ARTGRVAL R SGVDS  LRGY  PL
Sbjct  447  PYGLCEIARTGRVALERGSGVDSTSLRGYPLPL  479


 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT++ + ++V+QL+KLV++ +V D++  P
Sbjct  96   GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTEKILQQVVEQLNKLVNVIKVEDISREP  153

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR    
Sbjct  154  QVERELMLIKLHADPSNRAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKMVAVQRNFSK  213

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  214  FGIKELARTGKIALRRE  230



>ref|XP_006663345.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=425

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG SRITTVVPGTDESI+KLV QL+KL+D++EV+DLTHL
Sbjct  273  TGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHL  332

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA RELM+IK+AVN   RR ILDIA IFRAK VDVSDHT+TL+LTGDL KMVALQR+LE
Sbjct  333  PFAARELMIIKIAVNTTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLE  392

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRG++ PL
Sbjct  393  PYGICEVARTGRVALRRESGVDSKYLRGFSLPL  425


 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 106/147 (72%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  41   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQVVEQLNKLVNVIQVDDLSKEP  98

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+SDHT+T+E+TGD  K+VA+QR L  
Sbjct  99   QVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHTLTIEVTGDPGKIVAVQRNLSK  158

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G ++ + R
Sbjct  159  FGIKEIARTGKIALRREKMGENAPFWR  185



>emb|CDX79442.1| BnaC03g17780D [Brassica napus]
Length=471

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  657  SLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKV  478
            SLAVGHAE +G+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTHLPFAERELMLIK+
Sbjct  329  SLAVGHAEAQGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHLPFAERELMLIKI  388

Query  477  AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGR  298
            AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLEPYGICEVARTGR
Sbjct  389  AVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGR  448

Query  297  VALARESGVDSNYLRGYAFPL  235
            VALARESGVDS YLRGY+FPL
Sbjct  449  VALARESGVDSKYLRGYSFPL  469


 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  98   GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  156  QVERELMLVKVNADPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKN  215

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  216  FEIREIVRTGKIALRREKMGATAPFWR  242



>ref|XP_004953051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Setaria italica]
Length=488

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EG+SRITTVVPGT+ESI KLVQQL+KL+D+HEV D+THL
Sbjct  336  TGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTNESIEKLVQQLYKLIDVHEVHDITHL  395

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIKV+VN A RR ILDIA IFRAK VDVSDHT+TL+L+GDL+KMVALQRLLE
Sbjct  396  PFSERELMLIKVSVNTAARREILDIAEIFRAKPVDVSDHTVTLQLSGDLNKMVALQRLLE  455

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRG++ PL
Sbjct  456  HYGICEVARTGRVALVRESGVDSKYLRGFSLPL  488


 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ ++++++QL+KLV++  V DL+  P
Sbjct  102  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLNQVIEQLNKLVNVLSVEDLSKEP  159

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+SD T+TLE+ GD  K+ A+QR L  
Sbjct  160  QVERELMLIKLNVKPDQRPEVMVLVDIFRAKVVDISDTTLTLEVAGDPGKIAAVQRNLRK  219

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ RTG++AL RE  G  + + R
Sbjct  220  FGIKEICRTGKIALRREKIGATARFWR  246



>ref|XP_008643958.1| PREDICTED: uncharacterized protein LOC100381801 isoform X1 [Zea 
mays]
 gb|AFW72257.1| hypothetical protein ZEAMMB73_990877 [Zea mays]
Length=486

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EG+SRITTVVPGT ESI KLVQQL+KL+D+HEV D+TH 
Sbjct  334  TGVFARRGYNIQSLAVGSAEKEGISRITTVVPGTVESIGKLVQQLYKLIDVHEVHDITHS  393

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+VN A RR ILDIA IFRAK +DVSDHT+TL+LTGDL KMVALQRLLE
Sbjct  394  PFAERELMLIKVSVNTAARREILDIAEIFRAKPIDVSDHTVTLQLTGDLDKMVALQRLLE  453

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RES VDS YLRGY+ PL
Sbjct  454  PYGICEVARTGRVALVRESKVDSKYLRGYSLPL  486


 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  ++++++QL+KLV++H V DL+  P
Sbjct  102  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDMVLNQVIEQLNKLVNVHSVEDLSKEP  159

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+S+ T+T+E+ GD  K+ A+QR L  
Sbjct  160  QVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTLTIEVAGDPGKIAAVQRNLRK  219

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ RTG++AL RE  G  + + R
Sbjct  220  FGIKEICRTGKIALRREKIGATARFWR  246



>ref|XP_007028126.1| ACT domain-containing small subunit of acetolactate synthase 
protein isoform 1 [Theobroma cacao]
 gb|EOY08628.1| ACT domain-containing small subunit of acetolactate synthase 
protein isoform 1 [Theobroma cacao]
Length=482

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE + LSRITTVVPGT+E+I KLVQQL KLVDL+EV+D+THL
Sbjct  330  TGVISRRGYNIQSLAVGPAERDELSRITTVVPGTNETIGKLVQQLQKLVDLYEVQDMTHL  389

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELML+KVAVN A RR +LDIASIFRAKAVDVSDHTITLELTGDL+KMVALQRLLE
Sbjct  390  PFAERELMLVKVAVNTAARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQRLLE  449

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEV RTGRVAL RESGVDS  LRGY+ P 
Sbjct  450  PYGICEVTRTGRVALVRESGVDSTSLRGYSLPF  482


 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + +   T VV GT+  + ++V+QL+KLV++ +V D++  P
Sbjct  98   GVFARRGYNIESLAVGLNKDKAI--FTIVVSGTEMILRQVVEQLNKLVNVIKVEDISKEP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +A  R  ++ +  IFRAK VD S+  +T+E+TGD  KM A+QR L  
Sbjct  156  HVERELMLIKLHADADTRAEVMWLVDIFRAKIVDTSEQFLTIEVTGDPGKMAAVQRNLSK  215

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  216  FGIKELARTGKIALRRE  232



>gb|EEC67965.1| hypothetical protein OsI_35716 [Oryza sativa Indica Group]
Length=476

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG SRITTVVPGTDESI+KLV QL+KL+D++EV+DLTHL
Sbjct  324  TGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHL  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA RELM+IK+AVN   RR ILDIA IFRAK VDVSDHT+TL+LTGDL KMVALQR+LE
Sbjct  384  PFAARELMIIKIAVNTTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRG++ PL
Sbjct  444  PYGICEVARTGRVALRRESGVDSKYLRGFSLPL  476


 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  92   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQVVEQLNKLVNVIQVDDLSKEP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+SDHT+T+E+TGD  K+VA+QR L  
Sbjct  150  QVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHTLTIEVTGDPGKIVAVQRNLSK  209

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  210  FGIKEIARTGKIALRRE  226



>gb|AAX96859.1| acetolactate synthase, small subunit, putative [Oryza sativa 
Japonica Group]
 gb|ABA92419.1| acetolactate synthase small subunit, putative, expressed [Oryza 
sativa Japonica Group]
Length=476

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG SRITTVVPGTDESI+KLV QL+KL+D++EV+DLTHL
Sbjct  324  TGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHL  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA RELM+IK+AVN   RR ILDIA IFRAK VDVSDHT+TL+LTGDL KMVALQR+LE
Sbjct  384  PFAARELMIIKIAVNTTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRG++ PL
Sbjct  444  PYGICEVARTGRVALRRESGVDSKYLRGFSLPL  476


 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  92   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQVVEQLNKLVNVIQVDDLSKEP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+SDHT+T+E+TGD  K+VA+QR L  
Sbjct  150  QVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHTLTIEVTGDPGKIVAVQRNLSK  209

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  210  FGIKEIARTGKIALRRE  226



>ref|NP_001151166.1| acetolactate synthase/ amino acid binding protein [Zea mays]
 gb|ACG41837.1| acetolactate synthase/ amino acid binding protein [Zea mays]
 gb|AFW62901.1| acetolactate synthase/ amino acid binding protein [Zea mays]
Length=483

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EG+SRITTVVPGT ESI KLVQQL+KL+D+HEV D+TH 
Sbjct  331  TGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTVESIEKLVQQLYKLIDVHEVHDITHS  390

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+VN A R+ ILDIA IFRAK VDVSDHT+TL+LTGDL KMVALQRLLE
Sbjct  391  PFAERELMLIKVSVNTAARKEILDIAEIFRAKPVDVSDHTVTLQLTGDLDKMVALQRLLE  450

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RES VDS YLRGY+ PL
Sbjct  451  PYGICEVARTGRVALVRESKVDSKYLRGYSLPL  483


 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  ++++++QL+KLV++  V DL+  P
Sbjct  98   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLNQVIEQLNKLVNVLSVEDLSKEP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+S+ T+T+E+ GD  K+ A+QR L  
Sbjct  156  QVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTLTMEVAGDPGKIAAVQRNLWK  215

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ RTG++AL RE  G  + + R
Sbjct  216  FGIKEICRTGKIALRRERIGATARFWR  242



>emb|CDX84757.1| BnaA03g14730D [Brassica napus]
Length=467

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  657  SLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKV  478
            SLAVGHAE +G+SRITTVVP TDES+SKLVQQL+KLVD+HEV DLTHLPF+ERELMLIK+
Sbjct  325  SLAVGHAEAQGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKI  384

Query  477  AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGR  298
            AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLEPYGICEVARTGR
Sbjct  385  AVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGR  444

Query  297  VALARESGVDSNYLRGYAFPL  235
            VALARESGVDS YLRGY+FPL
Sbjct  445  VALARESGVDSKYLRGYSFPL  465


 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  94   GVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  151

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRAK VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  152  QVERELMLVKVNAHPEYRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKK  211

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  212  FEIREIVRTGKIALRREKMGATAPFWR  238



>gb|KHG18039.1| Acetolactate synthase small subunit [Gossypium arboreum]
Length=499

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE +GLSRITTV+PGTDE+++KL QQL KLVDL+EV+D+TH 
Sbjct  347  TGVISRRGYNIQSLAVGPAEKDGLSRITTVIPGTDETLAKLFQQLRKLVDLYEVQDMTHS  406

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAV+   RR ILDIA+IFRAKAVDVSDHTITLELTGDL+KMVALQ+LLE
Sbjct  407  PFAERELMLIKVAVSPPARRDILDIANIFRAKAVDVSDHTITLELTGDLNKMVALQKLLE  466

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  P 
Sbjct  467  PYGICEVARTGRVALVRESGVDSTYLRGYPLPF  499


 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++V+QL+KLV++ +V D++  P
Sbjct  99   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERILRQVVEQLNKLVNVIKVDDISMEP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  N   R  I+ +  IFRA+ VD S+H +T+E+TGD  KM A+QR L  
Sbjct  157  HVERELMLIKLNTNPTTRAEIMWLVDIFRARIVDTSEHFLTIEVTGDPGKMAAVQRNLSK  216

Query  330  YGICEVARTGRVALA  286
            +GI E+ARTG+VAL+
Sbjct  217  FGIKELARTGKVALS  231



>ref|XP_003576101.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brachypodium distachyon]
Length=474

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE  G+SRITTVVPG DESI+KLV QL+KL+D+HEV+DLTHL
Sbjct  322  TGVFSRRGYNIQSLAVGPAEKLGISRITTVVPGNDESIAKLVHQLYKLIDVHEVQDLTHL  381

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA RELM+IKVAVN   RR ILDIA IFRAK VDVSDHT+TL+LTGDL KMVALQR+LE
Sbjct  382  PFAARELMIIKVAVNTTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLE  441

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICE+ARTGRVAL+RESGVDS YLRG++ PL
Sbjct  442  PYGICEIARTGRVALSRESGVDSKYLRGFSLPL  474


 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  91   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQVVEQLNKLVNVIQVDDLSKEP  148

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V +  R  ++ +  IFRAK VD+S+ T+T+E+TGD  KMVA+QR L  
Sbjct  149  QVERELMLIKLNVESDRRLEVMGLVDIFRAKVVDLSERTLTIEVTGDPGKMVAVQRNLSK  208

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  209  FGIKEIARTGKIALRRE  225



>gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japonica Group]
Length=422

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 140/182 (77%), Gaps = 29/182 (16%)
 Frame = -2

Query  693  TAVFARRGYNIQ-----------------------------SLAVGHAEVEGLSRITTVV  601
            T VFARRGYNIQ                             SLAVG AE  GLSRITTV 
Sbjct  241  TGVFARRGYNIQGDVYPVEPYEGSSMNQVLDAHWGVLDDEDSLAVGPAEKSGLSRITTVA  300

Query  600  PGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKVAVNAAVRRTILDIASIFRA  421
            PGTDESI KLVQQL+KLVD+HEV+D+THLPFAERELMLIKV+VN A RR ILDIA IFRA
Sbjct  301  PGTDESIEKLVQQLNKLVDVHEVQDITHLPFAERELMLIKVSVNTAARRDILDIAEIFRA  360

Query  420  KAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRVALARESGVDSNYLRGYAF  241
            K+VDVSDHT+TL+LTGDL KMVALQRLLEPYGICEVARTGRVAL RESGVDS YLRGY+F
Sbjct  361  KSVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF  420

Query  240  PL  235
            PL
Sbjct  421  PL  422


 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + +   T VV GTD  ++++++QL+KLV++  V DL+  P
Sbjct  7    GVFARRGYNIESLAVGLNKDKAM--FTIVVSGTDRVLNQVIEQLNKLVNVLNVEDLSKEP  64

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+S++T+T+E+TGD  K+VA+QR L  
Sbjct  65   QVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKIVAVQRNLSK  124

Query  330  YGICEVARTGRVALARE  280
            +GI E+ RTG++AL RE
Sbjct  125  FGIKEICRTGKIALRRE  141



>gb|KJB78878.1| hypothetical protein B456_013G024000 [Gossypium raimondii]
Length=483

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE +GLSRITTV+PGTDE+++KL QQL KLVDL+EV+D+TH 
Sbjct  331  TGVISRRGYNIQSLAVGPAEKDGLSRITTVIPGTDETLAKLFQQLRKLVDLYEVQDMTHS  390

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAV+ A RR ILDIA+IFRAKAVDV DHTITLELTGDL+KMVALQ+LLE
Sbjct  391  PFAERELMLIKVAVSPAARRDILDIANIFRAKAVDVCDHTITLELTGDLNKMVALQKLLE  450

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY  P 
Sbjct  451  PYGICEVARTGRVALVRESGVDSTYLRGYPLPF  483


 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 102/149 (68%), Gaps = 2/149 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++V+QL+KLV++ +V D++  P
Sbjct  99   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERILRQVVEQLNKLVNVIKVDDISMEP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  N   R  I+ +  IFRA+ VD S+H +T+E+TGD  KM A+QR L  
Sbjct  157  HVERELMLIKLNTNPTTRAEIMWLVDIFRARIVDTSEHFLTVEVTGDPGKMAAVQRNLSK  216

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +GI E+ARTG++AL RE   ++    G++
Sbjct  217  FGIKELARTGKIALRREKMGETAPFWGFS  245



>emb|CDP04139.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYN+QSLAVG AE EG+SRITTVVPGT+E+I KLVQQ +KLVD+HEV+D+T L
Sbjct  300  TGVISRRGYNVQSLAVGPAEKEGVSRITTVVPGTNETIGKLVQQFYKLVDVHEVQDITPL  359

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVNAA RR +LDIASIFRAK VDVSDHTITLELTGD +KM+ALQ+LLE
Sbjct  360  PFAERELMLIKVAVNAAARRDVLDIASIFRAKPVDVSDHTITLELTGDFNKMLALQKLLE  419

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFP  238
            PYGICEVARTGRVAL RESGVDS  LRGY  P
Sbjct  420  PYGICEVARTGRVALVRESGVDSTLLRGYPLP  451


 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++++ ++V+QL+KLV++ +V DL+  P
Sbjct  68   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKTLQQVVEQLNKLVNVLKVEDLSREP  125

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  ++     ++ +  IFRAK VD+S+H +T+E+TGD  K  A+ R    
Sbjct  126  QVERELMLIKLHADSETIAEVMWLKDIFRAKIVDISEHFLTVEVTGDPGKTAAVLRNFSK  185

Query  330  YGICEVARTGRVALARE  280
            +GI EVARTGR+AL RE
Sbjct  186  FGIKEVARTGRIALRRE  202



>gb|AAD32291.1| putative acetolactate synthase [Arabidopsis thaliana]
Length=484

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  657  SLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKV  478
            SLAVGHAE +G+SRITTV+P TDES+SKLVQQL+KLVD+HEV DLTHLPF+ERELMLIK+
Sbjct  342  SLAVGHAETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKI  401

Query  477  AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGR  298
            AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLLEPYGICEVARTGR
Sbjct  402  AVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGR  461

Query  297  VALARESGVDSNYLRGYAFPL  235
            VALARESGVDS YLRGY+FPL
Sbjct  462  VALARESGVDSKYLRGYSFPL  482


 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 99/150 (66%), Gaps = 6/150 (4%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  163  QVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLKK  222

Query  330  YGICEVARTGRV---ALARES-GVDSNYLR  253
            + I E+ RTG+V   AL RE  G  + + R
Sbjct  223  FQIREIVRTGKVVYIALRREKMGATAPFWR  252



>ref|XP_003572704.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brachypodium distachyon]
Length=481

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGY+IQSLAVG AE EG+SRITTVVPGTDESI KLVQQL+KL+D+H+V DLTHL
Sbjct  329  TGVFARRGYSIQSLAVGRAEKEGISRITTVVPGTDESIEKLVQQLYKLIDVHKVHDLTHL  388

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+ N A RR ILDI  IFRAK VD+SDHT+TL+LTGD  KMVALQ LLE
Sbjct  389  PFAERELMLIKVSGNTAARREILDIGEIFRAKCVDLSDHTVTLQLTGDFAKMVALQGLLE  448

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  449  PYGICEVARTGRVALVRESGVDSKYLRGYSHPL  481


 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++++QL+KLV++  V DL+  P
Sbjct  95   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLKQVIEQLNKLVNVLNVEDLSKEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +A +FRA+ VD+S++++TLE+TGD  K+VA QR L  
Sbjct  153  QVERELMLIKLNVGPDQRADVMFVADVFRARVVDISENSLTLEVTGDPGKIVAAQRNLSK  212

Query  330  YGICEVARTGRVALARE  280
            +GI E+ RTG++AL RE
Sbjct  213  FGIEEICRTGKIALTRE  229



>ref|XP_010524340.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=489

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EG+SRITTV+P TDE ISKLV+QLHKLVDLHEVRD+T+L
Sbjct  337  TGVISRRGYNIQSLAVGPAEKEGISRITTVIPATDEMISKLVRQLHKLVDLHEVRDMTNL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA N + RR +LDIA +FRAKAVDVSDHTITLE+TGDL KM ALQ  LE
Sbjct  397  PFAERELMLIKVAANTSARRDVLDIAQVFRAKAVDVSDHTITLEVTGDLRKMAALQTQLE  456

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  457  AYGICEVARTGRVALVRESGVDSTYLRGYSLPL  489


 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++V+QL+KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNEDKAL--FTIVVIGTDKVLQQVVEQLNKLVNVIKVEDISKEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I+ +  IFRAK VD S+ ++T+E+TGD  KMVALQR LE 
Sbjct  163  QVERELMLIKLNADPTTRTEIMWLIDIFRAKIVDTSERSLTIEVTGDPGKMVALQRNLEK  222

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  223  FGIKEIARTGKIALRRE  239



>ref|XP_002452423.1| hypothetical protein SORBIDRAFT_04g025560 [Sorghum bicolor]
 gb|EES05399.1| hypothetical protein SORBIDRAFT_04g025560 [Sorghum bicolor]
Length=492

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE EG+SRITTVVPGT ESI KLVQQL+KLVD+HEV D+T  
Sbjct  340  TGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTVESIEKLVQQLYKLVDVHEVHDITPS  399

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKV+VN A RR ILDIA IFRAK VDVSDHT+TL+LTGD  KMVALQRLLE
Sbjct  400  PFAERELMLIKVSVNTAARREILDIAEIFRAKPVDVSDHTVTLQLTGDFDKMVALQRLLE  459

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RES VDS YLRGY+ PL
Sbjct  460  PYGICEVARTGRVALVRESKVDSKYLRGYSLPL  492


 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  ++++++QL+KLV++  V DL+  P
Sbjct  106  GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLNQVIEQLNKLVNVLSVEDLSKEP  163

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+S+ T+T+E+ GD  K+ A+QR L  
Sbjct  164  QVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKTLTIEVAGDPGKIAAVQRNLRK  223

Query  330  YGICEVARTGRVALARE  280
            +GI E+ RTG++AL RE
Sbjct  224  FGIKEICRTGKIALRRE  240



>ref|XP_011084704.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
 ref|XP_011084706.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=493

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EG+SRITTVV GTDESI KLV+Q +KLVD++EV+D+THL
Sbjct  341  TGVVSRRGYNIQSLAVGPAETEGISRITTVVAGTDESIGKLVKQFYKLVDVYEVQDMTHL  400

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NAA RR +LDIASIFRAK VDVSDHT+TLE+TGD +KM+ALQ LLE
Sbjct  401  PFAERELMLIKIAANAAARRDVLDIASIFRAKPVDVSDHTVTLEVTGDFNKMLALQNLLE  460

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+  L
Sbjct  461  PYGICEVARTGRVALVRESGVDSRYLRGYSLSL  493


 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  105  GVFARRGYNIESLAVGLNQDKAL--FTIVVCGTEKILQQVVEQLNKLVNVLKVEDLSREP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  ++  +  I+ +  IFR K VD+S++T+T+E+TGD  KMVA+ R L  
Sbjct  163  QVERELMLIKLNADSNTKGEIMWLVDIFRGKVVDISENTLTIEVTGDPGKMVAVLRNLRK  222

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  223  FGIKELARTGKIALRRE  239



>ref|XP_011084705.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=493

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EG+SRITTVV GTDESI KLV+Q +KLVD++EV+D+THL
Sbjct  341  TGVVSRRGYNIQSLAVGPAETEGISRITTVVAGTDESIGKLVKQFYKLVDVYEVQDMTHL  400

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NAA RR +LDIASIFRAK VDVSDHT+TLE+TGD +KM+ALQ LLE
Sbjct  401  PFAERELMLIKIAANAAARRDVLDIASIFRAKPVDVSDHTVTLEVTGDFNKMLALQNLLE  460

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGRVAL RESGVDS YLRGY+  L
Sbjct  461  PYGICEVARTGRVALVRESGVDSRYLRGYSLSL  493


 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  105  GVFARRGYNIESLAVGLNQDKAL--FTIVVCGTEKILQQVVEQLNKLVNVLKVEDLSREP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  ++  +  I+ +  IFR K VD+S++T+T+E+TGD  KMVA+ R L  
Sbjct  163  QVERELMLIKLNADSNTKGEIMWLVDIFRGKVVDISENTLTIEVTGDPGKMVAVLRNLRK  222

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  223  FGIKELARTGKIALRRE  239



>ref|XP_010558579.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=421

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             V +RRGYNIQSLAVG AE EGLSRITTV+P TDE  S+LV QLHKLVD+HEVRD+THLP
Sbjct  270  GVISRRGYNIQSLAVGPAEKEGLSRITTVIPATDEKTSQLVGQLHKLVDIHEVRDMTHLP  329

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
            FAERELMLIKVA N A RR +LDIA +FRAKAVDVSDHTITLE+TGDL KM ALQ  LE 
Sbjct  330  FAERELMLIKVAANTAARRDLLDIAQVFRAKAVDVSDHTITLEVTGDLRKMAALQNQLET  389

Query  330  YGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  390  YGICEVARTGRVALVRESGVDSTYLRGYSLPL  421


 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GTD  + ++V+QL+KLV++ +V D++  P
Sbjct  37   GVFARRGYNIESLAVGLNADKAL--FTIVVIGTDRVLQQVVEQLNKLVNVIKVEDISKEP  94

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+    + R  I+ +  IFRAK VD S+H++T+E+TGD  KM ALQR LE 
Sbjct  95   QVERELMLIKLNAGPSTRTEIMWLVDIFRAKIVDTSEHSLTIEVTGDPGKMAALQRNLEK  154

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  155  FGIKEIARTGKIALRRE  171



>sp|Q9SMC2.1|ILVH_NICPL RecName: Full=Acetolactate synthase small subunit 1, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; Flags: Precursor [Nicotiana plumbaginifolia]
 emb|CAB56614.1| acetolactate synthase small subunit [Nicotiana plumbaginifolia]
Length=449

 Score =   250 bits (639),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDES+SKLVQQL+KLVD+HEVRD+THL
Sbjct  275  TGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDITHL  334

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDLHKMV LQRLLE
Sbjct  335  PFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVRLQRLLE  394

Query  333  PYGICEVART  304
            PYGICEVART
Sbjct  395  PYGICEVART  404


 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 103/147 (70%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  43   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVMEQLQKLVNVIKVEDLSKEP  100

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK++ +   R  ++ +  +FRAK VD+SD ++T+E+TGD  KMVA+QR L  
Sbjct  101  QVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDQSLTIEVTGDPGKMVAVQRNLSK  160

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  161  FGIREIARTGKIALRREKMGESAPFWR  187



>gb|EMT17230.1| Acetolactate synthase small subunit [Aegilops tauschii]
Length=472

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE  G SRITTVVPG DESI+KLVQQL+KL+D++EV+DLTHL
Sbjct  319  TGVFARRGYNIQSLAVGPAEKTGTSRITTVVPGNDESIAKLVQQLYKLIDVYEVQDLTHL  378

Query  513  PFAERELMLIKVAVNAAVRRTILDIA-SIFRAKAVDVSDHTITLELTGDLHKMVALQRLL  337
            PFA RELM+IKVA N + RR ILDIA  +FRAK VDVS HTITL+LTGDL KMVALQRLL
Sbjct  379  PFAARELMIIKVAGNTSARREILDIAEDVFRAKTVDVSGHTITLQLTGDLDKMVALQRLL  438

Query  336  EPYGICEVARTGRVALARESGVDSNYLRGYAFP  238
            EPYGICE+ARTGRVAL RESGVDS YLRGY+ P
Sbjct  439  EPYGICEIARTGRVALCRESGVDSKYLRGYSLP  471


 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ ++++V+QL+KLV++ +V DL+  P
Sbjct  88   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILTQVVEQLYKLVNVIQVDDLSKEP  145

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+SDHT+T+E+TGD  K+ A+QR L  
Sbjct  146  QVERELMLIKLNVEPEQRLEVMGLVDIFRAKVVDLSDHTLTVEVTGDPGKIAAVQRNLNK  205

Query  330  YGICEVARTGRVALARE  280
            +GI EVARTG++AL RE
Sbjct  206  FGIKEVARTGKIALRRE  222



>dbj|BAJ92239.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=473

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGY+IQSLAVG AE EG+SRITTVVPGTDESI KLVQQL+KL+D+H+V DLT L
Sbjct  321  TGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIGKLVQQLYKLIDVHKVDDLTDL  380

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELM+IKV+ N A RR ILDI +IFRA+ VD+SDHT+TL+LTGDL KMVALQRLLE
Sbjct  381  PFAERELMVIKVSGNTAARREILDIGNIFRAECVDLSDHTVTLQLTGDLDKMVALQRLLE  440

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR AL RES VDS YLRGY+ PL
Sbjct  441  PYGICEVARTGRAALLRESRVDSKYLRGYSLPL  473


 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++++QL+KLV++  V DL+   
Sbjct  88   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLKQVIEQLNKLVNVLNVEDLSKEA  145

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +A++FRAK VD+S++++TLE+TGD  K+VA QR L  
Sbjct  146  QVERELMLIKLNVEPDQRADVMFVATVFRAKVVDISENSLTLEVTGDPGKIVAAQRNLSK  205

Query  330  YGICEVARTGRVALARE  280
            +GI E+ RTG++AL RE
Sbjct  206  FGIKEICRTGKIALRRE  222



>ref|XP_006400166.1| hypothetical protein EUTSA_v10016107mg [Eutrema salsugineum]
 gb|ESQ41619.1| hypothetical protein EUTSA_v10016107mg [Eutrema salsugineum]
Length=479

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVGHAE EGLSRITTV+PGTDE+I KLV+QL KL+DLHEV+++TH+
Sbjct  327  TGAISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDENIDKLVRQLQKLIDLHEVKNITHM  386

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA +   RR +LDIA +FRAKA+DVSDHTITLE+TGD+ KM ALQ  LE
Sbjct  387  PFAERELMLIKVAAHTTARRDVLDIAQVFRAKAIDVSDHTITLEVTGDIRKMAALQTQLE  446

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  447  VYGICEVARTGRVALVRESGVDSTYLRGYSLPL  479


 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + +   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  97   GVFARRGYNIESLAVGLNEDKAM--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  154

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I+ +  IFRAK VD S+HT+T+E+TGD  KMVAL+  LE 
Sbjct  155  HVERELMLIKLNADPTTRSEIMWLVDIFRAKIVDTSEHTLTIEVTGDPGKMVALKTNLEK  214

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  215  FGILEIARTGKIALRRE  231



>ref|XP_006286863.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
 gb|EOA19761.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
Length=246

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTD+ I KLV+QL KL+DLHEV+++TH+
Sbjct  94   TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKLVRQLQKLIDLHEVQNITHM  153

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGDL KM ALQ  LE
Sbjct  154  PFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDLRKMAALQTQLE  213

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YG+CEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  214  VYGLCEVARTGRVALVRESGVDSTYLRGYSLPL  246



>emb|CDX85509.1| BnaA02g03040D [Brassica napus]
Length=475

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTDE+I KLV+QL KL+DLHEV+++TH+
Sbjct  323  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDKLVRQLQKLIDLHEVQNITHM  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGD+ KM ALQ  LE
Sbjct  383  PFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDIRKMAALQTQLE  442

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  443  VYGICEVARTGRVALVRESGVDSTYLRGYSLPL  475


 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + +   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  92   GVFARRGYNIESLAVGLNEDKAM--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I+ +  IFRAK VD SDHT+T+E+TGD  KMVAL   LE 
Sbjct  150  HVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHTLTIEVTGDPGKMVALTANLEK  209

Query  330  YGICEVARTGRVALARE  280
            +GI EVARTG++AL RE
Sbjct  210  FGIKEVARTGKIALRRE  226



>ref|XP_009126106.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Brassica rapa]
Length=475

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTDE+I KLV+QL KL+DLHEV+++TH+
Sbjct  323  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDKLVRQLQKLIDLHEVQNITHM  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGD+ KM ALQ  LE
Sbjct  383  PFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDIRKMAALQTQLE  442

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  443  VYGICEVARTGRVALVRESGVDSTYLRGYSLPL  475


 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + +   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  92   GVFARRGYNIESLAVGLNEDKAM--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I+ +  IFRAK VD SDHT+T+E+TGD  KMVAL   LE 
Sbjct  150  HVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHTLTIEVTGDPGKMVALTANLEK  209

Query  330  YGICEVARTGRVALARE  280
            +GI EVARTG++AL RE
Sbjct  210  FGIKEVARTGKIALRRE  226



>emb|CDY38123.1| BnaC02g06500D [Brassica napus]
Length=475

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTDE+I KLV+QL KL+DLHEV+++TH+
Sbjct  323  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDKLVRQLQKLIDLHEVQNITHM  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGD+ KM ALQ  LE
Sbjct  383  PFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDIRKMAALQTQLE  442

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  443  VYGICEVARTGRVALVRESGVDSTYLRGYSLPL  475


 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + +   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  92   GVFARRGYNIESLAVGLNEDKAM--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  +   R  I+ +  IFRAK VD SDHT+T+E+TGD  KMVAL   LE 
Sbjct  150  HVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHTLTIEVTGDPGKMVALTANLEK  209

Query  330  YGICEVARTGRVALARE  280
            +GI EVARTG++AL RE
Sbjct  210  FGIKEVARTGKIALRRE  226



>ref|NP_197133.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 ref|NP_850829.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 sp|Q9FFF4.1|ILVH1_ARATH RecName: Full=Acetolactate synthase small subunit 1, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; AltName: Full=Protein valine-tolerant 
1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09596.1| acetolactate synthase-like protein [Arabidopsis thaliana]
 gb|AAY25401.1| At5g16290 [Arabidopsis thaliana]
 dbj|BAE98982.1| acetolactate synthase-like protein [Arabidopsis thaliana]
 gb|AED92272.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 gb|AED92273.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
Length=477

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTDE+I KLV+QL KL+DL E++++TH+
Sbjct  325  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDKLVRQLQKLIDLQEIQNITHM  384

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGDL KM ALQ  LE
Sbjct  385  PFAERELMLIKVAADTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDLRKMSALQTQLE  444

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  445  AYGICEVARTGRVALVRESGVDSTYLRGYSLPL  477


 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  95   GVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD S+ ++T+E+TGD  KMVAL   LE 
Sbjct  153  HVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQSLTIEVTGDPGKMVALTTNLEK  212

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  213  FGIKEIARTGKIALRRE  229



>dbj|BAH19535.1| AT5G16290 [Arabidopsis thaliana]
Length=477

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTDE+I KLV+QL KL+DL E++++TH+
Sbjct  325  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDKLVRQLQKLIDLQEIQNITHM  384

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGDL KM ALQ  LE
Sbjct  385  PFAERELMLIKVAADTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDLRKMSALQTQLE  444

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  445  AYGICEVARTGRVALVRESGVDSTYLRGYSLPL  477


 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  95   GVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD S+ ++T+E+TGD  KMVAL   LE 
Sbjct  153  HVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQSLTIEVTGDPGKMVALTTNLEK  212

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  213  FGIQEIARTGKIALRRE  229



>ref|XP_011464846.1| PREDICTED: LOW QUALITY PROTEIN: acetolactate synthase small subunit 
2, chloroplastic-like [Fragaria vesca subsp. vesca]
Length=357

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  657  SLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIKV  478
            SLAVGHAEVEG SRIT VVP TDESISKLVQQL+KLVD+H+VRDLT+ PFAERELMLIK+
Sbjct  217  SLAVGHAEVEGQSRITAVVPATDESISKLVQQLYKLVDVHDVRDLTNFPFAERELMLIKI  276

Query  477  AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGR  298
            A NA  RR +LDI +IFRAKAVDVSDHTITLELTGDL+KMVALQRLLEP GICEVARTGR
Sbjct  277  AANAVARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPCGICEVARTGR  336

Query  297  VALARESGVDSNYLRGYAFPL  235
            +AL RESGVDS YL GY+ PL
Sbjct  337  IALVRESGVDSRYLCGYSLPL  357


 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 4/149 (3%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + VFARRGYNI+SLAVG  + + L   T VV GTD  + + ++QLHKLV++ +V DL+  
Sbjct  6    SGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDTVLRQAIEQLHKLVNVLKVEDLSSE  63

Query  513  PFAERELMLIKVAV-NAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLL  337
            P  ERELML+KV   +      I  I +IFRAK VD+SDH++T+E+TGD  KMVALQR L
Sbjct  64   PQVERELMLLKVTTAHPDYVAEIKWIVNIFRAKIVDISDHSVTIEVTGDPGKMVALQRNL  123

Query  336  EPYGICEVARTGRVALARES-GVDSNYLR  253
              +GI E+ARTG++AL RE  G  + + R
Sbjct  124  SKFGIREIARTGKIALRREKLGASAPFWR  152



>ref|XP_002871713.1| hypothetical protein ARALYDRAFT_488480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47972.1| hypothetical protein ARALYDRAFT_488480 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTDE+I KLV+QL KL+DL E++++TH+
Sbjct  324  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDKLVRQLQKLIDLQEIQNITHM  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGDL KM ALQ  LE
Sbjct  384  PFAERELMLIKVAADTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDLRKMSALQTQLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YG+CEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  444  AYGLCEVARTGRVALVRESGVDSTYLRGYSLPL  476


 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  93   GVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  150

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD S+H++T+E+TGD  KMVAL   LE 
Sbjct  151  HVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHSLTIEVTGDPGKMVALTTNLEK  210

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  211  FGIKEIARTGKIALRRE  227



>ref|XP_008667813.1| PREDICTED: uncharacterized protein LOC100279727 isoform X1 [Zea 
mays]
Length=407

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG SRITTVVPGTDESI+KLV QL+KL+D++EV+D THL
Sbjct  255  TGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDFTHL  314

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA RELM+IKVA NA  RR +LDIA IF A+ VD+SDHTITL LTGD+ +MV LQ++LE
Sbjct  315  PFAARELMIIKVAANATARRDVLDIAQIFEAQKVDISDHTITLLLTGDIDRMVRLQKMLE  374

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGR+AL RESGVDS YLRG++ PL
Sbjct  375  QYGICEVARTGRIALLRESGVDSKYLRGFSLPL  407


 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ ++++V+QL+KLV++ +V DL+  P
Sbjct  22   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKILNQVVEQLNKLVNVIKVDDLSMEP  79

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV         I+ +  IF+A+ VD+SD+T+T+E+TGD  KMVA+Q+ L  
Sbjct  80   QVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDLSDYTLTIEVTGDPGKMVAIQKTLSK  139

Query  330  YGICEVARTGRVALARE  280
            YGI E+ARTG++AL RE
Sbjct  140  YGIREIARTGKIALRRE  156



>ref|XP_006286862.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
 gb|EOA19760.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
Length=476

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTD+ I KLV+QL KL+DLHEV+++TH+
Sbjct  324  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKLVRQLQKLIDLHEVQNITHM  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGDL KM ALQ  LE
Sbjct  384  PFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDLRKMAALQTQLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YG+CEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  444  VYGLCEVARTGRVALVRESGVDSTYLRGYSLPL  476


 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  95   GVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD S+H++T+E+TGD  K+VAL+  LE 
Sbjct  153  HVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHSLTIEVTGDPGKLVALETNLEK  212

Query  330  YGICEVARTGRVALARESGVDS  265
            +GI E+ARTG++AL RE   D+
Sbjct  213  FGIREIARTGKIALRREKMGDT  234



>gb|KCW46078.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=373

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 129/153 (84%), Gaps = 18/153 (12%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGH+EVEGLSRITTVVPGTDESISKLVQQL+KLVDLHE+      
Sbjct  239  TGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEI------  292

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
                        AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  293  ------------AVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  340

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGICEVARTGR+AL RESGVDS +LRGYAFP+
Sbjct  341  PYGICEVARTGRIALVRESGVDSKHLRGYAFPV  373


 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  7    GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVEDLSKEP  64

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV      R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  65   QVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  124

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  125  FGIREIARTGKIALRREKMGASAPFWR  151



>gb|EAZ36982.1| hypothetical protein OsJ_21322 [Oryza sativa Japonica Group]
Length=358

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  660  QSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLPFAERELMLIK  481
            QSLAVG AE EG SRITTVVPGTDESI+KLV QL+KL+D++EV+DLTHLPFA RELM+IK
Sbjct  217  QSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHLPFAARELMIIK  276

Query  480  VAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTG  301
            +AVN   RR ILDIA IFRAK VDVSDHT+TL+LTGDL KMVALQR+LEPYGICEVARTG
Sbjct  277  IAVNTTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLEPYGICEVARTG  336

Query  300  RVALARESGVDSNYLRGYAFPL  235
            RVAL RESGVDS YLRG++ PL
Sbjct  337  RVALRRESGVDSKYLRGFSLPL  358


 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GT++ + ++V+QL+KLV++ +V DL+  P
Sbjct  38   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQVVEQLNKLVNVIQVDDLSKEP  95

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +  IFRAK VD+SDHT+T+E+TGD  K+VA+QR L  
Sbjct  96   QVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHTLTIEVTGDPGKIVAVQRNLSK  155

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  156  FGIKEIARTGKIALRRE  172



>ref|NP_001146158.1| uncharacterized protein LOC100279727 [Zea mays]
 gb|ACL53373.1| unknown [Zea mays]
Length=476

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG SRITTVVPGTDESI+KLV QL+KL+D++EV+D THL
Sbjct  324  TGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDFTHL  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA RELM+IKVA NA  RR +LDIA IF A+ VD+SDHTITL LTGD+ +MV LQ++LE
Sbjct  384  PFAARELMIIKVAANATARRDVLDIAQIFEAQKVDISDHTITLLLTGDIDRMVRLQKMLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGR+AL RESGVDS YLRG++ PL
Sbjct  444  QYGICEVARTGRIALLRESGVDSKYLRGFSLPL  476


 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ ++++V+QL+KLV++ +V DL+  P
Sbjct  91   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKILNQVVEQLNKLVNVIKVDDLSMEP  148

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV         I+ +  IF+A+ VD+SD+T+T+E+TGD  KMVA+Q+ L  
Sbjct  149  QVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDLSDYTLTIEVTGDPGKMVAIQKTLSK  208

Query  330  YGICEVARTGRVALARE  280
            YGI E+ARTG++AL RE
Sbjct  209  YGIREIARTGKIALRRE  225



>tpg|DAA41907.1| TPA: hypothetical protein ZEAMMB73_831035 [Zea mays]
Length=476

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG SRITTVVPGTDESI+KLV QL+KL+D++EV+D THL
Sbjct  324  TGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDFTHL  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA RELM+IKVA NA  RR +LDIA IF A+ VD+SDHTITL LTGD+ +MV LQ++LE
Sbjct  384  PFAARELMIIKVAANATARRDVLDIAQIFEAQKVDISDHTITLLLTGDIDRMVRLQKMLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGR+AL RESGVDS YLRG++ PL
Sbjct  444  QYGICEVARTGRIALLRESGVDSKYLRGFSLPL  476


 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ ++++V+QL+KLV++ +V DL+  P
Sbjct  91   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKILNQVVEQLNKLVNVIKVDDLSMEP  148

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV         I+ +  IF+A+ VD+SD+T+T+E+TGD  KMVA+Q+ L  
Sbjct  149  QVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDLSDYTLTIEVTGDPGKMVAIQKTLSK  208

Query  330  YGICEVARTGRVALARE  280
            YGI E+ARTG++AL RE
Sbjct  209  YGIREIARTGKIALRRE  225



>ref|XP_010420316.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=481

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTD+ I KLV+QL KL+DLHEV+++TH+
Sbjct  329  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKLVRQLQKLIDLHEVQNITHM  388

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR ILDIA +FRAKA+DVSDHTITLE+ GDL KM ALQ  LE
Sbjct  389  PFAERELMLIKVAAHTSTRRDILDIAHVFRAKAIDVSDHTITLEVAGDLRKMAALQTQLE  448

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRGY+ PL
Sbjct  449  VYGICEVARTGRVALVRESGVDSTYLRGYSLPL  481


 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAV   E + L   T VV GTD+ + ++V+QL+K+V++ +V D++  P
Sbjct  99   GVFARRGYNIESLAVALNEDKAL--FTIVVLGTDKVLQQVVEQLNKIVNVIKVEDISKEP  156

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD S+H++T+E+TGD  KMVAL+R LE 
Sbjct  157  HVERELMLIKLNADPSTRSEIMWLMDIFRAKIVDTSEHSLTIEVTGDPGKMVALERNLEK  216

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  217  FGIKEIARTGKIALRRE  233



>gb|KCW46079.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=373

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVGH+EVEGLSRITTVVPGTDESISKLVQQL+KLVDLHEV+DLTH+
Sbjct  239  TGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHI  298

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  299  PFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  358

Query  333  PYGIC  319
            PYGIC
Sbjct  359  PYGIC  363


 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L   T VV GT+  + ++++QL KLV++ +V DL+  P
Sbjct  7    GVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVEDLSKEP  64

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV      R  I+ +  IFRAK VD+S+H++T+E+TGD  KMVA+QR L  
Sbjct  65   QVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAVQRNLSK  124

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  125  FGIREIARTGKIALRREKMGASAPFWR  151



>dbj|BAM75181.1| B3-type transcription factor [Ricinus communis]
Length=767

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTDE+I KLV+QL KL+DL E++++TH+
Sbjct  325  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDKLVRQLQKLIDLQEIQNITHM  384

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR +LDIA +FRAKA+DVSDHTITLE+TGDL KM ALQ  LE
Sbjct  385  PFAERELMLIKVAADTSARRDVLDIAQVFRAKAIDVSDHTITLEVTGDLRKMSALQTQLE  444

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL*TQLLN  217
             YGICEVARTGRVAL RESGVDS YLRGY+ PL  Q  N
Sbjct  445  AYGICEVARTGRVALVRESGVDSTYLRGYSLPLGDQFGN  483


 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++V+QL+KLV++ +V DL+  P
Sbjct  95   GVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEP  152

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD S+ ++T+E+TGD  KMVAL   LE 
Sbjct  153  HVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQSLTIEVTGDPGKMVALTTNLEK  212

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  213  FGIKEIARTGKIALRRE  229



>ref|XP_010453787.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Camelina sativa]
Length=479

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTD+ I KLV+QL KL+DLHEV+++TH+
Sbjct  327  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKLVRQLQKLIDLHEVQNITHM  386

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA + + RR ILDIA +FRAKA+DVSDHTITLE+ GDL KM ALQ  LE
Sbjct  387  PFAERELMLIKVAAHTSTRRDILDIAHVFRAKAIDVSDHTITLEVAGDLRKMAALQTQLE  446

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRG++ PL
Sbjct  447  VYGICEVARTGRVALVRESGVDSTYLRGFSLPL  479


 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 102/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++V+QL+K+V++ +V DL+  P
Sbjct  97   GVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQVVEQLNKIVNVIKVEDLSKEP  154

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD S+H++T+E+TGD  KMVAL+R LE 
Sbjct  155  HVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHSLTIEVTGDPGKMVALERNLEK  214

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  215  FGIKEIARTGKIALRRE  231



>ref|XP_010492512.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=479

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T   +RRGYNIQSLAVG AE EGLSRITTV+PGTD+ I KLV+QL KL+DLHEV ++TH+
Sbjct  327  TGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKLVRQLQKLIDLHEVHNITHM  386

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVA   + RR ILDIA +FRAKA+DVSDHTITLE+ GDL KM ALQ  LE
Sbjct  387  PFAERELMLIKVAAQTSTRRDILDIAQVFRAKAIDVSDHTITLEVAGDLRKMAALQTQLE  446

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRG++ PL
Sbjct  447  VYGICEVARTGRVALVRESGVDSTYLRGFSLPL  479


 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 102/137 (74%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  E + L   T VV GTD+ + ++V+QL+K+V++ +V DL+  P
Sbjct  97   GVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQVVEQLNKIVNVIKVEDLSKEP  154

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + + R  I+ +  IFRAK VD S+H++T+E+TGD  KMVAL+R LE 
Sbjct  155  HVERELMLIKLNADPSTRSEIMWLMDIFRAKIVDTSEHSLTIEVTGDPGKMVALERNLEK  214

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG++AL RE
Sbjct  215  FGIKEIARTGKIALRRE  231



>ref|XP_009144046.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Brassica rapa]
Length=379

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EG+SRITTVVP TDES+SKLVQQL+KLVD+HEVRDLTHL
Sbjct  239  TGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHL  298

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIAS+FRAK VDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  299  PFAERELMLIKIAVNAAARRDVLDIASVFRAKTVDVSDHTITLQLTGDLDKMVALQRLLE  358

Query  333  PYGICEVA  310
            PYGICEV+
Sbjct  359  PYGICEVS  366


 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNIQSLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  7    GVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  64

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ + + FRA+ VD+S+H +T+E+TGD  KM+A++R L+ 
Sbjct  65   QVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHALTIEVTGDPGKMIAVERNLKK  124

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  125  FQIREIVRTGKIALRREKMGATAPFWR  151



>ref|XP_002449227.1| hypothetical protein SORBIDRAFT_05g006620 [Sorghum bicolor]
 gb|EES08215.1| hypothetical protein SORBIDRAFT_05g006620 [Sorghum bicolor]
Length=476

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG A  EG SRITTVVPG DESI+KLV QL+KL+D+HEV+D THL
Sbjct  324  TGVFSRRGYNIQSLAVGPAAKEGTSRITTVVPGNDESIAKLVHQLYKLIDVHEVQDFTHL  383

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF  RELM+IKVA NA  RR +LDIA IF A+ VD+SDHTITL LTGD+ +MV LQ++LE
Sbjct  384  PFVGRELMIIKVAANATARRDVLDIAQIFEAQKVDISDHTITLLLTGDIDRMVRLQKMLE  443

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
             YGICEVARTGRVAL RESGVDS YLRG++ PL
Sbjct  444  QYGICEVARTGRVALLRESGVDSKYLRGFSLPL  476


 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ ++++V+QL+KLV++ +V DL+  P
Sbjct  92   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKILNQVVEQLNKLVNVIKVDDLSMEP  149

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV         I+ +  IF+A+ VD+SDHT+T+E+TGD  KMVA+Q+ L  
Sbjct  150  QVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDLSDHTLTIEVTGDPGKMVAIQKTLSK  209

Query  330  YGICEVARTGRVALARE  280
            YGI E+ARTG++AL RE
Sbjct  210  YGIREIARTGKIALRRE  226



>ref|XP_006446200.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59440.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=469

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVP TDESISKL+QQL+KL+DLHEVRDLTHL
Sbjct  336  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHL  395

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIKVAVN   RR +LDIA+IFRAKAVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  396  PFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLE  455

Query  333  PYGICEVA  310
            PYGICEV 
Sbjct  456  PYGICEVC  463


 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD+ + ++++QL KLV++ +V DL++ P
Sbjct  105  GVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +   R  I  +  IFRAK VD+S++++T+E+TGD  KMVA+QR L  
Sbjct  163  QVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E+ARTG++AL RE  G  + + R
Sbjct  223  FGIREIARTGKIALRREKLGASAPFWR  249



>ref|XP_009144045.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Brassica rapa]
Length=457

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EG+SRITTVVP TDES+SKLVQQL+KLVD+HEVRDLTHL
Sbjct  317  TGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHL  376

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIAS+FRAK VDVSDHTITL+LTGDL KMVALQRLLE
Sbjct  377  PFAERELMLIKIAVNAAARRDVLDIASVFRAKTVDVSDHTITLQLTGDLDKMVALQRLLE  436

Query  333  PYGICEVA  310
            PYGICEV+
Sbjct  437  PYGICEVS  444


 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNIQSLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  85   GVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  142

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ + + FRA+ VD+S+H +T+E+TGD  KM+A++R L+ 
Sbjct  143  QVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHALTIEVTGDPGKMIAVERNLKK  202

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  203  FQIREIVRTGKIALRREKMGATAPFWR  229



>ref|XP_004490062.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=564

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGH+EVEG+SR+TTVVPGTDESISKLVQQL+KLV+LHEVRD+TH+
Sbjct  323  TGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHV  382

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIASIFRA+AVDVSDHTITLELTGDL KMVALQRLLE
Sbjct  383  PFAERELMLIKIAVNAAARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLE  442

Query  333  PYGICEVA  310
            PYGICEV 
Sbjct  443  PYGICEVC  450


 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  +   L  I  VV GT+  + ++V+QL KLV++ +V DL++ P
Sbjct  91   GVFARRGYNIESLAVGLNQDRALFSI--VVSGTNRVLQQVVEQLQKLVNVLKVEDLSNEP  148

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I  +   FR K VD+S++++T+E+TGD  KMVA+QR L  
Sbjct  149  QVERELMLLKVNADPQNRAEIKWLVDTFRGKIVDISENSVTIEVTGDPGKMVAVQRSLSK  208

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            +GI E++RTG++AL RE  G  + + R
Sbjct  209  FGIKEISRTGKIALRREKMGASAPFWR  235



>ref|XP_004169905.1| PREDICTED: acetolactate synthase small subunit-like, partial 
[Cucumis sativus]
Length=178

 Score =   223 bits (569),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T + +RRGYNIQSLAVGHAE EGLSRITTV+PGTDESI KLVQQLHKL+DLHEVRDLTHL
Sbjct  53   TGIISRRGYNIQSLAVGHAEREGLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDLTHL  112

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+A NA  RR +LDIA IFRAKAVDVS HTITL+LTGDL+KMVALQRLLE
Sbjct  113  PFAERELMLIKIAANATARRDVLDIADIFRAKAVDVSGHTITLQLTGDLNKMVALQRLLE  172

Query  333  PYGICE  316
            P+GICE
Sbjct  173  PFGICE  178



>ref|XP_010101349.1| Acetolactate synthase small subunit [Morus notabilis]
 gb|EXB88296.1| Acetolactate synthase small subunit [Morus notabilis]
Length=401

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EGLSRITTVVP TDESI+KLVQQL+KLVD+HEVRD+THL
Sbjct  254  TGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESITKLVQQLYKLVDVHEVRDITHL  313

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAEREL+LIK+AVNA+ RR ILDIA+IFRAK+VDVSDHTIT+ELTGDL K++ALQRLLE
Sbjct  314  PFAERELVLIKLAVNASARRDILDIANIFRAKSVDVSDHTITIELTGDLDKIIALQRLLE  373

Query  333  PYGICEVA  310
            PYGICE++
Sbjct  374  PYGICELS  381


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 5/91 (5%)
 Frame = -2

Query  510  FAERELMLIKVAV----NAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQR  343
            FA R   +  +AV    + A+   I+ +   FRAK VD+S+ ++T+E+TGD  KMVALQR
Sbjct  105  FARRGYNIDSLAVGLNKDKALFTIIMWLVDTFRAKIVDISELSLTIEVTGDPGKMVALQR  164

Query  342  LLEPYGICEVARTGRVALARES-GVDSNYLR  253
             L  +GI E+ARTG++AL RE  G  + + R
Sbjct  165  NLSKFGIKEIARTGKIALRREKLGASAPFWR  195



>ref|NP_850174.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 gb|AEC08588.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=469

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 124/153 (81%), Gaps = 22/153 (14%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE +G+SRITTV+P TDES+SKLVQQL+KLVD+HEV DLTHL
Sbjct  337  TGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHL  396

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL                 
Sbjct  397  PFSERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITL-----------------  439

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
                 +VARTGRVALARESGVDS YLRGY+FPL
Sbjct  440  -----QVARTGRVALARESGVDSKYLRGYSFPL  467


 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  105  GVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEP  162

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ +   FRA+ VD+++H +T+E+TGD  KM+A++R L+ 
Sbjct  163  QVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLKK  222

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  223  FQIREIVRTGKIALRREKMGATAPFWR  249



>ref|XP_001773408.1| predicted protein [Physcomitrella patens]
 gb|EDQ61781.1| predicted protein, partial [Physcomitrella patens]
Length=417

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG AE  G SRI TVVPGTDESI KL+ QL KL+D+  V+D+TH 
Sbjct  261  TGVFARRGYNIQSLAVGPAETPGTSRILTVVPGTDESIKKLLSQLSKLIDVLAVQDITHQ  320

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PF+ERELMLIKVA  + VRR +LD+A+IFRAK VD+S+ TITLELTGDL KM ALQRLLE
Sbjct  321  PFSERELMLIKVAATSDVRREVLDVAAIFRAKPVDLSNRTITLELTGDLEKMAALQRLLE  380

Query  333  PYGICEVARTGRVALARESGVDSNYLRGY  247
            P+GI EVARTGRVAL R  GVD+ YLR +
Sbjct  381  PFGILEVARTGRVALVRGGGVDTKYLRQF  409


 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 99/152 (65%), Gaps = 6/152 (4%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             V ARRGYNI+SLAVG  + + L   T VV GTD  + ++++QL KLV + +V DL+  P
Sbjct  24   GVIARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLQQVMKQLSKLVSVKQVADLSKEP  81

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV V    R  +L +  IFRA+ VDV++ ++T+E+TGD  K+ A+Q  +  
Sbjct  82   RVERELMLLKVNVGPTQRAEVLGLVEIFRARIVDVAEESLTIEVTGDPGKIAAMQATMGK  141

Query  330  YGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            +GI E+ARTG++AL RE      Y R +  PL
Sbjct  142  FGIKELARTGKIALRRE----KPYGRTHTSPL  169



>ref|XP_002979412.1| hypothetical protein SELMODRAFT_111081 [Selaginella moellendorffii]
 gb|EFJ19301.1| hypothetical protein SELMODRAFT_111081 [Selaginella moellendorffii]
Length=414

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG +E +G+SRITTVVPGTDESI KL+ QL KL+D+ +V+D+THL
Sbjct  259  TGVFARRGYNIQSLAVGLSERQGISRITTVVPGTDESIRKLLHQLSKLIDVVQVQDITHL  318

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA+RELMLIK++   + RR ILDIA++FRAK VD+S+ +ITLELTGDL KM ALQ LLE
Sbjct  319  PFAQRELMLIKISALPSARRDILDIANVFRAKTVDLSNRSITLELTGDLEKMAALQHLLE  378

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI EVARTGR+AL R+SGVDS  L G   PL
Sbjct  379  PYGILEVARTGRLALVRDSGVDSKLL-GQLQPL  410


 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VF+RRGYNI+SLAVG    + L   T VV GTD  + ++++QL+KLV++ +V DL+  P
Sbjct  25   GVFSRRGYNIESLAVGLNRDKAL--FTIVVSGTDRVLQQVMKQLYKLVNVRKVEDLSKKP  82

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV V AA R  +L +  IFRA+ VDV++ ++TLE+TGD  K+ +L+R +  
Sbjct  83   RVERELMLLKVNVPAAQRTEVLGLVDIFRARVVDVAEDSLTLEVTGDAGKLASLERRMTK  142

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG+++L R+
Sbjct  143  FGIKELARTGKISLLRD  159



>ref|XP_006448524.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
 gb|ESR61764.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
Length=489

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVG AE EGLSRITTVVPGTDESI KLVQ LHKL+DLHEV+D+THL
Sbjct  332  TGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGKLVQLLHKLIDLHEVQDITHL  391

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAEREL+LIK+AVN A RR +LD A IFRA+AVDVSDHTITLELTGDL+K++ALQRLLE
Sbjct  392  PFAERELILIKIAVNTAARRDVLDTAKIFRARAVDVSDHTITLELTGDLNKIIALQRLLE  451

Query  333  PYGICEV  313
            PYGICE+
Sbjct  452  PYGICEL  458


 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 103/149 (69%), Gaps = 2/149 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG    + L   T VV GT+  + ++V+QL+KLV++ +V D+++ P
Sbjct  98   GVFARRGYNIESLAVGLNVDKAL--FTIVVSGTERVLRQVVEQLNKLVNVIKVEDISNEP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  + +    I+ +  IFRAK VD+S+H +T+E+TGD  KMVA+QR L  
Sbjct  156  HVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHALTIEVTGDPGKMVAVQRNLSK  215

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +GI E+ARTG++AL RE   D+     ++
Sbjct  216  FGIKELARTGKIALRREKLGDTAPFWNFS  244



>ref|XP_002977907.1| hypothetical protein SELMODRAFT_107328 [Selaginella moellendorffii]
 gb|EFJ21245.1| hypothetical protein SELMODRAFT_107328 [Selaginella moellendorffii]
Length=412

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 127/153 (83%), Gaps = 3/153 (2%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVG +E +G+SRITTVVPGTDESI KL+ QL KL+D+  V+D+THL
Sbjct  259  TGVFARRGYNIQSLAVGLSERQGISRITTVVPGTDESIRKLLHQLSKLIDV--VQDITHL  316

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFA+RELMLIK++   + RR ILDIA++FRAK VD+S+ +ITLELTGDL KM ALQ LLE
Sbjct  317  PFAQRELMLIKISALPSARRDILDIANVFRAKIVDLSNRSITLELTGDLEKMAALQHLLE  376

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI EVARTGR+AL R+SGVD+  L G   PL
Sbjct  377  PYGILEVARTGRLALVRDSGVDTKLL-GQLQPL  408


 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VF+RRGYNI+SLAVG    + L   T VV GTD  + ++++QL+KLV++ +V DL+  P
Sbjct  25   GVFSRRGYNIESLAVGLNRDKAL--FTIVVSGTDRVLQQVMKQLYKLVNVRKVEDLSKKP  82

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV V AA R  +L +  IFRA+ VDV++ ++TLE+TGD  K+ +L+R +  
Sbjct  83   RVERELMLLKVNVPAAQRTEVLGLVDIFRARVVDVAEDSLTLEVTGDAGKLASLERRMTK  142

Query  330  YGICEVARTGRVALARE  280
            +GI E+ARTG+++L R+
Sbjct  143  FGIKELARTGKISLLRD  159



>gb|EMS53688.1| Acetolactate synthase small subunit [Triticum urartu]
Length=384

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGY+IQSLAVG AE EG+SRITTVVPGTDESI KLVQQL+KL+D+H+V DLT L
Sbjct  257  TGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIEKLVQQLYKLIDVHKVDDLTDL  316

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELM+IKV+ N A RR ILDI +IFRA+ VD+SDHT+TL+LTGDL KMVALQRLLE
Sbjct  317  PFAERELMVIKVSGNTAARREILDIGNIFRAECVDLSDHTVTLQLTGDLDKMVALQRLLE  376

Query  333  PYGICE  316
            PYGICE
Sbjct  377  PYGICE  382


 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++++QL+KLV++  V DL+  P
Sbjct  24   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLKQVIEQLNKLVNVLNVEDLSKEP  81

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +A++FRAK VD+S++++TLE+TGD  K+VA QR L  
Sbjct  82   QVERELMLIKLNVEPDQRADVMFVANVFRAKVVDISENSLTLEVTGDPGKIVAAQRNLRK  141

Query  330  YGICEVARTGRVALARE  280
            +GI E+ RTG++AL RE
Sbjct  142  FGIEEICRTGKIALRRE  158



>gb|EMT12300.1| Acetolactate synthase small subunit [Aegilops tauschii]
Length=432

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGY+IQSLAVG AE EG+SRITTVVPGTDESI KLVQQL+KL+D+H+V DLT L
Sbjct  264  TGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIEKLVQQLYKLIDVHKVDDLTDL  323

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELM+IKV+ N A RR ILDI +IFRA+ VD+SDHT+TL+LTGDL KMVALQRLLE
Sbjct  324  PFAERELMVIKVSGNTAARREILDIGNIFRAECVDLSDHTVTLQLTGDLDKMVALQRLLE  383

Query  333  PYGICE  316
            PYGICE
Sbjct  384  PYGICE  389


 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNI+SLAVG  + + L   T VV GTD  + ++++QL+KLV++  V DL+  P
Sbjct  31   GVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLKQVIEQLNKLVNVLNVEDLSKEP  88

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+ V    R  ++ +A++FRAK VD+S++++TLE+TGD  K+VA QR L  
Sbjct  89   QVERELMLIKLNVEPDQRADVMFVANVFRAKVVDISENSLTLEVTGDPGKIVAAQRNLRK  148

Query  330  YGICEVARTGRVALARE  280
            +GI E+ RTG++AL RE
Sbjct  149  FGIEEICRTGKIALRRE  165



>ref|XP_009144047.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X3 [Brassica rapa]
Length=446

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 118/153 (77%), Gaps = 25/153 (16%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYNIQSLAVGHAE EG+SRITTVVP TDES+SKLVQQL+KLVD+HEVRDLTHL
Sbjct  317  TGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHL  376

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            PFAERELMLIK+AVNAA RR +LDIAS+FRAK VDVSDHTITL                 
Sbjct  377  PFAERELMLIKIAVNAAARRDVLDIASVFRAKTVDVSDHTITL-----------------  419

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
                 +V  T  ++L+R   VDSNYLRGY+FPL
Sbjct  420  -----QVKYTLSLSLSR---VDSNYLRGYSFPL  444


 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGYNIQSLAVG    + L   T VV GT+  + ++++QL KLV++ +V D++  P
Sbjct  85   GVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVEDISSEP  142

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +   R  I+ + + FRA+ VD+S+H +T+E+TGD  KM+A++R L+ 
Sbjct  143  QVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHALTIEVTGDPGKMIAVERNLKK  202

Query  330  YGICEVARTGRVALARES-GVDSNYLR  253
            + I E+ RTG++AL RE  G  + + R
Sbjct  203  FQIREIVRTGKIALRREKMGATAPFWR  229



>ref|XP_009123667.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=96

 Score =   178 bits (451),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -2

Query  516  LPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLL  337
            +PFAERELMLIK+AVNAA RR +LDIASIFRAKAVDVSDHTITL+LTGDL KMVALQRLL
Sbjct  1    MPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLL  60

Query  336  EPYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            EPYGICEVARTGRVALARESGVDS YLRGY+FPL
Sbjct  61   EPYGICEVARTGRVALARESGVDSKYLRGYSFPL  94



>ref|WP_007304707.1| acetolactate synthase [Crocosphaera watsonii]
 gb|EAM51559.1| Acetolactate synthase, small subunit [Crocosphaera watsonii WH 
8501]
 gb|EHJ13596.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0003]
 emb|CCQ59733.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0401]
 emb|CCQ49426.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
8502]
 emb|CCQ58541.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0005]
 emb|CCQ65782.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0402]
Length=173

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D SI +L +QL+KL+++ +V D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQPGISRITMVVPGDDNSIEQLTKQLYKLINVLKVNDITQTP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV V+AA R  +L++A +FRA+ VD+SD T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLLKVNVSAANRAEVLEVAQVFRARIVDISDDTVTIEVVGDPGKMVAIMKMLSK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL RESGV++ YL+
Sbjct  141  FGIREVARTGKIALTRESGVNTEYLK  166



>gb|KDO77101.1| hypothetical protein CISIN_1g0114912mg, partial [Citrus sinensis]
Length=100

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = -2

Query  534  VRDLTHLPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMV  355
            V+D+THLPFAEREL+LIK+AVN A RR +LDIA IFRA+AVDVSDHTITLELTGDL+K++
Sbjct  1    VQDITHLPFAERELILIKIAVNTAARRDVLDIAKIFRARAVDVSDHTITLELTGDLNKII  60

Query  354  ALQRLLEPYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            ALQRLLEPYGICEVARTGRVAL RESGVDS YLRGY  PL
Sbjct  61   ALQRLLEPYGICEVARTGRVALVRESGVDSTYLRGYPLPL  100



>ref|XP_010910806.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Elaeis guineensis]
Length=309

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VF+RRGYNIQSLAVG AE EG+SRITTVVPGTDESI KLVQQL+KL+D+HEV+D+THL
Sbjct  169  TGVFSRRGYNIQSLAVGPAEEEGISRITTVVPGTDESIGKLVQQLYKLIDVHEVQDITHL  228

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLE  382
            PFAERELMLIKVAVN A RR ILDIA IFRAKAVDVSDHTITL+
Sbjct  229  PFAERELMLIKVAVNTAARRDILDIADIFRAKAVDVSDHTITLQ  272


 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  492  MLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEV  313
            MLIK+ V    R+ ++ +  IFRAK VD+S+H++T+E+TGD  K+VA+QR L  +GI E+
Sbjct  1    MLIKLNVGPERRQEVMGLVDIFRAKVVDISEHSLTIEVTGDPGKIVAVQRNLHKFGIKEI  60

Query  312  ARTGRVALARES-GVDSNYLR  253
            ARTG++AL RE  G ++ + R
Sbjct  61   ARTGKIALRREKMGENAPFWR  81



>ref|WP_015219133.1| acetolactate synthase small subunit [Cyanobacterium aponinum]
 gb|AFZ53404.1| acetolactate synthase, small subunit [Cyanobacterium aponinum 
PCC 10605]
Length=172

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D++I +L +QLHKL+++ +V D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQSGISRITMVVPGDDDTIEQLTKQLHKLINVIKVTDITKIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+ N++ R  +L I  IFRAK VD+SD ++ LE+ GD  KMVA+  +L  
Sbjct  81   CVERELMLVKVSANSSNRSEVLQIVQIFRAKVVDISDDSLILEVVGDPGKMVAIISMLSK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG+VAL RESGV++ YL+
Sbjct  141  FGIKEIARTGKVALVRESGVNTEYLK  166



>ref|WP_015164258.1| acetolactate synthase small subunit [Pseudanabaena sp. PCC 7367]
 gb|AFY69285.1| acetolactate synthase, small subunit [Pseudanabaena sp. PCC 7367]
Length=168

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
            ++FARRG+NI+SLAVG AE  GLSRIT VVPG D  I ++V+QL+KL+++  VRDLT +P
Sbjct  21   SLFARRGFNIESLAVGSAEQNGLSRITMVVPGDDRVIEQIVKQLNKLINVITVRDLTQIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELM+IKV    + R  I++IA IFR++ VDVSD ++T+E+ GD  K+VA+ ++L+ 
Sbjct  81   CVERELMMIKVNAGPSTRSEIIEIAQIFRSRVVDVSDDSLTIEVVGDPGKIVAIGKMLQK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG+++L RESGV++ +L+
Sbjct  141  FGIREVARTGKISLTRESGVNTEFLK  166



>ref|XP_011014719.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=446

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T V +RRGYNIQSLAVGHAE EGLSRITTV+PGTDESI KLVQQLHKL+D HEVRD+TH 
Sbjct  338  TGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGKLVQQLHKLIDFHEVRDITHS  397

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLE  382
            PFAEREL LIK+A N+A RR +LDIA IFRAKAVDVSDHTITLE
Sbjct  398  PFAERELTLIKIAANSAARRDVLDIARIFRAKAVDVSDHTITLE  441


 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRGY+I+SLAVG  + + L   T VV GT+E + ++V+QL+KLV + +V D++  P
Sbjct  98   GVFARRGYSIESLAVGLNKDKAL--FTIVVCGTEEVLRQVVEQLNKLVTVIKVEDISRDP  155

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIK+  N + R  I+ +  IFRA  VD+S+H++T+E+TGD  KM A+QR L  
Sbjct  156  QVERELMLIKLNANPSTRAEIMWLVDIFRATIVDISEHSLTIEVTGDPGKMAAVQRNLSK  215

Query  330  YGICEVARTGRVALARES  277
            +GI E+ARTG++AL RE+
Sbjct  216  FGIKELARTGKIALRRET  233



>ref|WP_006527479.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 73106]
 gb|ELR99701.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 73106]
Length=171

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G SRIT VVPG ++ I +L +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQTGRSRITMVVPGDEQVIEQLTKQLYKLINVIKVQDITTIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  N+A R  I+++A +FRA+ VD+SD T+T+E+ GD  KMVA+ ++LE 
Sbjct  81   CVERELMLIKVNANSASRGEIIELAQVFRARIVDISDDTLTVEVVGDPGKMVAIVQMLEK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++AL RESGV++ YL+
Sbjct  141  FGIKEIARTGKIALIRESGVNTEYLK  166



>ref|WP_015227737.1| acetolactate synthase small subunit [Halothece sp. PCC 7418]
 gb|AFZ45866.1| acetolactate synthase, small subunit [Halothece sp. PCC 7418]
Length=176

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRGYNI+SLAVG AE EG+SRIT VVPG D +I +L +QL+KL+++ +V+D+T +P
Sbjct  22   GLFARRGYNIESLAVGPAEKEGISRITMVVPGDDRTIEQLTKQLYKLINVLKVQDVTQVP  81

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV+  A+ R  ++++A +FRA+ VD+++ ++TLE+ GD  KMVA+ +LL  
Sbjct  82   SVERELMLIKVSATASSRAEVIELAQVFRARVVDIAEDSLTLEVVGDPGKMVAIIQLLSK  141

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++ L RESGV++ YL+
Sbjct  142  FGIREIARTGKITLMRESGVNTEYLK  167



>ref|WP_013322899.1| acetolactate synthase [Cyanothece sp. PCC 7822]
 gb|ADN14794.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7822]
Length=175

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I ++ +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQPGISRITMVVPGDDGIIEQITKQLYKLINVLKVQDITQIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +AA R  ++++A +FRA+ VD+S+ T+TLE+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLVKVNASAAFRAEVIELAQVFRARVVDISEDTLTLEVVGDPGKMVAIVQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +GI E+ARTG+VAL RESGV++ YL+  A
Sbjct  141  FGIKEIARTGKVALVRESGVNTEYLKTIA  169



>ref|WP_015230978.1| acetolactate synthase small subunit [Dactylococcopsis salina]
 gb|AFZ52004.1| acetolactate synthase, small subunit [Dactylococcopsis salina 
PCC 8305]
Length=176

 Score =   172 bits (436),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRGYNI+SLAVG AE EG+SRIT VVPG D +I +L +QL+KL+++ +V+D+T LP
Sbjct  22   GLFARRGYNIESLAVGPAEKEGISRITMVVPGDDRTIEQLTKQLYKLINVLKVQDVTQLP  81

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A+ R  ++++A +FRA+ VD+S+ T+TLE+ GD  KMVA+ ++L  
Sbjct  82   CVERELMLIKVNATASGRAEVIELAQVFRARVVDISEDTLTLEVVGDPGKMVAIIKMLHK  141

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++ L R+SGV++ YL+
Sbjct  142  FGIREIARTGKITLVRDSGVNTEYLK  167



>gb|ACB49979.1| acetolactate synthase small subunit [Cyanothece sp. ATCC 51142]
Length=181

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D +I +L +QL+KL+++ +V D+T  P
Sbjct  29   GLFARRGFNIESLAVGPAEQPGISRITMVVPGDDSTIEQLTKQLYKLINVLKVNDITQTP  88

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+V A  R  +L++A +FRA+ VD+SD T+T+E+ GD  KMVA+ ++L  
Sbjct  89   CVERELMLVKVSVTATNRAEVLEVAQVFRARIVDISDDTVTVEVVGDPGKMVAIVQMLNK  148

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL RES V++ YL+
Sbjct  149  FGIREVARTGKIALTRESRVNTEYLK  174



>ref|WP_015167340.1| acetolactate synthase small subunit [Synechococcus sp. PCC 7502]
 gb|AFY72681.1| acetolactate synthase, small subunit [Synechococcus sp. PCC 7502]
Length=168

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
            ++FARRG+NI+SLAVG AE  G SRIT VVPG D  I +L +QL+KL+++  V+DLT +P
Sbjct  21   SLFARRGFNIESLAVGTAEQNGFSRITMVVPGDDHVIEQLTKQLNKLINVIVVKDLTEIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV    A R  I++IA IFRA+ VDVSD ++TLE+ GD  KMVA+ +++E 
Sbjct  81   CVERELMLIKVNAAPAHRSEIIEIAQIFRARVVDVSDDSLTLEVVGDPGKMVAIIKMVEK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG+++L RESGV++ YL+
Sbjct  141  FGIREVARTGKISLIRESGVNTEYLK  166



>ref|WP_036918354.1| MULTISPECIES: acetolactate synthase [Prochlorococcus]
 gb|KGG15568.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0602]
 gb|KGG17848.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0603]
Length=176

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE  G+SR+T VV G D ++ ++ +QL KLV++  V DLT L
Sbjct  20   SGLFARRGFNIDSLAVGPAEAPGISRLTMVVEGDDRTLQQMTKQLDKLVNVLNVIDLTTL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            P  ERELML+KV+ N   R +ILD+  +FRAK VDVS++ +TLE+ GD  K+VAL++LLE
Sbjct  80   PAVERELMLLKVSANNEHRSSILDLVQVFRAKVVDVSNNALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYA  244
            PYGI E+ARTG+VAL R SG+++  L+  +
Sbjct  140  PYGILEIARTGKVALERASGINTELLKSSS  169



>ref|WP_012195782.1| acetolactate synthase [Prochlorococcus marinus]
 gb|ABX09161.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9211]
Length=176

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI+SLAVG AE +G+SR+T VV G +E++ ++ +QL KLV++  V DLT L
Sbjct  20   SGLFARRGFNIESLAVGPAEAKGISRLTMVVEGDEETLQQMTKQLDKLVNVLNVIDLTRL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            P  ERELML+KV+     R+ ILD+  +FRAK VDVSD  + LE+ GD  K+VAL++LL+
Sbjct  80   PAVERELMLLKVSAKKDARKDILDLVQVFRAKVVDVSDEALILEVVGDPGKLVALEKLLK  139

Query  333  PYGICEVARTGRVALARESGVDSNYLR  253
            PYGI E+ARTG+VAL R SGV++  L+
Sbjct  140  PYGILEIARTGKVALKRASGVNTEMLK  166



>ref|WP_009547809.1| MULTISPECIES: acetolactate synthase [Cyanothece]
Length=173

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D +I +L +QL+KL+++ +V D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQPGISRITMVVPGDDSTIEQLTKQLYKLINVLKVNDITQTP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+V A  R  +L++A +FRA+ VD+SD T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLVKVSVTATNRAEVLEVAQVFRARIVDISDDTVTVEVVGDPGKMVAIVQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL RES V++ YL+
Sbjct  141  FGIREVARTGKIALTRESRVNTEYLK  166



>ref|WP_025968180.1| acetolactate synthase, partial [Prochlorococcus sp. scB245a_518I6]
Length=158

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G DE++ ++ +QL+KL ++  V D T+L
Sbjct  4    SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTKQLNKLFNVLGVVDFTNL  63

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  64   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTLEVVGDPGKLVALEKLLE  123

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  124  PYGILEIARTGKVALKRSSGVNTEMLKINKYTL  156



>ref|WP_006453777.1| acetolactate synthase [Synechococcus sp. PCC 7335]
 gb|EDX84032.1| acetolactate synthase, small subunit [Synechococcus sp. PCC 7335]
Length=172

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I +L +QL+KL+++ +V+D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEEAGISRITMVVPGDDLVIEQLAKQLYKLINVLKVQDITETP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  N+  R  ++ +A IFRA+ VDVS  ++TLE+ GD  K+VA++++L+P
Sbjct  81   SVERELMLIKVNANSENRAEVVGLAQIFRARVVDVSKESVTLEVVGDPGKLVAIEQMLKP  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ E+ARTG++AL RESGV++ YL+
Sbjct  141  FGVQEIARTGKIALIRESGVNTEYLK  166



>ref|NP_001067632.2| Os11g0256000 [Oryza sativa Japonica Group]
 dbj|BAF27995.2| Os11g0256000, partial [Oryza sativa Japonica Group]
Length=108

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 1/102 (1%)
 Frame = -2

Query  537  EVRDLTHLPFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLE-LTGDLHK  361
            +V+DLTHLPFA RELM+IK+AVN   RR ILDIA IFRAK VDVSDHT+TL+ LTGDL K
Sbjct  7    QVQDLTHLPFAARELMIIKIAVNTTARRAILDIADIFRAKTVDVSDHTVTLQQLTGDLDK  66

Query  360  MVALQRLLEPYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            MVALQR+LEPYGICEVARTGRVAL RESGVDS YLRG++ PL
Sbjct  67   MVALQRMLEPYGICEVARTGRVALRRESGVDSKYLRGFSLPL  108



>ref|WP_011818754.1| MULTISPECIES: acetolactate synthase [Prochlorococcus]
 gb|ABE10998.1| acetolactate synthase small subunit [uncultured Prochlorococcus 
marinus clone ASNC612]
 gb|ABM70615.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. AS9601]
 gb|ABO17969.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9301]
 gb|AIQ95400.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0604]
 gb|KGG00403.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9314]
 gb|KGG09118.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. SB]
Length=174

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G DE++ ++ +QL+KL ++  V D T+L
Sbjct  20   SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTKQLNKLFNVLGVVDFTNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  140  PYGILEIARTGKVALKRSSGVNTEMLKINKYSL  172



>ref|WP_032518375.1| acetolactate synthase [Prochlorococcus marinus]
 gb|KGG02943.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9321]
 gb|KGG05569.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9322]
 gb|KGG07613.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9401]
Length=174

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G DE++ ++ +QL+KL ++  V D T+L
Sbjct  20   SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTKQLNKLFNVLGVVDFTNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDTALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  140  PYGILEIARTGKVALKRSSGVNTEMLKINKYSL  172



>ref|WP_025930661.1| acetolactate synthase [Prochlorococcus sp. scB241_528O2]
Length=174

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G DE++ ++ +QL+KL ++  V D T+L
Sbjct  20   SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTKQLNKLFNVLGVVDFTNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  140  PYGILEIARTGKVALKRSSGVNTEILKINKYSL  172



>ref|WP_038653708.1| acetolactate synthase [Prochlorococcus sp. MIT 0801]
 gb|AIQ97755.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0801]
Length=167

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI SLAVG AE +G+SR+T VV G + ++ ++ +QL+KL+++ EV DLT LP
Sbjct  21   GLFARRGFNIDSLAVGPAEAKGISRLTMVVQGDESTLQQMTKQLNKLINVLEVLDLTTLP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+ ++  R  ILD+  +FRAK VDVSD  +TLE+ GD  K+VAL+ LL+P
Sbjct  81   AVERELMLLKVSASSQNRGKILDLVQVFRAKVVDVSDSALTLEVVGDPGKLVALENLLKP  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            YGI E+ARTG+VAL R SGV++  L+
Sbjct  141  YGILEIARTGKVALKRASGVNTEMLK  166



>ref|WP_011294852.1| acetolactate synthase [Prochlorococcus marinus]
 gb|AAZ58255.1| acetolactate synthase, small subunit [Prochlorococcus marinus 
str. NATL2A]
 gb|ABM76161.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. NATL1A]
 gb|KGG21278.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. PAC1]
Length=167

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI SLAVG AE +G+SR+T VV G + ++ ++ +QL+KL+++ EV DLT LP
Sbjct  21   GLFARRGFNIDSLAVGPAEAKGISRLTMVVQGDESTLQQMTKQLNKLINVLEVLDLTTLP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+ ++  R  ILD+  +FRAK VDVSD  +TLE+ GD  K+VAL+ LL+P
Sbjct  81   AVERELMLLKVSASSENRGKILDLVQVFRAKVVDVSDSALTLEVVGDPGKLVALENLLKP  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            YGI E+ARTG+VAL R SGV++  L+
Sbjct  141  YGILEIARTGKVALKRASGVNTEMLK  166



>ref|WP_025979293.1| acetolactate synthase, partial [Prochlorococcus sp. scB243_497E17]
Length=170

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G DE++ ++ +QL+KL ++  V D T+L
Sbjct  16   SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTKQLNKLFNVLGVVDFTNL  75

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  76   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDIALTLEVVGDPGKLVALEKLLE  135

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  136  PYGILEIARTGKVALKRSSGVNTEMLKINKYSL  168



>ref|XP_005648800.1| acetolactate synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE24256.1| acetolactate synthase [Coccomyxa subellipsoidea C-169]
Length=824

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYN+QSLAVG++EVEG SRI  V+PG+ E  SK+++QL+KLV + +VRDL+  
Sbjct  290  TGVFARRGYNVQSLAVGNSEVEGQSRIIMVIPGSAEGTSKIIKQLNKLVHVQQVRDLSAK  349

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            P+  RELMLIKV   AA RR + D+A+IF     DVS  TITLE+ G   KM ALQ LLE
Sbjct  350  PYVARELMLIKVRCPAAQRRELSDLANIFHGTVCDVSLDTITLEIQGKEDKMHALQGLLE  409

Query  333  PYGICEVARTGRVALARESGVDSNYLRG  250
            PYGI EVARTGRVALAR+SGVDS+ + G
Sbjct  410  PYGILEVARTGRVALARDSGVDSSSVTG  437


 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRG NI+SLAVG    + L   T VV GT  +++ LV+QL KLV +  V D+T   
Sbjct  59   GVFARRGANIESLAVGLNIDKAL--FTIVVTGTQSTVANLVKQLAKLVKVRYVEDITESD  116

Query  510  FAERELMLIKV-AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
              ERE++L+K+ A     R  ++ +  IFRA+ VDVSD ++ + ++GD  K  ALQ +L+
Sbjct  117  RVEREMVLLKIRAPPGPARTEVMQLIDIFRARVVDVSDRSMCIAVSGDSGKTAALQGVLQ  176

Query  333  PYGICEVARTGRVALAR  283
             +GI E+ARTG++AL R
Sbjct  177  KFGIMEIARTGKIALKR  193



>ref|WP_035798716.1| acetolactate synthase [Cyanothece sp. CCY0110]
Length=173

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D +I +L +QL+KL+++ +V ++T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQSGISRITMVVPGDDNTIEQLTKQLYKLINVLKVNNITQTP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+V A  R  +L++A +FRA+ VD+SD T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLVKVSVTATNRAEVLEVAQVFRARIVDISDDTVTVEVVGDPGKMVAIVQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL RES V++ YL+
Sbjct  141  FGIREVARTGKIALTRESRVNTEYLK  166



>ref|WP_011056724.1| MULTISPECIES: acetolactate synthase [Thermosynechococcus]
 ref|NP_681670.1| acetolactate synthase 3 regulatory subunit [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC08432.1| acetolactate synthase small subunit [Thermosynechococcus elongatus 
BP-1]
 gb|AHB89434.1| acetolactate synthase regulatory subunit IlvH [Thermosynechococcus 
sp. NK55a]
Length=172

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I +L +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQIGISRITMVVPGDDAVIEQLTKQLYKLINVLKVQDITTIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV   A+ R  IL++  IFRAK VDVSD ++ +E++GD  KMVAL ++L  
Sbjct  81   CVERELMLLKVNATASTRSEILELVQIFRAKVVDVSDDSLIIEVSGDPGKMVALVQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++AL RESGV++ YL+
Sbjct  141  FGIREIARTGKIALVRESGVNTEYLK  166



>gb|EAZ92294.1| acetolactate synthase small subunit [Cyanothece sp. CCY0110]
Length=181

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D +I +L +QL+KL+++ +V ++T  P
Sbjct  29   GLFARRGFNIESLAVGPAEQSGISRITMVVPGDDNTIEQLTKQLYKLINVLKVNNITQTP  88

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+V A  R  +L++A +FRA+ VD+SD T+T+E+ GD  KMVA+ ++L  
Sbjct  89   CVERELMLVKVSVTATNRAEVLEVAQVFRARIVDISDDTVTVEVVGDPGKMVAIVQMLNK  148

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL RES V++ YL+
Sbjct  149  FGIREVARTGKIALTRESRVNTEYLK  174



>ref|WP_012008031.1| MULTISPECIES: acetolactate synthase [Prochlorococcus]
 gb|ABV50975.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9215]
 gb|KGF86553.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. GP2]
 gb|KGF91892.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9107]
 gb|KGF93520.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9116]
 gb|KGF94067.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9123]
 gb|KGF96738.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9201]
 gb|KGF96834.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9302]
Length=174

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G DE++ ++ +QL+KL ++  V D T+L
Sbjct  20   SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTKQLNKLFNVLGVVDFTNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDIALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  140  PYGILEIARTGKVALKRSSGVNTEMLKINKYSL  172



>ref|WP_017294692.1| acetolactate synthase [Geminocystis herdmanii]
Length=172

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG  E   +SRIT VVPG + +I +L +QLHKL+++ +V D+T +P
Sbjct  21   GLFARRGFNIESLAVGPTEQGNISRITMVVPGDENTIEQLTKQLHKLINVIKVTDITQIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+ N   R  +L IA IFRA+ VD+SD ++TLE+ GD  KMVA+  +L  
Sbjct  81   CVERELMLVKVSTNVNTRAEVLQIAQIFRARVVDMSDDSLTLEVVGDPGKMVAIISMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG+VAL RESGV++ YL+
Sbjct  141  FGIKEIARTGKVALIRESGVNTEYLK  166



>ref|NP_848948.1| aceohydroxyacid synthase small subunit [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAC76110.1| acetolactate synthase small subunit (chloroplast) [Cyanidioschyzon 
merolae strain 10D]
Length=174

 Score =   169 bits (429),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARR +NI+SLAVG AE  G+SRIT VVPG D +I +L++QL+KL+ + +V +LT +P
Sbjct  21   GLFARRSFNIESLAVGPAEQAGISRITMVVPGDDRTIEQLMKQLYKLIPILQVENLTQVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              EREL+L+KV  N+  RR ILD+A+IFRA+ VD+S   + LE+TGD  KMVAL+++L  
Sbjct  81   CVERELILMKVQANSQTRREILDMANIFRARVVDISADDVMLEVTGDPGKMVALEQILTK  140

Query  330  YGICEVARTGRVALARESGVDSNYLRGYAF  241
            +GI EVARTG++AL R S V++ +LR Y F
Sbjct  141  FGIVEVARTGKIALKRSSKVNTEWLR-YNF  169



>ref|WP_023076484.1| acetolactate small subunit [Leptolyngbya sp. Heron Island J]
 gb|ESA32600.1| acetolactate small subunit [Leptolyngbya sp. Heron Island J]
Length=178

 Score =   169 bits (429),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I +L +QL+KL+++ +V D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQTGVSRITMVVPGDDSVIEQLTKQLYKLINVLKVNDITEKP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  N+  R  I++ A IFRA+ VDVSD ++T+E+ GD  KMVA+ ++L+ 
Sbjct  81   CVERELMLLKVNANSNTRSEIINFAQIFRARVVDVSDDSLTIEVVGDPGKMVAIVQVLDR  140

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +G+ E+ARTG++AL RESGV++ YL+  A
Sbjct  141  FGVREIARTGKIALTRESGVNTEYLKAKA  169



>dbj|BAA22822.1| acetolactate synthase [Cyanidioschyzon merolae]
Length=166

 Score =   169 bits (428),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARR +NI+SLAVG AE  G+SRIT VVPG D +I +L++QL+KL+ + +V +LT +P
Sbjct  21   GLFARRSFNIESLAVGPAEQAGISRITMVVPGDDRTIEQLMKQLYKLIPILQVENLTQVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              EREL+L+KV  N+  RR ILD+A+IFRA+ VD+S   + LE+TGD  KMVAL+++L  
Sbjct  81   CVERELILMKVQANSQTRREILDMANIFRARVVDISADDVMLEVTGDPGKMVALEQILTK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL R S V++ +LR
Sbjct  141  FGIVEVARTGKIALKRSSKVNTEWLR  166



>ref|WP_025939160.1| acetolactate synthase [Prochlorococcus sp. scB245a_518A6]
Length=174

 Score =   169 bits (429),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G +E++ ++ +QL+KL ++  V D T+L
Sbjct  20   SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDNETLQQMTKQLNKLFNVLGVVDFTNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  140  PYGILEIARTGKVALKRSSGVNTEMLKINKYSL  172



>ref|WP_017303099.1| acetolactate synthase [Spirulina subsalsa]
Length=172

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I +L++QL+KL+ + +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQVGISRITMVVPGDDRIIEQLIKQLYKLISVLKVQDITQVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV  +A+ R  +++IA +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLIKVNASASNRAEVIEIAQVFRARIVDMSEDTLTIEVVGDPGKMVAIVQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++AL RESGV++ YL+
Sbjct  141  FGIREIARTGKIALVRESGVNTEYLK  166



>ref|WP_025961335.1| acetolactate synthase [Prochlorococcus sp. scB245a_519L21]
Length=174

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G +E++ ++ +QL+KL ++  V D T+L
Sbjct  20   SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDEETLQQMTKQLNKLFNVLGVVDFTNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  140  PYGILEIARTGKVALKRSSGVNTEMLKINKYSL  172



>ref|WP_036902537.1| acetolactate synthase [Prochlorococcus sp. MIT 0601]
 gb|KGG12119.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0601]
Length=176

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI+SLAVG AE  G+SR+T VV G DE++ ++ +QL KLV++  V DLT L
Sbjct  20   SGLFARRGFNIESLAVGPAEAPGISRLTMVVEGDDETLQQMTKQLDKLVNVLYVIDLTSL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            P  ERELML+KV+  +  R+ ILD+  +FRAK VDVSD  + LE+ GD  K+VAL++L++
Sbjct  80   PAVERELMLLKVSAKSNHRKEILDLVQVFRAKVVDVSDQALILEVVGDPGKLVALEKLMK  139

Query  333  PYGICEVARTGRVALARESGVDSNYLR  253
            PYGI E+ARTG+VAL R SG+ +  L+
Sbjct  140  PYGILEIARTGKVALERASGISTEMLK  166



>ref|WP_010477416.1| MULTISPECIES: acetolactate synthase [Acaryochloris]
 gb|ABW27133.1| acetolactate synthase, small subunit [Acaryochloris marina MBIC11017]
Length=172

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG + SI +L +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQIGVSRITMVVPGDNRSIEQLTKQLYKLINVLKVQDITEVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A++R  I++I  IFRAK VDVS+  +T+E++GD  KMVA+ ++L  
Sbjct  81   CVERELMLIKVNAAASLRSEIVEIVQIFRAKVVDVSEDALTIEVSGDPGKMVAIVQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +GI E+ARTG++AL RES V++ YL+  A
Sbjct  141  FGIQEIARTGKIALTRESRVNTEYLKSLA  169



>ref|WP_018397129.1| acetolactate synthase [filamentous cyanobacterium ESFC-1]
Length=172

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
            ++FARRG+NI+SLAVG AE  G+SRIT VVPG D +I +L++QL+KLV++ +V+D+T +P
Sbjct  21   SLFARRGFNIESLAVGPAEQVGISRITMVVPGDDGTIEQLIKQLYKLVNVLKVQDITQVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+K+   A+ R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLLKINATASNRAEVIELAQVFRARIVDISEETLTIEVVGDPGKMVAIVQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG+VAL R+SGV++ YL+
Sbjct  141  FGIREIARTGKVALPRDSGVNTEYLK  166



>ref|WP_011132788.1| acetolactate synthase [Prochlorococcus marinus]
 emb|CAE19613.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
subsp. pastoris str. CCMP1986]
 gb|KGF87291.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. EQPAC1]
Length=174

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G +E++ ++ +QL+KL ++  V D T+L
Sbjct  20   SGLFARRGFNIDSLAVGPAETKGISRLTMVVEGDNETLQQMTKQLNKLFNVLGVVDFTNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDIALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  140  PYGILEIARTGKVALKRSSGVNTEMLKINKYSL  172



>ref|WP_002732118.1| acetolactate synthase [Microcystis aeruginosa]
 dbj|BAG04634.1| acetolactate synthase small subunit [Microcystis aeruginosa NIES-843]
 emb|CCH94766.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9432]
 emb|CCH96995.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9717]
 emb|CCI05878.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
7941]
 emb|CCI25608.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9809]
 emb|CCI34750.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9701]
 gb|ELP55727.1| acetolactate synthase, small subunit [Microcystis aeruginosa 
TAIHU98]
 gb|EPF19849.1| Acetolactate synthase small subunit [Microcystis aeruginosa SPC777]
Length=174

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG ++SI +L +QL+KL+++ +V+D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLTKQLYKLINVLKVQDITQTP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLTIEVVGDPGKMVAIMQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ EVARTG++AL RESGV++ YL+
Sbjct  141  FGVREVARTGKIALIRESGVNTEYLK  166



>ref|WP_006910483.1| acetolactate synthase [Cyanobium sp. PCC 7001]
 gb|EDY38581.1| acetolactate synthase, small subunit [Cyanobium sp. PCC 7001]
Length=176

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI+SLAVG AE EG+SR+T VV G D +++++ +QL KL+++  V DL+ L
Sbjct  20   SGLFARRGFNIESLAVGPAEREGMSRLTMVVEGDDRTLAQMTKQLDKLINVLGVIDLSRL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            P  ERELML+KVA  A  R  ILD+  +FRA  VDV+D  +TLE+ GD  K+VAL++++E
Sbjct  80   PSVERELMLLKVAAPAEQRSAILDLVQVFRANVVDVADDALTLEVVGDPGKLVALEQVME  139

Query  333  PYGICEVARTGRVALARESGVDSNYLR  253
            P+GI E+ARTG+VAL R SGV++ +LR
Sbjct  140  PFGILEIARTGKVALERASGVNTAFLR  166



>ref|WP_002743360.1| MULTISPECIES: acetolactate synthase [Microcystis]
 emb|CAO89159.1| ilvH [Microcystis aeruginosa PCC 7806]
 emb|CCI04181.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9443]
 emb|CCI24317.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9808]
 emb|CCI32791.1| Acetolactate synthase small subunit [Microcystis sp. T1-4]
 gb|ELS48302.1| acetolactate synthase, small subunit [Microcystis aeruginosa 
DIANCHI905]
Length=174

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG ++SI +L +QL+KL+++ +V+D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLTKQLYKLINVLKVQDITQTP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLTIEVVGDPGKMVAIMQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ EVARTG++AL RESGV++ YL+
Sbjct  141  FGVREVARTGKIALIRESGVNTEYLK  166



>ref|WP_015154365.1| acetolactate synthase small subunit [Chroococcidiopsis thermalis]
 gb|AFY87817.1| acetolactate synthase, small subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=174

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I +L +QL+KLV + +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGQAEQNGVSRITMVVPGDDRVIEQLTKQLYKLVHVLKVQDITEVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   ++ R  +++IA IFRA+ VDV++ ++TLE+ GD  K+VAL +LL+ 
Sbjct  81   CVERELMLIKVNATSSNRSEVIEIAQIFRARVVDVAEDSLTLEVVGDPGKIVALVQLLQK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ EVARTG++AL RESGV++ YL+
Sbjct  141  FGLREVARTGKIALVRESGVNTEYLK  166



>ref|WP_008188861.1| acetolactate synthase [Moorea producens]
 gb|EGJ29930.1| acetolactate synthase, small subunit [Moorea producens 3L]
Length=172

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG  E  G+SRIT VVPG D SI +L +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPTEQVGISRITMVVPGDDSSIEQLTKQLYKLINVLKVQDITSIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV   ++ R  I+++A +FRA  VD S+ ++TLE+ GD  KMVAL ++L  
Sbjct  81   CVERELMLLKVNTTSSTRSEIIELAQVFRAHVVDTSEESLTLEVVGDPGKMVALTQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++AL RESGV++ YL+
Sbjct  141  FGIREIARTGKIALTRESGVNTEYLK  166



>ref|WP_039716657.1| acetolactate synthase [Scytonema millei]
 gb|KIF19164.1| acetolactate synthase [Scytonema millei VB511283]
Length=174

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I +L +QL+KLV + +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGQAEQNGVSRITMVVPGDDRVIEQLTKQLYKLVHVLKVQDITEVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV+  ++ R  +++IA IFRA+ VDV++ ++TLE+ GD  K+VA+ +LL+ 
Sbjct  81   CVERELMLIKVSATSSNRSEVIEIAQIFRARVVDVAEDSLTLEVVGDPGKIVAIVQLLQK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ EVARTG++AL RESGV++ YL+
Sbjct  141  FGLREVARTGKIALVRESGVNTEYLK  166



>ref|WP_011125403.1| MULTISPECIES: acetolactate synthase [Prochlorococcus]
 ref|NP_875643.1| Acetolactate synthase, small (regulatory) subunit [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 gb|AAQ00296.1| Acetolactate synthase, small (regulatory) subunit [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 gb|KGG14107.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. LG]
 gb|KGG20725.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. SS2]
 gb|KGG25126.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. SS35]
 gb|KGG33322.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. SS51]
 gb|KGG35572.1| Acetolactate synthase small subunit [Prochlorococcus sp. SS52]
Length=168

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE EG+SR+T VV G  +++ ++ +QL KL+++ +V DLT  
Sbjct  20   SGLFARRGFNINSLAVGPAEAEGISRLTMVVEGDHQTLQQMTKQLDKLINVLKVVDLTTF  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            P  ERELML+KV+     R +ILD+  +FRAK VDVSD  +TLE+ GD  K+VAL++LL+
Sbjct  80   PAVERELMLLKVSATNEKRTSILDLVQVFRAKVVDVSDDALTLEVVGDPGKLVALEKLLK  139

Query  333  PYGICEVARTGRVALARESGVDSNYLR  253
            PYGI E+ARTG+VAL R SGV++  L+
Sbjct  140  PYGILEIARTGKVALERASGVNTEMLK  166



>ref|WP_024971071.1| acetolactate synthase [Microcystis aeruginosa]
Length=174

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG + SI +L +QL+KL+++ +V+D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENSIEQLTKQLYKLINVLKVQDITQTP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLTIEVVGDPGKMVAIMQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ EVARTG++AL RESGV++ YL+
Sbjct  141  FGVREVARTGKIALIRESGVNTEYLK  166



>emb|CCI18700.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9807]
Length=185

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG ++SI +L +QL+KL+++ +V+D+T  P
Sbjct  32   GLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLTKQLYKLINVLKVQDITQTP  91

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  92   CVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLTIEVVGDPGKMVAIMQMLNK  151

Query  330  YGICEVARTGRVALARESGVDSNYLRG  250
            +G+ EVARTG++AL RESGV++ YL+ 
Sbjct  152  FGVREVARTGKIALIRESGVNTEYLKA  178



>dbj|GAL94295.1| acetolactate synthase small subunit [Microcystis aeruginosa NIES-44]
Length=174

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG ++SI +L +QL+KL+++ +V+D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLTKQLYKLINVLKVQDITQTP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLIKVNATADRRAEVIELAQVFRARIVDISEETLTIEVVGDPGKMVAIMQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ EVARTG++AL RESGV++ YL+
Sbjct  141  FGVREVARTGKIALIRESGVNTEYLK  166



>ref|WP_008314262.1| acetolactate synthase, small subunit [Leptolyngbya sp. PCC 6406]
Length=176

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D++I +L +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDQAIEQLTKQLYKLINVLKVQDVTEVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  N+  R  I+ +A IFRA+ VDV++ ++TLE+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLLKVNANSTTRAEIVGLAQIFRARVVDVAEDSLTLEVVGDPGKMVAIVQVLNR  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ E+ARTG+VAL RESGV++ YL+
Sbjct  141  FGLREIARTGKVALTRESGVNTEYLK  166



>ref|WP_014407139.1| acetolactate synthase [Synechocystis sp. PCC 6803]
 sp|Q55141.2|ILVH_SYNY3 RecName: Full=Acetolactate synthase small subunit; AltName: Full=Acetohydroxy-acid 
synthase small subunit; Short=AHAS; Short=ALS 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAK51060.1| acetolactate synthase [Synechocystis sp. PCC 6803]
 dbj|BAL30058.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL33227.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL36396.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. PCC-P]
Length=172

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE   +SRIT VVPG + +I +L +QL+KLV++ +V+D+T  P
Sbjct  21   GLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLTKQLYKLVNVIKVQDITETP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+ NA  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLVKVSANAPNRAEVIELAQVFRARIVDISEDTVTIEVVGDPGKMVAILQMLAK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL RESGV++ YL+
Sbjct  141  FGIKEVARTGKIALVRESGVNTEYLK  166



>ref|WP_041622928.1| acetolactate synthase [Oscillatoria nigro-viridis]
Length=172

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D+ I +L +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIEQLTKQLYKLINVLKVQDITEIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV   +  R  I+++A IFRA+ VD+ D T+TLE+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDDTLTLEVVGDPGKMVAIVQVLNR  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++AL RESGV++ +L+
Sbjct  141  FGIKEIARTGKIALTRESGVNTEFLK  166



>ref|WP_012626204.1| acetolactate synthase [Cyanothece sp. PCC 7425]
 gb|ACL43106.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7425]
Length=172

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D+ I +L +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQMGVSRITMVVPGDDQIIEQLTKQLYKLINVLKVQDVTEIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV  +A+ R  IL++ +IFRAK VDVS+ ++T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLVKVNASASNRSEILELVNIFRAKVVDVSEESLTIEVAGDPGKMVAIIQVLLK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++ L RESGV++ YL+
Sbjct  141  FGIREIARTGKICLTRESGVNTEYLK  166



>ref|WP_039887977.1| acetolactate synthase [Microcoleus vaginatus]
Length=172

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D+ I +L +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIEQLTKQLYKLINVLKVQDITEIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV   +  R  I+++A IFRA+ VD+ D T+TLE+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDDTLTLEVVGDPGKMVAIVQVLNR  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++AL RESGV++ +L+
Sbjct  141  FGIKEIARTGKIALTRESGVNTEFLK  166



>ref|XP_005851575.1| hypothetical protein CHLNCDRAFT_29593 [Chlorella variabilis]
 gb|EFN59473.1| hypothetical protein CHLNCDRAFT_29593 [Chlorella variabilis]
Length=399

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            T VFARRGYN+QSLAVG++E EG+SRIT VVP +  SI+ L++QL+KLV +  V +LT +
Sbjct  244  TGVFARRGYNVQSLAVGNSEREGMSRITIVVPASTSSIANLIKQLNKLVYVENVEELTLV  303

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
            P   RELML+KVA +A+ R  ++ +ASIFRA+  DVS +T+TLE+TG   KMVAL+ +LE
Sbjct  304  PHVSRELMLVKVACSASQRGELVSLASIFRAQVCDVSVNTLTLEVTGREEKMVALKEVLE  363

Query  333  PYGICEVARTGRVALARESGVDSNYL  256
            P+GI EVARTGRV + R+SG+DS +L
Sbjct  364  PHGILEVARTGRVCMQRDSGLDSKFL  389


 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 97/157 (62%), Gaps = 8/157 (5%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             VFARRG NI+SLAVG    + L   T V  GTD +++ L +Q+ KLV++  V D+T   
Sbjct  18   GVFARRGANIESLAVGLTVDKAL--FTIVATGTDATVANLAKQIAKLVNVRYVEDITDES  75

Query  510  FAERELMLIKV-AVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
              ERELMLIKV A     R  +  IA IFRA AVD SD T+TL++TGD+ KM A +R+L 
Sbjct  76   HVERELMLIKVHAPPGPTRTEVTQIADIFRAHAVDCSDRTMTLQVTGDVGKMEAFRRVLA  135

Query  333  PYGICEVARTGRVALAR-----ESGVDSNYLRGYAFP  238
             +G+ E+ RTGR++L R     ++G  S    G + P
Sbjct  136  KFGVVELVRTGRISLKRGDRMFDTGAWSQRQAGRSAP  172



>ref|WP_043999720.1| acetolactate synthase [Microcystis aeruginosa]
Length=174

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG + SI +L +QL+KL+++ +V+D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENSIEQLTKQLYKLINVLKVQDITQTP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLIKVNATADRRAEVIELAQVFRARIVDISEETLTIEVVGDPGKMVAIMQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +G+ EVARTG++AL RESGV++ YL+
Sbjct  141  FGVREVARTGKIALIRESGVNTEYLK  166



>ref|WP_019502773.1| acetolactate synthase [Pseudanabaena sp. PCC 6802]
Length=168

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
            ++FARRG+NI+SLAVG AE  G SRIT VVPG D  I +L +QL+KL+++ +V D+T +P
Sbjct  21   SLFARRGFNIESLAVGAAEEGGCSRITMVVPGDDLVIEQLTKQLNKLINVIKVNDVTEIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV      R  I++IA IFRA+ VDVSD ++TLE+ GD  KMVA+ ++L+ 
Sbjct  81   CVERELMLIKVNAVPEKRSEIIEIAQIFRARVVDVSDDSLTLEVVGDPGKMVAIVKMLQK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG+++L RESGV++ YL+
Sbjct  141  FGIREIARTGKISLTRESGVNTEYLK  166



>dbj|BAM54375.1| acetolactate synthase 3 regulatory subunit [Synechocystis sp. 
PCC 6803]
Length=175

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE   +SRIT VVPG + +I +L +QL+KLV++ +V+D+T  P
Sbjct  24   GLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLTKQLYKLVNVIKVQDITETP  83

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+ NA  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  84   CVERELMLVKVSANAPNRAEVIELAQVFRARIVDISEDTVTIEVVGDPGKMVAILQMLAK  143

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL RESGV++ YL+
Sbjct  144  FGIKEVARTGKIALVRESGVNTEYLK  169



>gb|AFZ05551.1| acetolactate synthase, small subunit [Oscillatoria nigro-viridis 
PCC 7112]
Length=178

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D+ I +L +QL+KL+++ +V+D+T +P
Sbjct  27   GLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIEQLTKQLYKLINVLKVQDITEIP  86

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV   +  R  I+++A IFRA+ VD+ D T+TLE+ GD  KMVA+ ++L  
Sbjct  87   CVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDDTLTLEVVGDPGKMVAIVQVLNR  146

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++AL RESGV++ +L+
Sbjct  147  FGIKEIARTGKIALTRESGVNTEFLK  172



>gb|EGK83985.1| acetolactate synthase, small subunit [Microcoleus vaginatus FGP-2]
Length=178

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D+ I +L +QL+KL+++ +V+D+T +P
Sbjct  27   GLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIEQLTKQLYKLINVLKVQDITEIP  86

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV   +  R  I+++A IFRA+ VD+ D T+TLE+ GD  KMVA+ ++L  
Sbjct  87   CVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDDTLTLEVVGDPGKMVAIVQVLNR  146

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG++AL RESGV++ +L+
Sbjct  147  FGIKEIARTGKIALTRESGVNTEFLK  172



>ref|WP_038545989.1| acetolactate synthase [Synechococcus sp. KORDI-100]
 gb|AII44144.1| acetolactate synthase [Synechococcus sp. KORDI-100]
Length=176

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI SLAVG AE +G SR+T VV G D+++ ++ +QL KLV++ +V DLT  P
Sbjct  21   GLFARRGFNIDSLAVGPAESDGQSRLTMVVEGDDQTLQQMTKQLDKLVNVLQVLDLTQRP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+  A  R  I D+  +FRAK VDV+D  +TLE+ GD  K+VAL+RLL P
Sbjct  81   AVERELMLLKVSAPAQTRSAIFDLVQVFRAKVVDVADEALTLEVVGDPGKLVALERLLAP  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            YGI E+ARTG+VAL R SGV++  L+
Sbjct  141  YGILEIARTGKVALERASGVNTELLK  166



>emb|CCI14937.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9806]
Length=185

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG + SI +L +QL+KL+++ +V+D+T  P
Sbjct  32   GLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENSIEQLTKQLYKLINVLKVQDITQTP  91

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV   A  R  ++++A +FRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  92   CVERELMLIKVNATADRRAEVIELAQVFRARIVDISEETLTIEVVGDPGKMVAIMQMLNK  151

Query  330  YGICEVARTGRVALARESGVDSNYLRG  250
            +G+ EVARTG++AL RESGV++ YL+ 
Sbjct  152  FGVREVARTGKIALIRESGVNTEYLKA  178



>ref|WP_011376800.1| acetolactate synthase [Prochlorococcus marinus]
 gb|ABB50312.1| acetolactate synthase, small subunit [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGF99900.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9311]
Length=174

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G D ++ ++ +QL+KL ++  V D T+L
Sbjct  20   SGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDATLQQMTKQLNKLFNVLGVVDFTNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILDI  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDIALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLRGYAFPL  235
            PYGI E+ARTG+VAL R SGV++  L+   + L
Sbjct  140  PYGILEIARTGKVALKRSSGVNTEMLKINKYSL  172



>ref|WP_036020223.1| acetolactate synthase [Leptolyngbya sp. PCC 7375]
Length=176

 Score =   167 bits (424),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I +L +QL+KL+++ +V D+T  P
Sbjct  21   GLFARRGFNIESLAVGPAEQAGISRITMVVPGDDGVIEQLTKQLYKLINVLKVNDITEKP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV   ++ R  I++ A IFRA+ VDVSD ++T+E+ GD  KMVA+ ++L+ 
Sbjct  81   CVERELMLLKVNATSSTRAEIINFAQIFRARVVDVSDESLTIEVVGDPGKMVAIVQVLDR  140

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +G+ E+ARTG++AL RESGV++ YL+  A
Sbjct  141  FGVREIARTGKIALTRESGVNTEYLKAKA  169



>ref|WP_015195236.1| acetolactate synthase, small subunit [Stanieria cyanosphaera]
 gb|AFZ37582.1| acetolactate synthase, small subunit [Stanieria cyanosphaera 
PCC 7437]
Length=173

 Score =   167 bits (424),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VVPG D  I +L++QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQVGISRITMVVPGDDRIIEQLIKQLYKLINVLKVQDITQVP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV   A+ R  ++ IA IFRA+ VD+S+ T+T+E+ GD  KMVA+ ++L  
Sbjct  81   SVERELMLVKVNAPASGRAEVIQIAHIFRARIVDMSEDTVTVEVVGDPGKMVAIIQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI EVARTG++AL RESGV++ YL+
Sbjct  141  FGIREVARTGKIALVRESGVNTEYLK  166



>ref|WP_028952581.1| acetolactate synthase [Synechococcus sp. CC9616]
Length=176

 Score =   167 bits (423),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI SLAVG AE +G SR+T VV G D+++ ++ +QL KLV++ +V DLT  P
Sbjct  21   GLFARRGFNIDSLAVGPAENDGQSRLTMVVEGDDQTLQQMTKQLDKLVNVLQVLDLTQRP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+  A  R  I D+  +FRAK VDV+D  +TLE+ GD  K+VAL+RLL P
Sbjct  81   AVERELMLLKVSAPAQTRSAIFDLVQVFRAKVVDVADEALTLEVVGDPGKLVALERLLAP  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            YGI E+ARTG+VAL R SGV++  L+
Sbjct  141  YGILEIARTGKVALERASGVNTELLK  166



>ref|WP_026100701.1| acetolactate synthase [Synechococcus sp. PCC 7336]
Length=174

 Score =   167 bits (423),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI +L VG  E  G+SRI  VV GT+  + +  +QL+KL+D+ +V+D+TH+P
Sbjct  21   GMFARRGFNIHNLTVGETEKPGISRIIMVVSGTENDVEQFTKQLYKLIDVLKVQDMTHIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              +RELML+KV   AA RR I+D+A +FRA+ VDVS+ ++TLE+TGD  KMVA+ ++L  
Sbjct  81   CVQRELMLVKVNSTAATRREIMDLAEMFRARIVDVSEESLTLEVTGDPGKMVAIGKMLSG  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            YGI E+ARTG VA  RESGV++ +LR
Sbjct  141  YGIREMARTGMVATIRESGVNTEFLR  166



>gb|AII48755.1| acetolactate synthase [Synechococcus sp. KORDI-52]
Length=170

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI SLAVG AE EG SR+T VV G D+++ ++ +QL KLV++ +V DLT  P
Sbjct  15   GLFARRGFNIDSLAVGPAEAEGQSRLTMVVEGDDQTLQQMTKQLDKLVNVLQVLDLTQRP  74

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KV+  AA R  + ++  +FRAK VDV+D  +TLE+ GD  K+VAL+RL+ P
Sbjct  75   AVERELMLLKVSAPAASRGAVFELVQVFRAKVVDVADEAMTLEVVGDPGKLVALERLMAP  134

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            +GI E+ARTG+VAL R SGV++  L+
Sbjct  135  FGILEIARTGKVALERASGVNTEMLK  160



>ref|WP_012598844.1| acetolactate synthase [Cyanothece sp. PCC 7424]
 gb|ACK69899.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7424]
Length=175

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI+SLAVG AE  G+SRIT VV G D  I ++ +QL+KL+++ +V+D+T +P
Sbjct  21   GLFARRGFNIESLAVGPAEQLGISRITMVVSGDDGIIEQITKQLYKLINVLKVQDITQIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELMLIKV+ +A  R  ++++A +FRA+ VD+S+ T+TLE+ GD  KMVA+ ++L  
Sbjct  81   CVERELMLIKVSASAINRAEVIELAQVFRARVVDISEETLTLEVVGDPGKMVAIVQMLNK  140

Query  330  YGICEVARTGRVALARESGVDSNYLRGYA  244
            +GI E+ARTG+VAL RESGV++ YL+  A
Sbjct  141  FGIKEIARTGKVALVRESGVNTEYLKTIA  169



>ref|WP_007100311.1| acetolactate synthase [Synechococcus sp. RS9917]
 gb|EAQ69008.1| Acetolactate synthase small subunit [Synechococcus sp. RS9917]
Length=176

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -2

Query  690  AVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHLP  511
             +FARRG+NI SLAVG AE +G SR+T VV G D ++ ++ QQL KLV++ +V DL+ +P
Sbjct  21   GLFARRGFNIDSLAVGPAESDGRSRLTMVVDGDDHTLQQMTQQLDKLVNVLQVLDLSQIP  80

Query  510  FAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEP  331
              ERELML+KVA  A  R  I D+  +FRAK VDV+D  +TLE+ GD  K+VAL+RL+ P
Sbjct  81   AVERELMLLKVAAPAEQRSAIFDLVQVFRAKVVDVADEALTLEVVGDPGKLVALERLMAP  140

Query  330  YGICEVARTGRVALARESGVDSNYLR  253
            YGI E+ARTG+VAL R SGV++  L+
Sbjct  141  YGILEIARTGKVALERASGVNTELLK  166



>ref|WP_036920271.1| acetolactate synthase [Prochlorococcus marinus]
Length=174

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 115/155 (74%), Gaps = 2/155 (1%)
 Frame = -2

Query  693  TAVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISKLVQQLHKLVDLHEVRDLTHL  514
            + +FARRG+NI SLAVG AE +G+SR+T VV G ++++ ++ +QL+KL ++  V DL++L
Sbjct  20   SGLFARRGFNIDSLAVGPAETKGMSRLTMVVEGDNKTLQQMTKQLNKLFNVLGVADLSNL  79

Query  513  PFAERELMLIKVAVNAAVRRTILDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLE  334
               ERELML+KV+     R  ILD+  IFRAK VDVSD  +TLE+ GD  K+VAL++LLE
Sbjct  80   AAVERELMLLKVSSKDETRGKILDLVQIFRAKVVDVSDMALTLEVVGDPGKLVALEKLLE  139

Query  333  PYGICEVARTGRVALARESGVDSNYLR--GYAFPL  235
            PYGI E+ARTG++AL R SGV++  L+   Y+F +
Sbjct  140  PYGILEIARTGKIALKRSSGVNTEMLKINKYSFDI  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340