BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001O02

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO60217.1|  hypothetical protein CISIN_1g0083641mg                  246   8e-78   Citrus sinensis [apfelsine]
emb|CAN81885.1|  hypothetical protein VITISV_021582                     244   9e-76   Vitis vinifera
ref|XP_006424495.1|  hypothetical protein CICLE_v10028099mg             247   1e-75   
ref|XP_006488035.1|  PREDICTED: dolichol kinase-like isoform X2         249   3e-75   Citrus sinensis [apfelsine]
ref|XP_006488034.1|  PREDICTED: dolichol kinase-like isoform X1         249   5e-75   Citrus sinensis [apfelsine]
emb|CDP07056.1|  unnamed protein product                                249   7e-75   Coffea canephora [robusta coffee]
ref|XP_006424496.1|  hypothetical protein CICLE_v10028099mg             248   1e-74   Citrus clementina [clementine]
gb|KCW85786.1|  hypothetical protein EUGRSUZ_B02538                     245   2e-74   Eucalyptus grandis [rose gum]
ref|XP_006424497.1|  hypothetical protein CICLE_v10028099mg             247   2e-74   Citrus clementina [clementine]
gb|EPS67268.1|  hypothetical protein M569_07507                         235   2e-74   Genlisea aurea
ref|XP_002523693.1|  Transmembrane protein, putative                    247   2e-74   Ricinus communis
gb|KDP43992.1|  hypothetical protein JCGZ_05459                         247   3e-74   Jatropha curcas
ref|XP_002273662.1|  PREDICTED: dolichol kinase                         247   3e-74   Vitis vinifera
ref|XP_011090038.1|  PREDICTED: dolichol kinase                         246   6e-74   
gb|KHG05634.1|  Dolichol kinase                                         245   2e-73   Gossypium arboreum [tree cotton]
ref|XP_009594141.1|  PREDICTED: dolichol kinase isoform X1              245   2e-73   Nicotiana tomentosiformis
ref|XP_009594149.1|  PREDICTED: dolichol kinase isoform X2              245   2e-73   Nicotiana tomentosiformis
ref|XP_010043798.1|  PREDICTED: dolichol kinase                         244   2e-73   Eucalyptus grandis [rose gum]
ref|XP_008226289.1|  PREDICTED: dolichol kinase                         244   2e-73   Prunus mume [ume]
ref|XP_004487072.1|  PREDICTED: dolichol kinase-like                    244   2e-73   Cicer arietinum [garbanzo]
ref|XP_007205002.1|  hypothetical protein PRUPE_ppa003568mg             244   3e-73   
ref|XP_003638051.1|  Dolichol kinase                                    244   3e-73   
ref|XP_007016839.1|  Phosphatidate cytidylyltransferase family pr...    243   6e-73   
ref|XP_004147285.1|  PREDICTED: uncharacterized protein LOC101218949    243   7e-73   Cucumis sativus [cucumbers]
ref|XP_004161315.1|  PREDICTED: uncharacterized LOC101218949            243   8e-73   
ref|XP_008463178.1|  PREDICTED: dolichol kinase isoform X1              243   9e-73   Cucumis melo [Oriental melon]
ref|XP_008789547.1|  PREDICTED: dolichol kinase-like isoform X1         243   9e-73   Phoenix dactylifera
ref|XP_009408123.1|  PREDICTED: dolichol kinase isoform X2              241   1e-72   
ref|XP_009786599.1|  PREDICTED: dolichol kinase                         242   2e-72   Nicotiana sylvestris
ref|XP_004241288.1|  PREDICTED: dolichol kinase isoform X1              242   2e-72   Solanum lycopersicum
ref|XP_006347198.1|  PREDICTED: dolichol kinase-like                    242   2e-72   Solanum tuberosum [potatoes]
gb|KJB20358.1|  hypothetical protein B456_003G144600                    241   5e-72   Gossypium raimondii
ref|XP_010940630.1|  PREDICTED: dolichol kinase                         241   5e-72   Elaeis guineensis
gb|KJB83869.1|  hypothetical protein B456_013G268700                    240   6e-72   Gossypium raimondii
ref|XP_010689112.1|  PREDICTED: dolichol kinase                         241   6e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009408122.1|  PREDICTED: dolichol kinase isoform X1              241   7e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010233804.1|  PREDICTED: dolichol kinase-like                    234   7e-72   
ref|XP_008800541.1|  PREDICTED: dolichol kinase-like isoform X2         241   7e-72   Phoenix dactylifera
ref|XP_002451535.1|  hypothetical protein SORBIDRAFT_04g003380          234   8e-72   Sorghum bicolor [broomcorn]
gb|KJB83868.1|  hypothetical protein B456_013G268700                    240   9e-72   Gossypium raimondii
ref|XP_011004786.1|  PREDICTED: dolichol kinase isoform X1              240   1e-71   Populus euphratica
gb|KHN06871.1|  Dolichol kinase                                         239   1e-71   Glycine soja [wild soybean]
ref|XP_009356907.1|  PREDICTED: dolichol kinase isoform X3              238   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_004288135.1|  PREDICTED: dolichol kinase                         239   3e-71   Fragaria vesca subsp. vesca
ref|XP_010111811.1|  hypothetical protein L484_020600                   238   3e-71   
ref|XP_008385359.1|  PREDICTED: dolichol kinase isoform X1              239   3e-71   
ref|XP_009356906.1|  PREDICTED: dolichol kinase isoform X2              239   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_008385360.1|  PREDICTED: dolichol kinase isoform X2              239   3e-71   
ref|XP_009356905.1|  PREDICTED: dolichol kinase isoform X1              239   4e-71   Pyrus x bretschneideri [bai li]
ref|XP_003539429.2|  PREDICTED: dolichol kinase-like isoform X1         239   5e-71   Glycine max [soybeans]
ref|XP_010935716.1|  PREDICTED: dolichol kinase-like                    238   8e-71   
gb|KHN21496.1|  Dolichol kinase                                         237   2e-70   Glycine soja [wild soybean]
ref|XP_002313531.1|  phosphatidate cytidylyltransferase family pr...    237   3e-70   
ref|XP_003543453.1|  PREDICTED: dolichol kinase-like                    236   5e-70   Glycine max [soybeans]
ref|XP_008645238.1|  PREDICTED: dolichol kinase                         236   7e-70   Zea mays [maize]
ref|XP_004951908.1|  PREDICTED: dolichol kinase-like isoform X2         235   1e-69   
ref|XP_010497094.1|  PREDICTED: dolichol kinase-like                    230   1e-69   Camelina sativa [gold-of-pleasure]
dbj|BAJ95806.1|  predicted protein                                      232   2e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004951907.1|  PREDICTED: dolichol kinase-like isoform X1         235   2e-69   
ref|XP_010253970.1|  PREDICTED: dolichol kinase                         234   3e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006419077.1|  hypothetical protein EUTSA_v10002461mg             233   1e-68   Eutrema salsugineum [saltwater cress]
gb|KFK33914.1|  hypothetical protein AALP_AA5G077000                    231   2e-68   Arabis alpina [alpine rockcress]
ref|XP_010520384.1|  PREDICTED: dolichol kinase                         231   3e-68   Tarenaya hassleriana [spider flower]
ref|XP_002877378.1|  phosphatidate cytidylyltransferase family pr...    231   5e-68   
ref|XP_010425937.1|  PREDICTED: dolichol kinase-like                    230   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010514840.1|  PREDICTED: dolichol kinase-like                    230   1e-67   Camelina sativa [gold-of-pleasure]
gb|AAL67067.1|  unknown protein                                         229   1e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48280.1|  BnaA05g10740D                                          229   1e-67   Brassica napus [oilseed rape]
ref|NP_190090.2|  putative dolichol kinase                              229   2e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23707.1|  BnaC01g24140D                                          229   2e-67   Brassica napus [oilseed rape]
ref|XP_009149874.1|  PREDICTED: dolichol kinase                         229   2e-67   Brassica rapa
ref|XP_009143958.1|  PREDICTED: dolichol kinase-like                    229   2e-67   
ref|XP_006290826.1|  hypothetical protein CARUB_v10016935mg             229   3e-67   Capsella rubella
emb|CAB89319.1|  putative protein                                       229   3e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY12224.1|  BnaC04g12540D                                          226   2e-66   Brassica napus [oilseed rape]
ref|XP_006833180.1|  hypothetical protein AMTR_s00072p00153940          224   2e-65   Amborella trichopoda
dbj|BAG90656.1|  unnamed protein product                                218   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045877.1|  Os02g0146500                                       218   4e-65   
ref|XP_006646877.1|  PREDICTED: dolichol kinase-like                    221   6e-65   
gb|EEE56295.1|  hypothetical protein OsJ_05366                          218   1e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72477.1|  hypothetical protein OsI_05838                          218   3e-63   Oryza sativa Indica Group [Indian rice]
gb|EEC72481.1|  hypothetical protein OsI_05844                          217   1e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_008789549.1|  PREDICTED: dolichol kinase-like isoform X3         214   5e-62   
ref|XP_008800543.1|  PREDICTED: dolichol kinase-like isoform X3         214   5e-62   
ref|XP_008789548.1|  PREDICTED: dolichol kinase-like isoform X2         214   7e-62   
ref|XP_008800540.1|  PREDICTED: dolichol kinase-like isoform X1         214   1e-61   Phoenix dactylifera
gb|EMT30058.1|  hypothetical protein F775_31824                         204   7e-59   
gb|EMS63897.1|  Splicing factor 3B subunit 1                            211   3e-58   Triticum urartu
gb|KHG19069.1|  Dolichol kinase                                         197   5e-56   Gossypium arboreum [tree cotton]
gb|EEC72462.1|  hypothetical protein OsI_05811                          195   1e-52   Oryza sativa Indica Group [Indian rice]
gb|EEE56282.1|  hypothetical protein OsJ_05340                          189   6e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006419076.1|  hypothetical protein EUTSA_v10002461mg             180   2e-49   
ref|XP_007150159.1|  hypothetical protein PHAVU_005G1319000g            158   3e-41   Phaseolus vulgaris [French bean]
ref|XP_007150160.1|  hypothetical protein PHAVU_005G1319000g            156   1e-40   Phaseolus vulgaris [French bean]
gb|EEE56294.1|  hypothetical protein OsJ_05365                          152   5e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008463185.1|  PREDICTED: dolichol kinase isoform X2              134   1e-32   Cucumis melo [Oriental melon]
gb|KEH39387.1|  phosphatidate cytidylyltransferase family protein       131   1e-31   Medicago truncatula
ref|XP_010322411.1|  PREDICTED: dolichol kinase isoform X2              129   5e-31   Solanum lycopersicum
ref|XP_011004788.1|  PREDICTED: dolichol kinase isoform X2              129   8e-31   Populus euphratica
gb|KJB20357.1|  hypothetical protein B456_003G144600                    124   2e-29   Gossypium raimondii
gb|EYU36157.1|  hypothetical protein MIMGU_mgv1a005517mg                121   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_001762080.1|  predicted protein                                  119   5e-27   
gb|KIM39990.1|  hypothetical protein M413DRAFT_446890                 98.6    4e-20   Hebeloma cylindrosporum h7
dbj|GAM28688.1|  hypothetical protein SAMD00019534_118640             94.7    7e-20   Acytostelium subglobosum LB1
ref|XP_007765981.1|  hypothetical protein CONPUDRAFT_119896           98.6    1e-19   Coniophora puteana RWD-64-598 SS2
ref|XP_005096549.1|  PREDICTED: dolichol kinase-like isoform X1       97.4    2e-19   
emb|CEP13489.1|  hypothetical protein                                 97.8    2e-19   Parasitella parasitica
gb|KDQ24532.1|  hypothetical protein PLEOSDRAFT_1113830               97.1    3e-19   Pleurotus ostreatus PC15
gb|KIJ66658.1|  hypothetical protein HYDPIDRAFT_174072                96.7    7e-19   Hydnomerulius pinastri MD-312
ref|XP_009526345.1|  hypothetical protein PHYSODRAFT_504686           93.2    8e-19   Phytophthora sojae
gb|EPB92011.1|  hypothetical protein HMPREF1544_01074                 95.1    1e-18   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_777440.1|  hypothetical protein CNBB0140                       95.9    1e-18   Cryptococcus neoformans var. neoformans B-3501A
gb|KDR78911.1|  hypothetical protein GALMADRAFT_64608                 95.5    1e-18   Galerina marginata CBS 339.88
ref|XP_569044.1|  dolichol kinase                                     95.5    1e-18   Cryptococcus neoformans var. neoformans JEC21
ref|XP_007342961.1|  hypothetical protein AURDEDRAFT_85412            94.7    1e-18   
gb|KIR59719.1|  dolichol kinase                                       95.5    1e-18   Cryptococcus gattii CA1873
gb|KIR46744.1|  dolichol kinase                                       95.5    1e-18   Cryptococcus gattii CA1280
ref|XP_007848358.1|  dolichol kinase                                  95.1    1e-18   
gb|EGN99090.1|  hypothetical protein SERLA73DRAFT_54621               95.5    2e-18   Serpula lacrymans var. lacrymans S7.3
gb|KIR85359.1|  dolichol kinase                                       94.7    2e-18   Cryptococcus gattii VGIV IND107
ref|XP_003965290.1|  PREDICTED: dolichol kinase-like                  93.6    2e-18   Takifugu rubripes [tiger puffer]
ref|XP_007318681.1|  Fph type histidine kinase                        95.1    3e-18   Serpula lacrymans var. lacrymans S7.9
gb|AFR93583.1|  dolichol kinase                                       94.4    3e-18   Cryptococcus neoformans var. grubii H99
ref|XP_009526336.1|  hypothetical protein PHYSODRAFT_501611           91.3    3e-18   Phytophthora sojae
gb|KII89750.1|  hypothetical protein PLICRDRAFT_52914                 94.4    5e-18   Plicaturopsis crispa FD-325 SS-3
emb|CAG12437.1|  unnamed protein product                              92.4    5e-18   Tetraodon nigroviridis
gb|KIR80106.1|  dolichol kinase                                       93.6    6e-18   Cryptococcus gattii EJB2
gb|KIR54076.1|  dolichol kinase                                       93.6    6e-18   Cryptococcus gattii Ru294
ref|XP_003191093.1|  dolichol kinase                                  93.6    6e-18   Cryptococcus gattii WM276
ref|XP_008893767.1|  hypothetical protein PPTG_21066                  90.5    6e-18   Phytophthora parasitica INRA-310
gb|KIK47436.1|  hypothetical protein CY34DRAFT_73979                  93.2    7e-18   Suillus luteus UH-Slu-Lm8-n1
gb|EST08647.1|  tRNA dihydrouridine synthase                          92.8    7e-18   Kalmanozyma brasiliensis GHG001
gb|KIK10099.1|  hypothetical protein K443DRAFT_139137                 93.2    8e-18   Laccaria amethystina LaAM-08-1
ref|XP_007869006.1|  hypothetical protein GLOTRDRAFT_117464           93.6    8e-18   Gloeophyllum trabeum ATCC 11539
ref|XP_009266123.1|  Rho guanine nucleotide exchange factor scd1      93.2    9e-18   Wallemia ichthyophaga EXF-994
ref|XP_002680715.1|  predicted protein                                89.7    1e-17   Naegleria gruberi strain NEG-M
ref|XP_002470509.1|  hypothetical histidine kinase                    93.2    1e-17   
ref|XP_007393395.1|  hypothetical protein PHACADRAFT_159124           93.2    1e-17   Phanerochaete carnosa HHB-10118-sp
gb|ABQ22586.1|  transmembrane protein 15-like protein                 87.8    1e-17   Callithrix jacchus [common marmoset]
ref|XP_006459296.1|  Tco6 SGD histidine kinase sensor protein         92.8    1e-17   Agaricus bisporus var. bisporus H97
ref|XP_007330370.1|  Tco6 SGD-HK type GAF domain related HK           92.8    1e-17   Agaricus bisporus var. burnettii JB137-S8
ref|XP_007007861.1|  hypothetical protein TREMEDRAFT_74797            92.4    1e-17   Tremella mesenterica DSM 1558
gb|KIJ52540.1|  hypothetical protein M422DRAFT_43384                  92.4    2e-17   Sphaerobolus stellatus SS14
gb|KIM84287.1|  hypothetical protein PILCRDRAFT_87687                 91.3    2e-17   Piloderma croceum F 1598
gb|KIY64571.1|  hypothetical protein CYLTODRAFT_90406                 91.7    2e-17   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_009014801.1|  hypothetical protein HELRODRAFT_76716            87.4    2e-17   Helobdella robusta
ref|XP_010899421.1|  PREDICTED: dolichol kinase                       90.9    2e-17   Esox lucius
ref|XP_004671842.1|  PREDICTED: dolichol kinase                       90.9    2e-17   Jaculus jaculus
gb|ABQ22725.1|  transmembrane protein 15-like protein                 87.0    3e-17   Callithrix jacchus [common marmoset]
ref|XP_007263024.1|  hypothetical protein FOMMEDRAFT_117686           91.3    3e-17   Fomitiporia mediterranea MF3/22
gb|ETP15210.1|  hypothetical protein F441_09951                       90.9    3e-17   Phytophthora parasitica CJ01A1
gb|ETK85356.1|  hypothetical protein L915_09801                       90.9    3e-17   Phytophthora parasitica
gb|ETP43290.1|  hypothetical protein F442_09905                       90.9    3e-17   Phytophthora parasitica P10297
gb|ETO74044.1|  hypothetical protein F444_10097                       90.9    3e-17   Phytophthora parasitica P1976
gb|ETL91903.1|  hypothetical protein L917_09629                       90.9    3e-17   Phytophthora parasitica
gb|ETI45409.1|  hypothetical protein F443_10005                       90.9    3e-17   Phytophthora parasitica P1569
gb|EMD34151.1|  hypothetical protein CERSUDRAFT_117640                91.3    3e-17   Gelatoporia subvermispora B
emb|CBQ69732.1|  conserved hypothetical protein                       91.7    3e-17   Sporisorium reilianum SRZ2
gb|EFA86315.1|  hypothetical protein PPL_00105                        90.1    4e-17   Heterostelium album PN500
ref|NP_055723.1|  dolichol kinase                                     90.1    4e-17   Homo sapiens [man]
gb|EJU04762.1|  hypothetical protein DACRYDRAFT_47116                 90.5    4e-17   Dacryopinax primogenitus
gb|KIP08064.1|  hypothetical protein PHLGIDRAFT_70027                 91.3    4e-17   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_004048758.1|  PREDICTED: dolichol kinase                       90.1    4e-17   
ref|XP_009243213.1|  PREDICTED: dolichol kinase                       90.1    4e-17   Pongo abelii [orang utan]
dbj|BAA83046.2|  KIAA1094 protein                                     90.1    4e-17   
gb|KIK62538.1|  hypothetical protein GYMLUDRAFT_242694                90.5    5e-17   Gymnopus luxurians FD-317 M1
ref|XP_003726510.1|  PREDICTED: dolichol kinase-like                  86.7    5e-17   
gb|KIM54348.1|  hypothetical protein SCLCIDRAFT_1222049               90.5    6e-17   Scleroderma citrinum Foug A
ref|XP_003264273.1|  PREDICTED: dolichol kinase                       89.7    6e-17   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_002907865.1|  dolichol kinase, putative                        87.4    6e-17   Phytophthora infestans T30-4
ref|NP_001086008.1|  dolichol kinase                                  89.0    8e-17   Xenopus laevis [clawed frog]
ref|NP_001103954.1|  dolichol kinase                                  89.0    9e-17   Danio rerio [leopard danio]
ref|XP_002911424.1|  dolichol kinase                                  89.7    1e-16   Coprinopsis cinerea okayama7#130
ref|XP_010738697.1|  PREDICTED: dolichol kinase                       89.0    1e-16   Larimichthys crocea [croceine croaker]
emb|CDS08742.1|  hypothetical protein LRAMOSA10103                    89.4    1e-16   Lichtheimia ramosa
ref|XP_008489660.1|  PREDICTED: dolichol kinase                       89.0    1e-16   
gb|KFO99048.1|  Dolichol kinase                                       89.0    1e-16   Calypte anna
ref|XP_002110921.1|  hypothetical protein TRIADDRAFT_54357            88.6    1e-16   Trichoplax adhaerens
ref|NP_001172797.1|  Os02g0142250                                     81.6    1e-16   
ref|XP_006817759.1|  PREDICTED: dolichol kinase-like                  85.9    1e-16   Saccoglossus kowalevskii
gb|KDN39447.1|  hypothetical protein K437DRAFT_239479                 89.4    1e-16   Tilletiaria anomala UBC 951
dbj|GAC98366.1|  tRNA dihydrouridine synthase                         89.4    2e-16   Pseudozyma hubeiensis SY62
ref|XP_006272364.1|  PREDICTED: dolichol kinase                       88.2    2e-16   Alligator mississippiensis
ref|XP_005982749.1|  PREDICTED: dolichol kinase                       88.2    2e-16   
ref|XP_011391647.1|  hypothetical protein UMAG_04779                  89.0    2e-16   Ustilago maydis 521
ref|NP_808316.1|  dolichol kinase                                     88.2    2e-16   Mus musculus [mouse]
ref|XP_638216.1|  hypothetical protein DDB_G0285689                   88.2    2e-16   Dictyostelium discoideum AX4
ref|XP_007527131.1|  PREDICTED: dolichol kinase                       88.2    2e-16   Erinaceus europaeus [common hedgehog]
ref|XP_004879784.1|  PREDICTED: dolichol kinase                       87.8    2e-16   
ref|XP_004713321.1|  PREDICTED: dolichol kinase                       87.8    2e-16   Echinops telfairi [lesser hedgehog tenrec]
dbj|GAN04081.1|  diacylglycerol o-acyltransferase                     89.0    2e-16   Mucor ambiguus
ref|XP_002935551.1|  PREDICTED: dolichol kinase isoform X1            87.8    2e-16   Xenopus tropicalis [western clawed frog]
gb|ACA57898.1|  transmembrane protein 15 (predicted)                  87.8    2e-16   Plecturocebus moloch [Dusky titi]
ref|XP_008577675.1|  PREDICTED: dolichol kinase                       87.8    2e-16   Galeopterus variegatus [Malayan flying lemur]
ref|XP_001928954.1|  PREDICTED: dolichol kinase                       87.8    3e-16   Sus scrofa [pigs]
ref|XP_004332137.1|  PREDICTED: LOW QUALITY PROTEIN: dolichol kinase  87.8    3e-16   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004269170.1|  PREDICTED: dolichol kinase                       87.8    3e-16   Orcinus orca [Orca]
ref|XP_003794961.1|  PREDICTED: dolichol kinase                       87.8    3e-16   Otolemur garnettii
ref|XP_010349052.1|  PREDICTED: dolichol kinase                       87.8    3e-16   Saimiri boliviensis boliviensis
gb|KIJ14276.1|  hypothetical protein PAXINDRAFT_135282                88.2    3e-16   Paxillus involutus ATCC 200175
ref|XP_006181973.1|  PREDICTED: dolichol kinase                       87.8    3e-16   Camelus ferus
ref|XP_006205500.1|  PREDICTED: dolichol kinase                       87.8    3e-16   Vicugna pacos
gb|ABY84169.1|  transmembrane protein 15 (predicted)                  87.8    3e-16   Callithrix jacchus [common marmoset]
ref|XP_003514016.1|  PREDICTED: dolichol kinase                       87.8    3e-16   Cricetulus griseus [Chinese hamsters]
emb|CDH60498.1|  peptide chain release factor 1                       88.6    3e-16   Lichtheimia corymbifera JMRC:FSU:9682
ref|NP_001270562.1|  uncharacterized protein LOC101925965             87.8    3e-16   Macaca fascicularis [crab eating macaque]
ref|NP_001162452.1|  dolichol kinase                                  87.8    3e-16   Papio anubis [baboon]
ref|XP_010359211.1|  PREDICTED: dolichol kinase                       87.8    3e-16   
ref|XP_005687279.1|  PREDICTED: dolichol kinase                       87.8    3e-16   Capra hircus [domestic goat]
ref|NP_001030442.2|  dolichol kinase                                  87.4    3e-16   Bos taurus [bovine]
ref|XP_007103846.1|  PREDICTED: dolichol kinase                       87.4    3e-16   
ref|XP_004005635.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Ovis aries [domestic sheep]
ref|NP_001101296.1|  dolichol kinase                                  87.4    3e-16   Rattus norvegicus [brown rat]
ref|XP_008039045.1|  hypothetical protein TRAVEDRAFT_21010            87.8    3e-16   Trametes versicolor FP-101664 SS1
ref|XP_005085543.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007471862.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Lipotes vexillifer [baiji]
ref|XP_005346195.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Microtus ochrogaster [prairie voles]
ref|XP_007942437.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Orycteropus afer afer
ref|XP_007256629.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Astyanax mexicanus [blind cave fish]
ref|XP_008046802.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Carlito syrichta
ref|XP_007194596.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Balaenoptera acutorostrata scammoni
ref|XP_006918105.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Pteropus alecto
ref|XP_008824325.1|  PREDICTED: dolichol kinase                       87.4    3e-16   Nannospalax galili
ref|XP_004463151.1|  PREDICTED: dolichol kinase                       87.4    4e-16   Dasypus novemcinctus
ref|XP_006024405.1|  PREDICTED: dolichol kinase                       87.4    4e-16   Alligator sinensis
ref|XP_006172139.1|  PREDICTED: LOW QUALITY PROTEIN: dolichol kinase  87.4    4e-16   Tupaia chinensis
ref|XP_003738877.1|  PREDICTED: dolichol kinase-like                  84.3    4e-16   
ref|XP_009072581.1|  PREDICTED: dolichol kinase                       87.0    4e-16   Acanthisitta chloris
ref|XP_004423608.1|  PREDICTED: dolichol kinase                       87.0    4e-16   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KFP79949.1|  Dolichol kinase                                       87.0    4e-16   Acanthisitta chloris
ref|XP_004677320.1|  PREDICTED: dolichol kinase                       87.0    4e-16   Condylura cristata
ref|XP_004640527.1|  PREDICTED: dolichol kinase                       87.0    4e-16   Octodon degus
ref|XP_011362452.1|  PREDICTED: dolichol kinase                       87.0    4e-16   Pteropus vampyrus
ref|XP_005413657.1|  PREDICTED: dolichol kinase                       87.0    4e-16   Chinchilla lanigera
ref|XP_010227041.1|  PREDICTED: dolichol kinase                       87.0    4e-16   Tinamus guttatus
gb|KGL72442.1|  Dolichol kinase                                       87.0    5e-16   Tinamus guttatus
gb|ACC64536.1|  transmembrane protein 15 (predicted)                  87.0    5e-16   Rhinolophus ferrumequinum
ref|XP_009048761.1|  hypothetical protein LOTGIDRAFT_96453            83.6    5e-16   Lottia gigantea
ref|XP_010625639.1|  PREDICTED: dolichol kinase                       86.7    5e-16   Fukomys damarensis [Damara mole rat]
gb|KDQ19948.1|  hypothetical protein BOTBODRAFT_101902                87.0    5e-16   Botryobasidium botryosum FD-172 SS1
ref|XP_009683324.1|  PREDICTED: dolichol kinase                       86.7    5e-16   Struthio camelus australis
gb|KFH63327.1|  hypothetical protein MVEG_10737                       87.8    5e-16   Mortierella verticillata NRRL 6337
gb|KFV86493.1|  Dolichol kinase                                       86.7    5e-16   Struthio camelus australis
dbj|GAK66682.1|  dolichol kinase                                      87.8    6e-16   Moesziomyces antarcticus
gb|ENN71694.1|  hypothetical protein YQE_11617                        86.3    6e-16   Dendroctonus ponderosae
ref|XP_004375794.1|  PREDICTED: dolichol kinase-like                  86.7    6e-16   Trichechus manatus latirostris
ref|XP_009997212.1|  PREDICTED: dolichol kinase                       86.7    6e-16   Chaetura pelagica
gb|ETS60555.1|  dolichol kinase                                       87.4    6e-16   Moesziomyces aphidis DSM 70725
gb|KFU90632.1|  Dolichol kinase                                       86.7    7e-16   Chaetura pelagica
gb|EMS26024.1|  dolichol kinase                                       87.4    7e-16   Rhodotorula toruloides NP11
gb|KFV12449.1|  Dolichol kinase                                       86.3    7e-16   Tauraco erythrolophus
ref|XP_009979310.1|  PREDICTED: dolichol kinase                       86.3    7e-16   Tauraco erythrolophus
emb|CEL55447.1|  dolichol kinase                                      87.0    7e-16   Rhizoctonia solani AG-1 IB
ref|XP_006983477.1|  PREDICTED: dolichol kinase                       86.3    8e-16   Peromyscus maniculatus bairdii
emb|CEG70575.1|  hypothetical protein RMATCC62417_06445               83.6    9e-16   Rhizopus microsporus
gb|KFP48339.1|  Dolichol kinase                                       84.0    9e-16   Cathartes aura
dbj|GAC77454.1|  dolichol kinase                                      87.0    9e-16   Moesziomyces antarcticus T-34
ref|XP_009946997.1|  PREDICTED: dolichol kinase                       85.9    1e-15   Leptosomus discolor
gb|KFQ08886.1|  Dolichol kinase                                       85.9    1e-15   Leptosomus discolor
ref|XP_002915243.1|  PREDICTED: dolichol kinase                       85.9    1e-15   Ailuropoda melanoleuca
ref|XP_003211316.1|  PREDICTED: dolichol kinase                       85.9    1e-15   Meleagris gallopavo [common turkey]
ref|XP_008696923.1|  PREDICTED: dolichol kinase                       85.9    1e-15   Ursus maritimus [white bear]
gb|EJT53062.1|  dolichol kinase                                       82.0    1e-15   Trichosporon asahii var. asahii CBS 2479
gb|KIK28799.1|  hypothetical protein PISMIDRAFT_673000                86.3    1e-15   Pisolithus microcarpus 441
ref|XP_007388992.1|  hypothetical protein PUNSTDRAFT_139242           86.7    1e-15   Punctularia strigosozonata HHB-11173 SS5
ref|XP_005013337.1|  PREDICTED: dolichol kinase                       85.5    1e-15   
emb|CDO74563.1|  hypothetical protein BN946_scf184931.g2              83.6    1e-15   Trametes cinnabarina
ref|XP_002092187.1|  GE14052                                          85.5    1e-15   Drosophila yakuba
ref|XP_003996006.1|  PREDICTED: dolichol kinase                       85.5    1e-15   Felis catus [cat]
ref|XP_009886319.1|  PREDICTED: dolichol kinase                       85.5    1e-15   Charadrius vociferus
gb|KFO06682.1|  Dolichol kinase                                       85.5    1e-15   Balearica regulorum gibbericeps
gb|KGL95754.1|  Dolichol kinase                                       85.5    1e-15   Charadrius vociferus
emb|CEI92924.1|  hypothetical protein RMCBS344292_07169               83.2    1e-15   Rhizopus microsporus
ref|XP_010300227.1|  PREDICTED: dolichol kinase                       85.5    2e-15   Balearica regulorum gibbericeps
ref|XP_003470665.1|  PREDICTED: dolichol kinase                       85.5    2e-15   Cavia porcellus [guinea pig]
gb|EUC64773.1|  dolichol kinase, putative                             86.3    2e-15   Rhizoctonia solani AG-3 Rhs1AP
gb|KFZ60197.1|  Dolichol kinase                                       85.5    2e-15   Antrostomus carolinensis
ref|XP_007299440.1|  hypothetical protein STEHIDRAFT_72672            85.9    2e-15   Stereum hirsutum FP-91666 SS1
ref|XP_010168346.1|  PREDICTED: dolichol kinase                       85.1    2e-15   Antrostomus carolinensis
emb|CCF49241.1|  uncharacterized protein UHOR_07636                   86.3    2e-15   
gb|KFQ92937.1|  Dolichol kinase                                       85.1    2e-15   
ref|XP_004392552.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
gb|KDQ57239.1|  hypothetical protein JAAARDRAFT_47842                 86.7    2e-15   
gb|ERL87225.1|  hypothetical protein D910_04623                       86.3    2e-15   
ref|XP_009475211.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_006749043.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
gb|KFV17103.1|  Dolichol kinase                                       85.1    2e-15   
ref|XP_006768553.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_004757201.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_010083868.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_002723922.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_006834912.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_001500302.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_003407704.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_003642334.1|  PREDICTED: dolichol kinase-like isoform X1       85.1    2e-15   
ref|XP_008518264.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
ref|XP_002034152.1|  GM20049                                          84.7    2e-15   
gb|KFQ29783.1|  Dolichol kinase                                       84.7    2e-15   
ref|XP_537820.2|  PREDICTED: dolichol kinase                          85.1    2e-15   
ref|XP_008938659.1|  PREDICTED: dolichol kinase                       84.3    2e-15   
ref|XP_010121662.1|  PREDICTED: dolichol kinase                       84.7    2e-15   
ref|NP_001264588.1|  dolichol kinase                                  84.7    2e-15   
emb|CCA18022.1|  dolichol kinase putative                             84.7    2e-15   
ref|XP_006103232.1|  PREDICTED: dolichol kinase                       85.1    2e-15   
gb|KFP43360.1|  Dolichol kinase                                       84.7    2e-15   
gb|KFO82452.1|  Dolichol kinase                                       84.7    3e-15   
ref|XP_008150763.1|  PREDICTED: dolichol kinase                       84.7    3e-15   
ref|XP_009567751.1|  PREDICTED: dolichol kinase                       84.7    3e-15   
ref|XP_001517971.2|  PREDICTED: dolichol kinase                       84.3    3e-15   
ref|XP_001960648.1|  GF13462                                          84.3    3e-15   
gb|EXX70631.1|  Sec59p                                                84.0    3e-15   
ref|XP_009894487.1|  PREDICTED: dolichol kinase                       84.3    3e-15   
ref|XP_005321117.1|  PREDICTED: dolichol kinase                       84.3    3e-15   
ref|XP_004359632.1|  hypothetical protein DFA_01668                   84.7    3e-15   
ref|XP_003032320.1|  hypothetical protein SCHCODRAFT_257244           85.1    3e-15   
gb|KIO23287.1|  hypothetical protein M407DRAFT_78256                  84.3    3e-15   
gb|ESA19749.1|  hypothetical protein GLOINDRAFT_343963                84.7    3e-15   
gb|KFV64093.1|  Dolichol kinase                                       84.3    4e-15   
gb|KIY51824.1|  hypothetical protein FISHEDRAFT_36430                 84.7    4e-15   
ref|XP_005234069.1|  PREDICTED: dolichol kinase                       84.3    4e-15   
ref|XP_010145712.1|  PREDICTED: dolichol kinase                       84.3    4e-15   
gb|KFV91560.1|  Dolichol kinase                                       84.3    4e-15   
gb|KDN50429.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...  84.7    4e-15   
ref|XP_011207952.1|  PREDICTED: dolichol kinase isoform X1            84.0    4e-15   
ref|XP_005490642.1|  PREDICTED: dolichol kinase isoform X1            84.0    4e-15   
ref|XP_004593560.1|  PREDICTED: dolichol kinase                       84.0    4e-15   
ref|XP_011207982.1|  PREDICTED: dolichol kinase isoform X3            83.6    5e-15   
ref|XP_011194557.1|  PREDICTED: dolichol kinase                       84.0    5e-15   
gb|KFO65628.1|  Dolichol kinase                                       84.0    5e-15   
ref|XP_005421358.1|  PREDICTED: dolichol kinase                       84.0    5e-15   
gb|KFZ51837.1|  Dolichol kinase                                       84.0    5e-15   
gb|KFP09092.1|  Dolichol kinase                                       84.0    5e-15   
ref|XP_002194897.1|  PREDICTED: dolichol kinase                       84.0    5e-15   
ref|XP_007362376.1|  hypothetical protein DICSQDRAFT_133331           84.3    5e-15   
ref|XP_011207967.1|  PREDICTED: dolichol kinase isoform X2            83.6    5e-15   
ref|XP_008640461.1|  PREDICTED: dolichol kinase                       84.0    5e-15   
gb|KFM12718.1|  Dolichol kinase                                       84.0    5e-15   
ref|XP_009285181.1|  PREDICTED: dolichol kinase                       84.0    5e-15   
emb|CEG79021.1|  hypothetical protein RMATCC62417_13542               84.0    5e-15   
ref|XP_009632909.1|  PREDICTED: dolichol kinase                       83.6    6e-15   
gb|KFW65844.1|  Dolichol kinase                                       83.6    6e-15   
ref|XP_008917661.1|  PREDICTED: dolichol kinase                       83.6    6e-15   
ref|XP_009320377.1|  PREDICTED: dolichol kinase                       83.6    6e-15   
gb|KFW95674.1|  Dolichol kinase                                       83.6    6e-15   
ref|XP_009512918.1|  PREDICTED: dolichol kinase                       83.6    6e-15   
gb|EPY49806.1|  dolichol kinase                                       83.6    6e-15   
gb|KFQ79547.1|  Dolichol kinase                                       83.6    6e-15   
gb|KFQ39944.1|  Dolichol kinase                                       83.6    6e-15   
emb|CEG79020.1|  hypothetical protein RMATCC62417_13542               84.0    6e-15   
gb|KFW77263.1|  Dolichol kinase                                       83.6    6e-15   
ref|XP_010189271.1|  PREDICTED: dolichol kinase                       83.6    6e-15   
gb|EGU12693.1|  Dolichol kinase                                       84.3    6e-15   
ref|NP_611139.1|  CG8311                                              83.6    7e-15   
gb|KFV41430.1|  Dolichol kinase                                       83.6    7e-15   
ref|XP_010396015.1|  PREDICTED: dolichol kinase                       83.6    7e-15   
ref|XP_009871537.1|  PREDICTED: dolichol kinase                       83.6    7e-15   
ref|XP_009806762.1|  PREDICTED: dolichol kinase                       83.6    7e-15   
ref|XP_005646435.1|  hypothetical protein COCSUDRAFT_56338            82.8    7e-15   
ref|XP_005527307.1|  PREDICTED: dolichol kinase                       83.2    7e-15   
ref|XP_004613333.1|  PREDICTED: dolichol kinase                       83.6    7e-15   
ref|XP_005183383.1|  PREDICTED: dolichol kinase                       83.2    7e-15   
gb|KFP77854.1|  Dolichol kinase                                       83.2    7e-15   
ref|XP_005055591.1|  PREDICTED: dolichol kinase isoform X1            83.2    8e-15   
gb|ACH92163.1|  FI02089p                                              83.2    8e-15   
ref|XP_001975334.1|  GG22259                                          83.2    8e-15   
ref|XP_006892667.1|  PREDICTED: dolichol kinase                       83.2    8e-15   
gb|KFP30155.1|  Dolichol kinase                                       83.2    8e-15   
ref|XP_010196306.1|  PREDICTED: dolichol kinase                       83.2    8e-15   
ref|XP_009574369.1|  PREDICTED: dolichol kinase                       83.2    8e-15   
gb|KFQ47840.1|  Dolichol kinase                                       83.2    9e-15   
ref|XP_002081797.1|  GD25530                                          83.2    9e-15   
gb|KFP67270.1|  Dolichol kinase                                       83.2    9e-15   
ref|XP_010011015.1|  PREDICTED: dolichol kinase                       83.2    9e-15   
ref|XP_009703042.1|  PREDICTED: dolichol kinase                       83.2    9e-15   
ref|XP_009091698.1|  PREDICTED: dolichol kinase                       83.2    9e-15   
gb|KFQ67072.1|  Dolichol kinase                                       83.2    1e-14   
gb|KIK96459.1|  hypothetical protein PAXRUDRAFT_32371                 83.6    1e-14   
ref|XP_010283955.1|  PREDICTED: dolichol kinase                       82.8    1e-14   
ref|XP_005146276.1|  PREDICTED: dolichol kinase                       82.8    1e-14   
gb|KFQ01821.1|  Dolichol kinase                                       82.8    1e-14   
ref|XP_009914539.1|  PREDICTED: dolichol kinase                       82.8    1e-14   
ref|XP_009965779.1|  PREDICTED: dolichol kinase                       82.8    1e-14   
emb|CCJ30155.1|  unnamed protein product                              79.3    1e-14   
gb|KIM33265.1|  hypothetical protein M408DRAFT_326045                 83.2    1e-14   
gb|KFV39805.1|  Dolichol kinase                                       82.4    1e-14   
ref|XP_009545176.1|  hypothetical protein HETIRDRAFT_444487           83.6    1e-14   
ref|XP_006640721.1|  PREDICTED: dolichol kinase-like                  82.4    2e-14   
ref|NP_587983.3|  dolichol kinase Sec59 (predicted)                   82.0    2e-14   
ref|XP_009488741.1|  PREDICTED: dolichol kinase                       82.4    2e-14   
ref|XP_003285404.1|  hypothetical protein DICPUDRAFT_29220            82.8    2e-14   
ref|XP_005881591.1|  PREDICTED: dolichol kinase                       82.0    2e-14   
gb|EPX72024.1|  dolichol kinase                                       82.0    2e-14   
gb|KFQ57659.1|  Dolichol kinase                                       82.0    2e-14   
gb|EPQ17153.1|  Dolichol kinase                                       82.0    2e-14   
ref|XP_009001986.1|  PREDICTED: dolichol kinase                       82.0    2e-14   
gb|KDE02871.1|  hypothetical protein MVLG_06590                       82.4    3e-14   
gb|KIO14711.1|  hypothetical protein M404DRAFT_991457                 82.4    3e-14   
ref|XP_007880038.1|  hypothetical protein PFL1_04321                  82.4    3e-14   
ref|XP_005514020.1|  PREDICTED: dolichol kinase                       81.6    3e-14   
ref|XP_008421906.1|  PREDICTED: dolichol kinase                       81.3    3e-14   
ref|XP_001368167.3|  PREDICTED: dolichol kinase                       81.3    4e-14   
gb|ETE64017.1|  Dolichol kinase                                       81.3    4e-14   
ref|XP_005791150.1|  hypothetical protein EMIHUDRAFT_122165           80.9    4e-14   
ref|XP_007900954.1|  PREDICTED: dolichol kinase                       80.9    5e-14   
ref|XP_002062803.1|  GK19504                                          80.9    5e-14   
gb|KFQ99359.1|  Dolichol kinase                                       80.9    5e-14   
ref|XP_009932747.1|  PREDICTED: dolichol kinase                       80.9    5e-14   
ref|XP_002005443.1|  GI19069                                          80.5    6e-14   
ref|XP_006119115.1|  PREDICTED: dolichol kinase                       80.5    6e-14   
ref|XP_005757780.1|  hypothetical protein EMIHUDRAFT_97251            80.9    7e-14   
ref|XP_011396931.1|  Dolichol kinase sec59                            80.1    8e-14   
gb|ETP43291.1|  hypothetical protein, variant                         79.7    1e-13   
gb|ETL91904.1|  hypothetical protein, variant                         79.7    1e-13   
gb|ETI45410.1|  hypothetical protein, variant                         79.7    1e-13   
gb|ETK85357.1|  hypothetical protein, variant                         79.7    1e-13   
gb|ETO74045.1|  hypothetical protein, variant                         79.7    1e-13   
ref|XP_003230543.1|  PREDICTED: dolichol kinase                       79.7    1e-13   
ref|XP_010138950.1|  PREDICTED: dolichol kinase                       79.7    1e-13   
gb|KFO85028.1|  Dolichol kinase                                       79.3    1e-13   
gb|KJA26371.1|  hypothetical protein HYPSUDRAFT_52649                 80.5    2e-13   
ref|XP_004526356.1|  PREDICTED: dolichol kinase-like                  79.3    2e-13   
ref|XP_008324047.1|  PREDICTED: dolichol kinase                       79.3    2e-13   
emb|CCU98277.1|  unnamed protein product                              79.7    2e-13   
gb|ETO17898.1|  hypothetical protein RFI_19407                        79.0    2e-13   
ref|XP_007433424.1|  PREDICTED: dolichol kinase                       79.0    2e-13   
ref|XP_005798724.1|  PREDICTED: dolichol kinase-like                  78.6    3e-13   
ref|XP_008287549.1|  PREDICTED: dolichol kinase                       78.6    3e-13   
ref|XP_003757437.1|  PREDICTED: dolichol kinase                       78.2    3e-13   
ref|XP_007061140.1|  PREDICTED: dolichol kinase                       78.2    4e-13   
ref|XP_002402441.1|  transmembrane protein, putative                  78.2    4e-13   
ref|XP_007078881.1|  PREDICTED: dolichol kinase                       77.8    6e-13   
emb|CCI46238.1|  unnamed protein product                              77.4    6e-13   
ref|XP_004353180.1|  phosphatidate cytidylyltransferase               77.4    6e-13   
ref|XP_005293444.1|  PREDICTED: dolichol kinase                       77.4    6e-13   
emb|CCI46237.1|  unnamed protein product                              77.4    7e-13   
ref|XP_007571604.1|  PREDICTED: dolichol kinase                       77.4    7e-13   
ref|XP_007872832.1|  hypothetical protein PNEG_00920                  77.4    7e-13   
ref|XP_001986122.1|  GH20708                                          77.4    7e-13   
emb|CCI46236.1|  unnamed protein product                              77.4    8e-13   
gb|EPT01357.1|  hypothetical protein FOMPIDRAFT_1036293               78.2    8e-13   
ref|XP_004074602.1|  PREDICTED: dolichol kinase isoform X2            77.0    8e-13   
gb|KDO28265.1|  hypothetical protein SPRG_06315                       77.0    9e-13   
ref|XP_010778781.1|  PREDICTED: dolichol kinase                       77.0    9e-13   
ref|XP_011479852.1|  PREDICTED: dolichol kinase isoform X1            77.0    1e-12   
gb|EGT36204.1|  hypothetical protein CAEBREN_14053                    74.7    2e-12   
ref|XP_005456247.1|  PREDICTED: dolichol kinase-like                  76.3    2e-12   
gb|EWM24180.1|  dolichol kinase                                       76.3    2e-12   
ref|XP_004549836.1|  PREDICTED: dolichol kinase-like                  76.3    2e-12   
ref|XP_005720313.1|  PREDICTED: dolichol kinase-like                  76.3    2e-12   
ref|XP_006796837.1|  PREDICTED: dolichol kinase-like                  76.3    2e-12   
gb|EPZ36955.1|  hypothetical protein O9G_001400                       72.4    2e-12   
ref|XP_008605575.1|  hypothetical protein SDRG_01803                  75.9    2e-12   
dbj|GAA93631.1|  hypothetical protein E5Q_00275                       76.6    2e-12   
emb|CDI55809.1|  conserved hypothetical protein                       76.6    2e-12   
gb|KFM83016.1|  Dolichol kinase                                       73.2    2e-12   
ref|XP_011270353.1|  hypothetical protein CAOG_08733                  76.6    3e-12   
ref|XP_002015691.1|  GL11205                                          75.5    3e-12   
gb|EFZ13651.1|  hypothetical protein SINV_14950                       72.0    3e-12   
ref|XP_001360277.1|  GA20976                                          75.5    3e-12   
emb|CCA69351.1|  related to SEC59-dolichol kinase                     75.9    4e-12   
ref|XP_002499601.1|  predicted protein                                75.1    4e-12   
ref|XP_011424506.1|  PREDICTED: dolichol kinase-like                  74.3    6e-12   
emb|CCG83481.1|  Dolichol kinase                                      74.3    8e-12   
ref|XP_008482789.1|  PREDICTED: dolichol kinase                       73.6    8e-12   
ref|XP_003058223.1|  predicted protein                                73.6    1e-11   
ref|XP_003701034.1|  PREDICTED: dolichol kinase-like                  73.6    1e-11   
gb|EJY66909.1|  Dolichol kinase                                       73.6    1e-11   
gb|ETN65984.1|  transmembrane protein 15                              73.2    2e-11   
dbj|GAM38345.1|  hypothetical protein TCE0_033r08997                  73.2    2e-11   
ref|XP_001730870.1|  hypothetical protein MGL_1869                    72.8    3e-11   
emb|CBY41498.1|  unnamed protein product                              71.6    3e-11   
emb|CDS25992.1|  dolichol kinase                                      70.5    3e-11   
emb|CBY23790.1|  unnamed protein product                              71.6    3e-11   
ref|XP_007751744.1|  hypothetical protein A1O5_12985                  72.8    4e-11   
emb|CBY38964.1|  unnamed protein product                              71.6    4e-11   
ref|XP_007714101.1|  hypothetical protein COCCADRAFT_100889           72.4    4e-11   
ref|XP_003298931.1|  hypothetical protein PTT_09803                   72.4    4e-11   
dbj|GAM89230.1|  hypothetical protein ANO11243_072670                 70.9    4e-11   
ref|XP_001933052.1|  conserved hypothetical protein                   72.4    4e-11   
gb|EUN27150.1|  hypothetical protein COCVIDRAFT_26511                 72.4    5e-11   
ref|XP_008862800.1|  hypothetical protein H310_01468                  72.0    5e-11   
ref|XP_008862801.1|  hypothetical protein, variant 1                  71.6    5e-11   
ref|XP_011051109.1|  PREDICTED: dolichol kinase                       71.6    5e-11   
gb|EGI67471.1|  Dolichol kinase                                       71.6    5e-11   
gb|KIW94426.1|  hypothetical protein Z519_04402                       72.0    5e-11   
gb|EME39117.1|  hypothetical protein DOTSEDRAFT_75018                 72.0    5e-11   
gb|EJT43713.1|  SEC59-like protein                                    71.6    6e-11   
ref|XP_005538665.1|  hypothetical protein, conserved                  72.0    6e-11   
gb|ENI05710.1|  hypothetical protein COCC4DRAFT_80714                 71.6    7e-11   
ref|XP_007702167.1|  hypothetical protein COCSADRAFT_38997            71.6    8e-11   
gb|EMD91209.1|  hypothetical protein COCHEDRAFT_1225184               71.6    8e-11   
ref|XP_011166670.1|  PREDICTED: dolichol kinase isoform X1            70.9    8e-11   
ref|XP_011166671.1|  PREDICTED: dolichol kinase isoform X2            70.9    8e-11   
gb|KIW01632.1|  hypothetical protein PV09_06819                       71.2    1e-10   
emb|CBK24950.2|  unnamed protein product                              67.0    1e-10   
ref|XP_011140069.1|  PREDICTED: dolichol kinase                       70.5    1e-10   
gb|KIH63675.1|  phosphatidate cytidylyltransferase                    68.2    1e-10   
ref|XP_007681602.1|  hypothetical protein BAUCODRAFT_316743           71.2    1e-10   
ref|XP_002562188.1|  Pc18g03500                                       71.2    1e-10   
ref|XP_003851254.1|  hypothetical protein MYCGRDRAFT_73738            70.9    1e-10   



>gb|KDO60217.1| hypothetical protein CISIN_1g0083641mg, partial [Citrus sinensis]
 gb|KDO60218.1| hypothetical protein CISIN_1g0083641mg, partial [Citrus sinensis]
 gb|KDO60219.1| hypothetical protein CISIN_1g0083641mg, partial [Citrus sinensis]
Length=241

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFM AFTDHRDSDLLIVSHFSLLLGCALPIW+SSGFNDRPLAPFAGILSLGIGD
Sbjct  92   LGQFIHQFMTAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGFNDRPLAPFAGILSLGIGD  151

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYIFT++ FSL+L
Sbjct  152  TMASIVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYIFTEHWFSLIL  211

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+S LLEAYT QLDNAFIPL+FY
Sbjct  212  AVTVSSLLEAYTTQLDNAFIPLIFY  236



>emb|CAN81885.1| hypothetical protein VITISV_021582 [Vitis vinifera]
Length=344

 Score =   244 bits (624),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFMNAFTDHRDS+LL+VSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  195  LGQLVHQFMNAFTDHRDSNLLVVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  254

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVL ACSILLPLLA+TGY  T++  SLLL
Sbjct  255  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLVACSILLPLLASTGYJLTQHWVSLLL  314

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYTAQLDNAFIPL+FY
Sbjct  315  AVTASGLLEAYTAQLDNAFIPLIFY  339



>ref|XP_006424495.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
 gb|ESR37735.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
Length=434

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFM AFTDHRDSDLLIVSHFSLLLGCALPIW+SSGFNDRPLAPFAGILSLGIGD
Sbjct  285  LGQFIHQFMTAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGFNDRPLAPFAGILSLGIGD  344

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYIFT++ FSL+L
Sbjct  345  TMASIVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYIFTEHWFSLIL  404

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+S LLEAYT QLDNAFIPL+FY
Sbjct  405  AVTVSSLLEAYTTQLDNAFIPLIFY  429



>ref|XP_006488035.1| PREDICTED: dolichol kinase-like isoform X2 [Citrus sinensis]
Length=541

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM AFTDHRDSDLLIVSHFSLLLGCALPIW+SSGFNDRPLAPFAGILSLGIGD
Sbjct  392  LGQLIHQFMTAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGFNDRPLAPFAGILSLGIGD  451

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYIFT++ FSL+L
Sbjct  452  TMASIVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYIFTEHWFSLIL  511

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+S LLEAYT QLDNAFIPL+FY
Sbjct  512  AVTVSSLLEAYTTQLDNAFIPLIFY  536



>ref|XP_006488034.1| PREDICTED: dolichol kinase-like isoform X1 [Citrus sinensis]
Length=568

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM AFTDHRDSDLLIVSHFSLLLGCALPIW+SSGFNDRPLAPFAGILSLGIGD
Sbjct  419  LGQLIHQFMTAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGFNDRPLAPFAGILSLGIGD  478

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYIFT++ FSL+L
Sbjct  479  TMASIVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYIFTEHWFSLIL  538

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+S LLEAYT QLDNAFIPL+FY
Sbjct  539  AVTVSSLLEAYTTQLDNAFIPLIFY  563



>emb|CDP07056.1| unnamed protein product [Coffea canephora]
Length=574

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFMNAFTDHRDS++L++SHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD
Sbjct  425  LGQLVHQFMNAFTDHRDSEILVISHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  484

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVL ACS+LLPLLATTGYIF+++ FSLL+
Sbjct  485  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLVACSVLLPLLATTGYIFSQHWFSLLV  544

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYTAQLDNAFIPL+FY
Sbjct  545  AVTTSGLLEAYTAQLDNAFIPLVFY  569



>ref|XP_006424496.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
 gb|ESR37736.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
Length=541

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFM AFTDHRDSDLLIVSHFSLLLGCALPIW+SSGFNDRPLAPFAGILSLGIGD
Sbjct  392  LGQFIHQFMTAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGFNDRPLAPFAGILSLGIGD  451

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYIFT++ FSL+L
Sbjct  452  TMASIVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYIFTEHWFSLIL  511

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+S LLEAYT QLDNAFIPL+FY
Sbjct  512  AVTVSSLLEAYTTQLDNAFIPLIFY  536



>gb|KCW85786.1| hypothetical protein EUGRSUZ_B02538 [Eucalyptus grandis]
Length=461

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LGKL+HQFMNAFTDHRDSDLLIVSHFSLLLGCALP+WLS G+NDRPLAPFAGILSLGIGD
Sbjct  312  LGKLVHQFMNAFTDHRDSDLLIVSHFSLLLGCALPMWLSFGYNDRPLAPFAGILSLGIGD  371

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVL ACS LLPLLA+TGY+ T++ FSLLL
Sbjct  372  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLVACSALLPLLASTGYVMTQHWFSLLL  431

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYTAQLDNAFIPL+FY
Sbjct  432  AVTASGLLEAYTAQLDNAFIPLVFY  456



>ref|XP_006424497.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
 gb|ESR37737.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
Length=568

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFM AFTDHRDSDLLIVSHFSLLLGCALPIW+SSGFNDRPLAPFAGILSLGIGD
Sbjct  419  LGQFIHQFMTAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGFNDRPLAPFAGILSLGIGD  478

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYIFT++ FSL+L
Sbjct  479  TMASIVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYIFTEHWFSLIL  538

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+S LLEAYT QLDNAFIPL+FY
Sbjct  539  AVTVSSLLEAYTTQLDNAFIPLIFY  563



>gb|EPS67268.1| hypothetical protein M569_07507, partial [Genlisea aurea]
Length=181

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFM+AFTDHRDSDLLIVSHFSLLLGCA+PIWLSSG NDRPLAPFAGILSLGIGD
Sbjct  31   LGHLIHQFMSAFTDHRDSDLLIVSHFSLLLGCAIPIWLSSGLNDRPLAPFAGILSLGIGD  90

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFT-KNlfsll  355
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSVLAAC +LLPLLA  GYIFT ++  SL+
Sbjct  91   TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVLAACFVLLPLLAAAGYIFTMQHWSSLI  150

Query  354  lavtlsglLEAYTAQLDNAFIPLMFY  277
            +AV  SGLLEAYTAQLDNAFIPL+FY
Sbjct  151  VAVICSGLLEAYTAQLDNAFIPLVFY  176



>ref|XP_002523693.1| Transmembrane protein, putative [Ricinus communis]
 gb|EEF38633.1| Transmembrane protein, putative [Ricinus communis]
Length=565

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  416  LGQLIHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  475

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSK+GKKTIEGTAAGITSVL ACS+LLP+LA+TGYI T++  SLLL
Sbjct  476  TMASMVGHKYGVLRWSKSGKKTIEGTAAGITSVLVACSVLLPILASTGYILTQHWVSLLL  535

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AV +SG+LEAYTAQLDNAFIPL+FY
Sbjct  536  AVIVSGMLEAYTAQLDNAFIPLVFY  560



>gb|KDP43992.1| hypothetical protein JCGZ_05459 [Jatropha curcas]
Length=557

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            G+L+HQFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGDT
Sbjct  409  GQLIHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGDT  468

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfsllla  349
            MAS+VGHKYGVLRWSKTGKKTIEGTAAGITSV+AACS LLPLLA+TGYI +++  SLLLA
Sbjct  469  MASMVGHKYGVLRWSKTGKKTIEGTAAGITSVMAACSFLLPLLASTGYILSQHWVSLLLA  528

Query  348  vtlsglLEAYTAQLDNAFIPLMFY  277
            V +SGLLEAYTAQLDNAFIPL+FY
Sbjct  529  VIVSGLLEAYTAQLDNAFIPLVFY  552



>ref|XP_002273662.1| PREDICTED: dolichol kinase [Vitis vinifera]
 emb|CBI17166.3| unnamed protein product [Vitis vinifera]
Length=564

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFMNAFTDHRDS+LL+VSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  415  LGQLVHQFMNAFTDHRDSNLLVVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  474

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVL ACSILLPLLA+TGYI T++  SLLL
Sbjct  475  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLVACSILLPLLASTGYILTQHWVSLLL  534

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYTAQLDNAFIPL+FY
Sbjct  535  AVTASGLLEAYTAQLDNAFIPLIFY  559



>ref|XP_011090038.1| PREDICTED: dolichol kinase [Sesamum indicum]
Length=559

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGF DRPLAPFAGILSLGIGD
Sbjct  410  LGHLVHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFTDRPLAPFAGILSLGIGD  469

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAAC +LLPLLA TGYIFT + FSL++
Sbjct  470  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACFMLLPLLAATGYIFTLHWFSLIV  529

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  530  AVTISGLLEAYTAQLDNAFIPLVFY  554



>gb|KHG05634.1| Dolichol kinase [Gossypium arboreum]
Length=567

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM+AFTDHRDSDL+IVSHFSLLLGCALPIW+SSGFNDRPL PFAGILSLGIGD
Sbjct  418  LGQLVHQFMSAFTDHRDSDLIIVSHFSLLLGCALPIWMSSGFNDRPLTPFAGILSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLATTGY+ T++ F + +
Sbjct  478  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLATTGYVLTQHWFPIFI  537

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYT QLDNAFIPL+FY
Sbjct  538  AVTTSGLLEAYTTQLDNAFIPLVFY  562



>ref|XP_009594141.1| PREDICTED: dolichol kinase isoform X1 [Nicotiana tomentosiformis]
Length=565

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFMNAFTDHRD+DLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD
Sbjct  416  LGHLVHQFMNAFTDHRDTDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  475

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLAT+ YI  +N FSLL 
Sbjct  476  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATSRYILDQNWFSLLF  535

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  536  AVTISGLLEAYTAQLDNAFIPLVFY  560



>ref|XP_009594149.1| PREDICTED: dolichol kinase isoform X2 [Nicotiana tomentosiformis]
Length=564

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFMNAFTDHRD+DLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD
Sbjct  415  LGHLVHQFMNAFTDHRDTDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  474

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLAT+ YI  +N FSLL 
Sbjct  475  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATSRYILDQNWFSLLF  534

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  535  AVTISGLLEAYTAQLDNAFIPLVFY  559



>ref|XP_010043798.1| PREDICTED: dolichol kinase [Eucalyptus grandis]
Length=571

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LGKL+HQFMNAFTDHRDSDLLIVSHFSLLLGCALP+WLS G+NDRPLAPFAGILSLGIGD
Sbjct  422  LGKLVHQFMNAFTDHRDSDLLIVSHFSLLLGCALPMWLSFGYNDRPLAPFAGILSLGIGD  481

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVL ACS LLPLLA+TGY+ T++ FSLLL
Sbjct  482  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLVACSALLPLLASTGYVMTQHWFSLLL  541

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYTAQLDNAFIPL+FY
Sbjct  542  AVTASGLLEAYTAQLDNAFIPLVFY  566



>ref|XP_008226289.1| PREDICTED: dolichol kinase [Prunus mume]
Length=570

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +H+FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPF+GILSLGIGD
Sbjct  421  LGQSIHKFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGYNDRPLAPFSGILSLGIGD  480

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI T++  SLL+
Sbjct  481  TMASVVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYILTEHWGSLLV  540

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  541  AVTVSGLLEAYTAQLDNAFIPLIFY  565



>ref|XP_004487072.1| PREDICTED: dolichol kinase-like [Cicer arietinum]
Length=554

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ ++QFMNAFTDHRDSD LIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  405  LGQPINQFMNAFTDHRDSDFLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  464

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSVLAACS+LLPLLA+TGYIFT++ F+LLL
Sbjct  465  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVLAACSLLLPLLASTGYIFTQHWFTLLL  524

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL FY
Sbjct  525  AVTVSGLLEAYTAQLDNAFIPLFFY  549



>ref|XP_007205002.1| hypothetical protein PRUPE_ppa003568mg [Prunus persica]
 gb|EMJ06201.1| hypothetical protein PRUPE_ppa003568mg [Prunus persica]
Length=565

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +H+FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPF+GILSLGIGD
Sbjct  416  LGQSIHKFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGYNDRPLAPFSGILSLGIGD  475

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI T++  SLL+
Sbjct  476  TMASVVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYILTEHWGSLLV  535

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  536  AVTVSGLLEAYTAQLDNAFIPLIFY  560



>ref|XP_003638051.1| Dolichol kinase [Medicago truncatula]
 gb|KEH39386.1| phosphatidate cytidylyltransferase family protein [Medicago truncatula]
Length=554

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            G+ ++QFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGDT
Sbjct  406  GQPINQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGDT  465

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfsllla  349
            MAS+VGHKYGVLRWSKTGKKT+EGTAAGITSVLAACS+LLPL+A+TGYIFT++ FSL LA
Sbjct  466  MASMVGHKYGVLRWSKTGKKTVEGTAAGITSVLAACSLLLPLIASTGYIFTQHWFSLFLA  525

Query  348  vtlsglLEAYTAQLDNAFIPLMFY  277
            VT+SGLLEAYTAQLDNAFIPL FY
Sbjct  526  VTVSGLLEAYTAQLDNAFIPLFFY  549



>ref|XP_007016839.1| Phosphatidate cytidylyltransferase family protein [Theobroma 
cacao]
 gb|EOY34458.1| Phosphatidate cytidylyltransferase family protein [Theobroma 
cacao]
Length=567

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM+AFTDHRDSDLLIVSHFSLLLGCALPIW+SSGFNDRPL PFAG+LSLGIGD
Sbjct  418  LGQLVHQFMSAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGFNDRPLTPFAGVLSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+ GY+ T++ F LL+
Sbjct  478  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASKGYVLTQHWFPLLI  537

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYTAQLDNAFIPL+FY
Sbjct  538  AVTTSGLLEAYTAQLDNAFIPLVFY  562



>ref|XP_004147285.1| PREDICTED: uncharacterized protein LOC101218949 [Cucumis sativus]
 gb|KGN64794.1| hypothetical protein Csa_1G097720 [Cucumis sativus]
Length=567

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  418  LGQPVHQFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPL+A+TGYI T+   SLLL
Sbjct  478  TMASVVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLIASTGYILTERWLSLLL  537

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+F+
Sbjct  538  AVTISGLLEAYTAQLDNAFIPLVFF  562



>ref|XP_004161315.1| PREDICTED: uncharacterized LOC101218949 [Cucumis sativus]
Length=567

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  418  LGQPVHQFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPL+A+TGYI T+   SLLL
Sbjct  478  TMASVVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLIASTGYILTERWLSLLL  537

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+F+
Sbjct  538  AVTISGLLEAYTAQLDNAFIPLVFF  562



>ref|XP_008463178.1| PREDICTED: dolichol kinase isoform X1 [Cucumis melo]
Length=567

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  418  LGQPVHQFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPL+A+TGYI T+   SLLL
Sbjct  478  TMASVVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLIASTGYILTERWLSLLL  537

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+F+
Sbjct  538  AVTISGLLEAYTAQLDNAFIPLVFF  562



>ref|XP_008789547.1| PREDICTED: dolichol kinase-like isoform X1 [Phoenix dactylifera]
Length=568

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  419  LGHLVHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  478

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYI +++  SLLL
Sbjct  479  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYILSQHWLSLLL  538

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  539  AVTVSGLLEAYTAQLDNAFIPLVFY  563



>ref|XP_009408123.1| PREDICTED: dolichol kinase isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFMNAFTDHRDS++LIVSHFSLLLGCALP W+SSG NDRPLAPFAGILSLGIGD
Sbjct  343  LGDIVHQFMNAFTDHRDSEILIVSHFSLLLGCALPKWMSSGLNDRPLAPFAGILSLGIGD  402

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGY+ +++  SLL+
Sbjct  403  TMASVVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYVLSQHWLSLLM  462

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  463  AVTVSGLLEAYTAQLDNAFIPLVFY  487



>ref|XP_009786599.1| PREDICTED: dolichol kinase [Nicotiana sylvestris]
Length=564

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFMNAFTDHRD+DLLIVSHFSLLLGCALPIW SSGF+DRPLAPFAGILSLGIGD
Sbjct  415  LGQLVHQFMNAFTDHRDTDLLIVSHFSLLLGCALPIWFSSGFSDRPLAPFAGILSLGIGD  474

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLAT+ YI  +N FSLL 
Sbjct  475  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATSRYIVDQNWFSLLF  534

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  535  AVTVSGLLEAYTAQLDNAFIPLVFY  559



>ref|XP_004241288.1| PREDICTED: dolichol kinase isoform X1 [Solanum lycopersicum]
Length=561

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 140/145 (97%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFMNAFTDHRD+DLL+VSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD
Sbjct  414  LGQLVHQFMNAFTDHRDTDLLVVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  473

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATT Y+  +N FSLL 
Sbjct  474  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTRYV--QNWFSLLF  531

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  532  AVTISGLLEAYTAQLDNAFIPLVFY  556



>ref|XP_006347198.1| PREDICTED: dolichol kinase-like [Solanum tuberosum]
Length=561

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 140/145 (97%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFMNAFTDHRD+DLL+VSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD
Sbjct  414  LGQLVHQFMNAFTDHRDTDLLVVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  473

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATT Y+  +N FSLL 
Sbjct  474  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTRYV--QNWFSLLF  531

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  532  AVTISGLLEAYTAQLDNAFIPLVFY  556



>gb|KJB20358.1| hypothetical protein B456_003G144600 [Gossypium raimondii]
Length=567

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM+AFTDHRDSDL+IVSHFSLLLGCALPIW+SSGFNDRPL PF+GILSLGIGD
Sbjct  418  LGQLVHQFMSAFTDHRDSDLIIVSHFSLLLGCALPIWMSSGFNDRPLTPFSGILSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGY  T++ F + +
Sbjct  478  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYFLTQHWFPIFI  537

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYT QLDNAFIPL+FY
Sbjct  538  AVTTSGLLEAYTTQLDNAFIPLVFY  562



>ref|XP_010940630.1| PREDICTED: dolichol kinase [Elaeis guineensis]
Length=572

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFM AFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  423  LGHLVHQFMTAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  482

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI +++  SLLL
Sbjct  483  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYILSQHWLSLLL  542

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  543  AVTVSGLLEAYTAQLDNAFIPLVFY  567



>gb|KJB83869.1| hypothetical protein B456_013G268700 [Gossypium raimondii]
Length=545

 Score =   240 bits (613),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM+AFTDHRDSD+LIVSHFSLLLGCALPIW+SSGFNDRPL PFAGILSLGIGD
Sbjct  396  LGQLVHQFMSAFTDHRDSDILIVSHFSLLLGCALPIWMSSGFNDRPLIPFAGILSLGIGD  455

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGI SVLAACSILLPLLA+T YI T++ F LL+
Sbjct  456  TMASMVGHKYGVLRWSKTGKKTIEGTAAGIVSVLAACSILLPLLASTRYIATQHWFPLLI  515

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYTAQLDNAFIPL+FY
Sbjct  516  AVTTSGLLEAYTAQLDNAFIPLVFY  540



>ref|XP_010689112.1| PREDICTED: dolichol kinase [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 137/145 (94%), Gaps = 2/145 (1%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+++H FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSGFNDRPLAPFAGILSLGIGD
Sbjct  413  LGEMIHHFMNAFTDHRDSDLLIVSHFSLLLGCALPIWISSGFNDRPLAPFAGILSLGIGD  472

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSV+AACS LLPLLA+TGYI  +N  SLLL
Sbjct  473  TMASMVGYKYGVLRWSKTGKKTIEGTAAGITSVMAACSFLLPLLASTGYI--QNWTSLLL  530

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AV  SGLLEAYTAQLDNAFIPL+FY
Sbjct  531  AVIASGLLEAYTAQLDNAFIPLVFY  555



>ref|XP_009408122.1| PREDICTED: dolichol kinase isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=573

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFMNAFTDHRDS++LIVSHFSLLLGCALP W+SSG NDRPLAPFAGILSLGIGD
Sbjct  424  LGDIVHQFMNAFTDHRDSEILIVSHFSLLLGCALPKWMSSGLNDRPLAPFAGILSLGIGD  483

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGY+ +++  SLL+
Sbjct  484  TMASVVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYVLSQHWLSLLM  543

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  544  AVTVSGLLEAYTAQLDNAFIPLVFY  568



>ref|XP_010233804.1| PREDICTED: dolichol kinase-like [Brachypodium distachyon]
Length=350

 Score =   234 bits (598),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG  +HQFMNAFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  201  LGHTVHQFMNAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  260

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSIL+ LLA++GYI +++  SL +
Sbjct  261  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILVSLLASSGYILSQHWLSLSV  320

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLS LLEAYTAQLDNAFIPL+FY
Sbjct  321  AVTLSLLLEAYTAQLDNAFIPLVFY  345



>ref|XP_008800541.1| PREDICTED: dolichol kinase-like isoform X2 [Phoenix dactylifera]
Length=572

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  423  LGHIVHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  482

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYI ++   SLLL
Sbjct  483  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYILSQQWLSLLL  542

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  543  AVTVSGLLEAYTAQLDNAFIPLVFY  567



>ref|XP_002451535.1| hypothetical protein SORBIDRAFT_04g003380 [Sorghum bicolor]
 gb|EES04511.1| hypothetical protein SORBIDRAFT_04g003380 [Sorghum bicolor]
Length=350

 Score =   234 bits (598),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFMNAFTDHRDS++LIVSHFSLLLGCALP W+SSG NDRPLAPFAGILSLGIGD
Sbjct  201  LGHVVHQFMNAFTDHRDSEILIVSHFSLLLGCALPKWMSSGLNDRPLAPFAGILSLGIGD  260

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSIL+ LLA++GYI ++N  SLL+
Sbjct  261  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILVSLLASSGYILSQNWLSLLI  320

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  321  AVTLSGLLEAYTAQLDNAFIPLVFY  345



>gb|KJB83868.1| hypothetical protein B456_013G268700 [Gossypium raimondii]
Length=567

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM+AFTDHRDSD+LIVSHFSLLLGCALPIW+SSGFNDRPL PFAGILSLGIGD
Sbjct  418  LGQLVHQFMSAFTDHRDSDILIVSHFSLLLGCALPIWMSSGFNDRPLIPFAGILSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGI SVLAACSILLPLLA+T YI T++ F LL+
Sbjct  478  TMASMVGHKYGVLRWSKTGKKTIEGTAAGIVSVLAACSILLPLLASTRYIATQHWFPLLI  537

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT SGLLEAYTAQLDNAFIPL+FY
Sbjct  538  AVTTSGLLEAYTAQLDNAFIPLVFY  562



>ref|XP_011004786.1| PREDICTED: dolichol kinase isoform X1 [Populus euphratica]
Length=562

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+H+FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  413  LGQLVHEFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  472

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLP LA+TGY  T++  SLLL
Sbjct  473  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPHLASTGYFLTEHWISLLL  532

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEA TAQLDNAFIPL+FY
Sbjct  533  AVTVSGLLEASTAQLDNAFIPLVFY  557



>gb|KHN06871.1| Dolichol kinase [Glycine soja]
Length=531

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG  ++QFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+S+G+NDRPLAPFAGILSLGIGD
Sbjct  382  LGHPINQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSTGYNDRPLAPFAGILSLGIGD  441

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSVLAACS+LLPLLA+TGYI T++ FSLLL
Sbjct  442  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVLAACSLLLPLLASTGYILTQHWFSLLL  501

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYT QLDNAFIPL FY
Sbjct  502  AVTVSGLLEAYTTQLDNAFIPLFFY  526



>ref|XP_009356907.1| PREDICTED: dolichol kinase isoform X3 [Pyrus x bretschneideri]
Length=501

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ + +FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPF+GILSLGIGD
Sbjct  352  LGQSVDKFMNAFTDHRDSDLLIVSHFSLLLGCALPIWISSGYNDRPLAPFSGILSLGIGD  411

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI T++  SLLL
Sbjct  412  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYILTEHWCSLLL  471

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SG+LEAYTAQLDNAFIPL+FY
Sbjct  472  AVTVSGMLEAYTAQLDNAFIPLVFY  496



>ref|XP_004288135.1| PREDICTED: dolichol kinase [Fragaria vesca subsp. vesca]
Length=562

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ + +FM+AFTDHRDSDLLIVSHFSLLLGCALPIWLSSG NDRPL+PF+GILSLGIGD
Sbjct  413  LGQFIQKFMSAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGNNDRPLSPFSGILSLGIGD  472

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI T++  S+L+
Sbjct  473  TMASVVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYIVTEHWISILV  532

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  533  AVTVSGLLEAYTAQLDNAFIPLVFY  557



>ref|XP_010111811.1| hypothetical protein L484_020600 [Morus notabilis]
 gb|EXC31776.1| hypothetical protein L484_020600 [Morus notabilis]
Length=499

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFMNAFTDHRDSD+LIVSHFSLLLGCALPIW+SSG++DRPLAPFAGILSLGIGD
Sbjct  350  LGQPVHQFMNAFTDHRDSDILIVSHFSLLLGCALPIWMSSGYSDRPLAPFAGILSLGIGD  409

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLA CS+LLP+LA+TGYI T++  SL++
Sbjct  410  TMASMVGYKYGVLRWSKTGKKTIEGTAAGITSVLATCSVLLPVLASTGYIVTEHWSSLVV  469

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AV +SGLLEAYT QLDNAFIPL+FY
Sbjct  470  AVIVSGLLEAYTTQLDNAFIPLVFY  494



>ref|XP_008385359.1| PREDICTED: dolichol kinase isoform X1 [Malus domestica]
Length=569

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ + +FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPF+GILSLGIGD
Sbjct  420  LGQSVDKFMNAFTDHRDSDLLIVSHFSLLLGCALPIWISSGYNDRPLAPFSGILSLGIGD  479

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI T++  SLLL
Sbjct  480  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYILTEHWCSLLL  539

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SG+LEAYTAQLDNAFIPL+FY
Sbjct  540  AVTVSGMLEAYTAQLDNAFIPLIFY  564



>ref|XP_009356906.1| PREDICTED: dolichol kinase isoform X2 [Pyrus x bretschneideri]
Length=563

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ + +FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPF+GILSLGIGD
Sbjct  414  LGQSVDKFMNAFTDHRDSDLLIVSHFSLLLGCALPIWISSGYNDRPLAPFSGILSLGIGD  473

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI T++  SLLL
Sbjct  474  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYILTEHWCSLLL  533

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SG+LEAYTAQLDNAFIPL+FY
Sbjct  534  AVTVSGMLEAYTAQLDNAFIPLVFY  558



>ref|XP_008385360.1| PREDICTED: dolichol kinase isoform X2 [Malus domestica]
Length=563

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ + +FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPF+GILSLGIGD
Sbjct  414  LGQSVDKFMNAFTDHRDSDLLIVSHFSLLLGCALPIWISSGYNDRPLAPFSGILSLGIGD  473

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI T++  SLLL
Sbjct  474  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYILTEHWCSLLL  533

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SG+LEAYTAQLDNAFIPL+FY
Sbjct  534  AVTVSGMLEAYTAQLDNAFIPLIFY  558



>ref|XP_009356905.1| PREDICTED: dolichol kinase isoform X1 [Pyrus x bretschneideri]
Length=569

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ + +FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPF+GILSLGIGD
Sbjct  420  LGQSVDKFMNAFTDHRDSDLLIVSHFSLLLGCALPIWISSGYNDRPLAPFSGILSLGIGD  479

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLPLLA+TGYI T++  SLLL
Sbjct  480  TMASVVGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPLLASTGYILTEHWCSLLL  539

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SG+LEAYTAQLDNAFIPL+FY
Sbjct  540  AVTVSGMLEAYTAQLDNAFIPLVFY  564



>ref|XP_003539429.2| PREDICTED: dolichol kinase-like isoform X1 [Glycine max]
Length=579

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG  ++QFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+S+G+NDRPLAPFAGILSLGIGD
Sbjct  430  LGHPINQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSTGYNDRPLAPFAGILSLGIGD  489

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSVLAACS+LLPLLA+TGYI T++ FSLLL
Sbjct  490  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVLAACSLLLPLLASTGYILTQHWFSLLL  549

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYT QLDNAFIPL FY
Sbjct  550  AVTVSGLLEAYTTQLDNAFIPLFFY  574



>ref|XP_010935716.1| PREDICTED: dolichol kinase-like [Elaeis guineensis]
Length=572

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  423  LGHIVHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  482

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGI SVLAACS+LLPLLA+TG+I +++  SLLL
Sbjct  483  TMASMVGHKYGVLRWSKTGKKTIEGTAAGIMSVLAACSLLLPLLASTGFILSQHWLSLLL  542

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT++GLLEAYTAQLDNAFIPL+FY
Sbjct  543  AVTVTGLLEAYTAQLDNAFIPLVFY  567



>gb|KHN21496.1| Dolichol kinase [Glycine soja]
Length=560

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ ++QFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+S+G+NDRPLAPFAGILSLGIGD
Sbjct  411  LGQPINQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSTGYNDRPLAPFAGILSLGIGD  470

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSVLAACS+LLPL A+TGYI T++ FSLLL
Sbjct  471  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVLAACSLLLPLFASTGYILTQHWFSLLL  530

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEA+TAQLDNAFIPL F+
Sbjct  531  AVTVSGLLEAHTAQLDNAFIPLFFF  555



>ref|XP_002313531.1| phosphatidate cytidylyltransferase family protein [Populus trichocarpa]
 gb|EEE87486.1| phosphatidate cytidylyltransferase family protein [Populus trichocarpa]
Length=573

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 139/148 (94%), Gaps = 3/148 (2%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSH---FSLLLGCALPIWLSSGFNDRPLAPFAGILSLG  541
            LG+L+H+FMNAFTDHRDSDLLIV H   FSLLLGCALPIW+SSG+NDRPLAPFAGILSLG
Sbjct  421  LGQLVHEFMNAFTDHRDSDLLIVRHDYHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLG  480

Query  540  IGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfs  361
            IGDTMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS+LLP LA+TGY  T++  S
Sbjct  481  IGDTMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSVLLPHLASTGYFLTEHWIS  540

Query  360  lllavtlsglLEAYTAQLDNAFIPLMFY  277
            LLLAVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  541  LLLAVTVSGLLEAYTAQLDNAFIPLVFY  568



>ref|XP_003543453.1| PREDICTED: dolichol kinase-like [Glycine max]
Length=581

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ ++QFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+S+G+NDRPLAPFAGILSLGIGD
Sbjct  432  LGQPINQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSTGYNDRPLAPFAGILSLGIGD  491

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSVLAACS+LLPL A+TGYI T++ FSLLL
Sbjct  492  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVLAACSLLLPLFASTGYILTQHWFSLLL  551

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEA+TAQLDNAFIPL F+
Sbjct  552  AVTVSGLLEAHTAQLDNAFIPLFFF  576



>ref|XP_008645238.1| PREDICTED: dolichol kinase [Zea mays]
 gb|AFW70133.1| hypothetical protein ZEAMMB73_937323 [Zea mays]
Length=575

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+++HQFMNAFTDHRDS++LIVSHFSLLLGCALP W+SSG NDRPLAPFAGILSLGIGD
Sbjct  426  LGRVVHQFMNAFTDHRDSEILIVSHFSLLLGCALPKWMSSGLNDRPLAPFAGILSLGIGD  485

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSIL+ LLA++GYI ++N  SLL+
Sbjct  486  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILVSLLASSGYILSQNWLSLLI  545

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  546  AVTLSGLLEAYTAQLDNAFIPLVFY  570



>ref|XP_004951908.1| PREDICTED: dolichol kinase-like isoform X2 [Setaria italica]
Length=569

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+++HQFMNAFTDHRDS++LIVSHFSLLLGCALP W+SSG NDRPLAPFAGILSLGIGD
Sbjct  420  LGRVVHQFMNAFTDHRDSEILIVSHFSLLLGCALPKWMSSGLNDRPLAPFAGILSLGIGD  479

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSIL+ LLA++GYI ++N  SLL+
Sbjct  480  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILVSLLASSGYILSQNWLSLLI  539

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  540  AVTLSGLLEAYTAQLDNAFIPLVFY  564



>ref|XP_010497094.1| PREDICTED: dolichol kinase-like [Camelina sativa]
Length=389

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  240  LGEPLHQFMNAFTDHRDSEYLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  299

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSV+A C +L+P+LA+ GYI ++  +SL +
Sbjct  300  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVMAVCFVLVPVLASMGYILSQGWWSLFV  359

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             VT +G+LEAYTAQLDNAFIPL+FY
Sbjct  360  TVTATGMLEAYTAQLDNAFIPLVFY  384



>dbj|BAJ95806.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG  +HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  335  LGHTIHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  394

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSIL+ LLA++GYI +++  SL L
Sbjct  395  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILVTLLASSGYILSQHWLSLSL  454

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLS LLEAYT QLDNAFIPL+FY
Sbjct  455  AVTLSLLLEAYTTQLDNAFIPLVFY  479



>ref|XP_004951907.1| PREDICTED: dolichol kinase-like isoform X1 [Setaria italica]
Length=605

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+++HQFMNAFTDHRDS++LIVSHFSLLLGCALP W+SSG NDRPLAPFAGILSLGIGD
Sbjct  456  LGRVVHQFMNAFTDHRDSEILIVSHFSLLLGCALPKWMSSGLNDRPLAPFAGILSLGIGD  515

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSIL+ LLA++GYI ++N  SLL+
Sbjct  516  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILVSLLASSGYILSQNWLSLLI  575

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  576  AVTLSGLLEAYTAQLDNAFIPLVFY  600



>ref|XP_010253970.1| PREDICTED: dolichol kinase [Nelumbo nucifera]
Length=574

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            L + +H FMNAFTDHRDSDLLIVSHFSLLLGCALP W+S+GFNDRPLAP AGILSLGIGD
Sbjct  425  LWRTVHHFMNAFTDHRDSDLLIVSHFSLLLGCALPKWISTGFNDRPLAPLAGILSLGIGD  484

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSVLAACS+LLPLLA+T YI +++  SLLL
Sbjct  485  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVLAACSVLLPLLASTSYILSQHWISLLL  544

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT+SGLLEAYTAQLDNAFIPL+FY
Sbjct  545  AVTVSGLLEAYTAQLDNAFIPLVFY  569



>ref|XP_006419077.1| hypothetical protein EUTSA_v10002461mg [Eutrema salsugineum]
 gb|ESQ37513.1| hypothetical protein EUTSA_v10002461mg [Eutrema salsugineum]
Length=578

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  429  LGEPLHQFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  488

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSV+A C +L+P+LA+ GYI ++  +SLL+
Sbjct  489  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVMAVCFVLVPVLASMGYILSQGWWSLLV  548

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  549  AVTATGMLEAYTAQLDNAFIPLVFY  573



>gb|KFK33914.1| hypothetical protein AALP_AA5G077000 [Arabis alpina]
Length=576

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  427  LGEPLHQFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  486

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS++A C +L+P+LA+ GYI ++  +SLL+
Sbjct  487  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSMMAVCFVLVPVLASMGYILSQGWWSLLV  546

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  547  AVTATGMLEAYTAQLDNAFIPLVFY  571



>ref|XP_010520384.1| PREDICTED: dolichol kinase [Tarenaya hassleriana]
Length=584

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 129/149 (87%), Gaps = 4/149 (3%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LGK LHQFMNAFTDHRDSD+LIVSHFSLL+GCALPIW+SSGFNDRPL+PFAGILSLGIGD
Sbjct  431  LGKPLHQFMNAFTDHRDSDILIVSHFSLLMGCALPIWMSSGFNDRPLSPFAGILSLGIGD  490

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTG-YIFTKNlfsll  355
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSV+A C +L+P+LA+TG YI T      +
Sbjct  491  TMASVVGHKYGVLRWSKTGKKTVEGTAAGITSVMAVCFVLVPVLASTGFYILTTQEEKWV  550

Query  354  lavtlsg---lLEAYTAQLDNAFIPLMFY  277
              +       +LEAYTAQLDNAFIPL+FY
Sbjct  551  SLLVAVTGSGMLEAYTAQLDNAFIPLVFY  579



>ref|XP_002877378.1| phosphatidate cytidylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH53637.1| phosphatidate cytidylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=569

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  420  LGEPLHQFMNAFTDHRDSEHLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  479

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSV+A C +L+P+LA+ GYI ++  +SLL+
Sbjct  480  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVMAVCFVLVPILASMGYILSQGWWSLLV  539

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  540  AVTATGMLEAYTAQLDNAFIPLVFY  564



>ref|XP_010425937.1| PREDICTED: dolichol kinase-like [Camelina sativa]
Length=573

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  424  LGEPLHQFMNAFTDHRDSEHLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  483

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSV+A C +L+P+LA+ GYI ++  +SL +
Sbjct  484  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVMAVCFVLVPVLASMGYILSQGWWSLFV  543

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  544  AVTATGMLEAYTAQLDNAFIPLVFY  568



>ref|XP_010514840.1| PREDICTED: dolichol kinase-like [Camelina sativa]
Length=572

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  423  LGEPLHQFMNAFTDHRDSEHLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  482

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSV+A C +L+P+LA+ GYI ++  +SL +
Sbjct  483  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVMAVCFVLVPVLASMGYILSQGWWSLFV  542

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             VT +G+LEAYTAQLDNAFIPL+FY
Sbjct  543  TVTATGMLEAYTAQLDNAFIPLVFY  567



>gb|AAL67067.1| unknown protein [Arabidopsis thaliana]
Length=569

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  420  LGEPLHQFMNAFTDHRDSEHLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  479

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS++A C +L+P+LA+ GYI ++  +SLL+
Sbjct  480  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSMMAVCFVLVPILASMGYILSQGWWSLLV  539

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  540  AVTATGMLEAYTAQLDNAFIPLVFY  564



>emb|CDY48280.1| BnaA05g10740D [Brassica napus]
Length=564

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LH FMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  415  LGEPLHHFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  474

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS++A C +L+P+LA+ GYI ++  +SLL+
Sbjct  475  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSMMAVCYVLVPVLASMGYILSQGWWSLLV  534

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  535  AVTATGMLEAYTAQLDNAFIPLVFY  559



>ref|NP_190090.2| putative dolichol kinase [Arabidopsis thaliana]
 gb|AEE77982.1| putative dolichol kinase [Arabidopsis thaliana]
Length=569

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  420  LGEPLHQFMNAFTDHRDSEHLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  479

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS++A C +L+P+LA+ GYI ++  +SLL+
Sbjct  480  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSMMAVCFVLVPILASMGYILSQGWWSLLV  539

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  540  AVTATGMLEAYTAQLDNAFIPLVFY  564



>emb|CDY23707.1| BnaC01g24140D [Brassica napus]
Length=568

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LH FMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSGFNDR L+PF+GILSLGIGD
Sbjct  419  LGEPLHHFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGFNDRALSPFSGILSLGIGD  478

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSV+A C +L+P+LA+ GYI ++  +SLLL
Sbjct  479  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVMAVCFVLVPVLASMGYILSQGWWSLLL  538

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  539  AVTATGMLEAYTAQLDNAFIPLVFY  563



>ref|XP_009149874.1| PREDICTED: dolichol kinase [Brassica rapa]
Length=567

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LH FMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSGFNDR L+PF+GILSLGIGD
Sbjct  418  LGEPLHHFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGFNDRALSPFSGILSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITSV+A C +L+P+LA+ GYI ++  +SLLL
Sbjct  478  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSVMAVCFVLVPVLASMGYILSQGWWSLLL  537

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  538  AVTATGMLEAYTAQLDNAFIPLVFY  562



>ref|XP_009143958.1| PREDICTED: dolichol kinase-like [Brassica rapa]
Length=589

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LH FMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  440  LGEPLHHFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  499

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS++A C +L+P+LA+ GYI ++  +SLL+
Sbjct  500  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSMMAVCYVLVPVLASMGYILSQGWWSLLV  559

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  560  AVTATGMLEAYTAQLDNAFIPLVFY  584



>ref|XP_006290826.1| hypothetical protein CARUB_v10016935mg [Capsella rubella]
 gb|EOA23724.1| hypothetical protein CARUB_v10016935mg [Capsella rubella]
Length=569

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  420  LGEPLHQFMNAFTDHRDSEHLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  479

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS++A C +L+P+LA+ GYI ++  +SLL+
Sbjct  480  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSMMAVCFVLVPVLASMGYILSQGWWSLLV  539

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  540  AVTATGMLEAYTAQLDNAFIPLVFY  564



>emb|CAB89319.1| putative protein [Arabidopsis thaliana]
Length=598

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  449  LGEPLHQFMNAFTDHRDSEHLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  508

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS++A C +L+P+LA+ GYI ++  +SLL+
Sbjct  509  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSMMAVCFVLVPILASMGYILSQGWWSLLV  568

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  569  AVTATGMLEAYTAQLDNAFIPLVFY  593



>emb|CDY12224.1| BnaC04g12540D [Brassica napus]
Length=574

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LH FMNAFTDHRDS+ LIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  425  LGEPLHHFMNAFTDHRDSEFLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  484

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS++A C +L+P+LA+ GYI ++  +SLL+
Sbjct  485  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITSMMAVCFMLVPVLASMGYILSQGWWSLLV  544

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVT +G+LEAYTAQLDNAFIPL+FY
Sbjct  545  AVTATGMLEAYTAQLDNAFIPLVFY  569



>ref|XP_006833180.1| hypothetical protein AMTR_s00072p00153940 [Amborella trichopoda]
 gb|ERM98458.1| hypothetical protein AMTR_s00072p00153940 [Amborella trichopoda]
Length=581

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+ QFMNAFTDHRDSD+LIVSHFSLLLGCALP W+S+ F DRPL PFAGILSLGIGD
Sbjct  432  LGDLVDQFMNAFTDHRDSDILIVSHFSLLLGCALPKWMSARFYDRPLVPFAGILSLGIGD  491

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS+VG+KYGVLRWSKTGKKT+EGTAAGITSVL ACS+LLPLLA+ GYI +++  SL +
Sbjct  492  TMASMVGYKYGVLRWSKTGKKTVEGTAAGITSVLFACSVLLPLLASKGYILSQHWLSLAV  551

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYT QLDNAFIPL+FY
Sbjct  552  AVTLSGLLEAYTTQLDNAFIPLVFY  576



>dbj|BAG90656.1| unnamed protein product [Oryza sativa Japonica Group]
Length=350

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFM+AFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  201  LGHIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  260

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILL LLA++GYI +++  SLL+
Sbjct  261  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLSLLASSGYILSQHWISLLV  320

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  321  AVTLSGLLEAYTAQLDNAFIPLVFY  345



>ref|NP_001045877.1| Os02g0146500 [Oryza sativa Japonica Group]
 dbj|BAF07791.1| Os02g0146500, partial [Oryza sativa Japonica Group]
Length=375

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFM+AFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  226  LGHIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  285

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILL LLA++GYI +++  SLL+
Sbjct  286  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLSLLASSGYILSQHWISLLV  345

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  346  AVTLSGLLEAYTAQLDNAFIPLVFY  370



>ref|XP_006646877.1| PREDICTED: dolichol kinase-like [Oryza brachyantha]
Length=484

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFMNAFTDHRDS+ LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  335  LGHIVHQFMNAFTDHRDSETLIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  394

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILL LLA++GYI +++  SLL+
Sbjct  395  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLSLLASSGYILSQHWLSLLV  454

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPLMFY
Sbjct  455  AVTLSGLLEAYTAQLDNAFIPLMFY  479



>gb|EEE56295.1| hypothetical protein OsJ_05366 [Oryza sativa Japonica Group]
Length=509

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFM+AFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  360  LGHIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  419

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILL LLA++GYI +++  SLL+
Sbjct  420  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLSLLASSGYILSQHWISLLV  479

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  480  AVTLSGLLEAYTAQLDNAFIPLVFY  504



>gb|EEC72477.1| hypothetical protein OsI_05838 [Oryza sativa Indica Group]
Length=568

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFM+AFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  419  LGHIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  478

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILL LLA++GYI +++  SLL+
Sbjct  479  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLSLLASSGYILSQHWISLLV  538

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  539  AVTLSGLLEAYTAQLDNAFIPLVFY  563



>gb|EEC72481.1| hypothetical protein OsI_05844 [Oryza sativa Indica Group]
Length=588

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFM+AFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  439  LGHIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  498

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILL LLA++GYI +++  SLL+
Sbjct  499  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLSLLASSGYILSQHWISLLV  558

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTLSGLLEAYTAQLDNAFIPL+FY
Sbjct  559  AVTLSGLLEAYTAQLDNAFIPLVFY  583



>ref|XP_008789549.1| PREDICTED: dolichol kinase-like isoform X3 [Phoenix dactylifera]
Length=532

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  419  LGHLVHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  478

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKN  370
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYI +++
Sbjct  479  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYILSQS  532



>ref|XP_008800543.1| PREDICTED: dolichol kinase-like isoform X3 [Phoenix dactylifera]
Length=550

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  423  LGHIVHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  482

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYI ++
Sbjct  483  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYILSQ  535



>ref|XP_008789548.1| PREDICTED: dolichol kinase-like isoform X2 [Phoenix dactylifera]
Length=544

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  419  LGHLVHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  478

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKN  370
            TMAS+VGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYI +++
Sbjct  479  TMASMVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYILSQS  532



>ref|XP_008800540.1| PREDICTED: dolichol kinase-like isoform X1 [Phoenix dactylifera]
Length=589

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  423  LGHIVHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  482

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKN  370
            TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLA+TGYI ++ 
Sbjct  483  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLASTGYILSQR  536



>gb|EMT30058.1| hypothetical protein F775_31824 [Aegilops tauschii]
Length=482

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG  +HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  337  LGHTIHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  396

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSIL+ LLA++GYI ++
Sbjct  397  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILVTLLASSGYILSQ  449



>gb|EMS63897.1| Splicing factor 3B subunit 1 [Triticum urartu]
Length=1651

 Score =   211 bits (536),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 95/113 (84%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  711   LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             LG  +HQFMNAFTDHRDS++LI+SHFSLLLGCALP W+SSGFNDRPLAPFAGILSLGIGD
Sbjct  1502  LGHTIHQFMNAFTDHRDSEILIISHFSLLLGCALPKWMSSGFNDRPLAPFAGILSLGIGD  1561

Query  531   TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
             TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSIL+ LLA++GYI ++
Sbjct  1562  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILVTLLASSGYILSQ  1614



>gb|KHG19069.1| Dolichol kinase [Gossypium arboreum]
 gb|KHG22571.1| Dolichol kinase [Gossypium arboreum]
Length=501

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 113/148 (76%), Gaps = 29/148 (20%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM+AFTDHRDSD+LIVSHFSLLLGCALPIW+SSGFNDRPL PFAGILSLGIGD
Sbjct  375  LGQLVHQFMSAFTDHRDSDILIVSHFSLLLGCALPIWMSSGFNDRPLIPFAGILSLGIGD  434

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLL---ATTGYIFTKNlfs  361
            TMAS+VGHKYGVLRWSKTG+KTIEGTAAGI           PLL    T+G +       
Sbjct  435  TMASMVGHKYGVLRWSKTGQKTIEGTAAGIH--------WFPLLIAVTTSGLL-------  479

Query  360  lllavtlsglLEAYTAQLDNAFIPLMFY  277
                       EAYTAQLDNAFIPL+FY
Sbjct  480  -----------EAYTAQLDNAFIPLVFY  496



>gb|EEC72462.1| hypothetical protein OsI_05811 [Oryza sativa Indica Group]
Length=1454

 Score =   195 bits (495),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 95/113 (84%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  711   LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             LG ++HQFM+AFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  1179  LGHIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  1238

Query  531   TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
             TMAS++G+KYGVLRWSKTGKKTIEGTAAGITSVLAACSILL LLA++GYI ++
Sbjct  1239  TMASMIGYKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLSLLASSGYILSQ  1291



>gb|EEE56282.1| hypothetical protein OsJ_05340 [Oryza sativa Japonica Group]
Length=1283

 Score =   189 bits (481),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 93/113 (82%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -3

Query  711   LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             LG ++HQFM+AFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  1150  LGHIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  1209

Query  531   TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
             TMAS++ +KYGVLRWSKTGKKTIEGTAAGITS LAACSILL LLA++GYI ++
Sbjct  1210  TMASMICYKYGVLRWSKTGKKTIEGTAAGITSALAACSILLSLLASSGYILSQ  1262



>ref|XP_006419076.1| hypothetical protein EUTSA_v10002461mg [Eutrema salsugineum]
 gb|ESQ37512.1| hypothetical protein EUTSA_v10002461mg [Eutrema salsugineum]
Length=531

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ LHQFMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSGFNDR L+PFAGILSLGIGD
Sbjct  429  LGEPLHQFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGFNDRALSPFAGILSLGIGD  488

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITS  436
            TMAS+VGHKYGVLRWSKTGKKT+EGTAAGITS
Sbjct  489  TMASMVGHKYGVLRWSKTGKKTVEGTAAGITS  520



>ref|XP_007150159.1| hypothetical protein PHAVU_005G1319000g [Phaseolus vulgaris]
 gb|ESW22153.1| hypothetical protein PHAVU_005G1319000g [Phaseolus vulgaris]
Length=513

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ ++QFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+S+G+NDRPLAPFAGILSLGIGD
Sbjct  429  LGQPINQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSTGYNDRPLAPFAGILSLGIGD  488

Query  531  TMASLVGHKYGVLRWSKTGKK  469
            TMAS+VGHKYGVLRWSKTG K
Sbjct  489  TMASMVGHKYGVLRWSKTGSK  509



>ref|XP_007150160.1| hypothetical protein PHAVU_005G1319000g, partial [Phaseolus vulgaris]
 gb|ESW22154.1| hypothetical protein PHAVU_005G1319000g, partial [Phaseolus vulgaris]
Length=507

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ ++QFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+S+G+NDRPLAPFAGILSLGIGD
Sbjct  429  LGQPINQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSTGYNDRPLAPFAGILSLGIGD  488

Query  531  TMASLVGHKYGVLRWSKTG  475
            TMAS+VGHKYGVLRWSKTG
Sbjct  489  TMASMVGHKYGVLRWSKTG  507



>gb|EEE56294.1| hypothetical protein OsJ_05365 [Oryza sativa Japonica Group]
Length=506

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG ++HQFM+AFTDHRDS++LIVSHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGD
Sbjct  410  LGHIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGD  469

Query  531  TMASLVGHKYGVLRWSKTGK  472
            TMAS++G+KYGVLRWSKTG+
Sbjct  470  TMASMIGYKYGVLRWSKTGR  489



>ref|XP_008463185.1| PREDICTED: dolichol kinase isoform X2 [Cucumis melo]
Length=516

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 89/145 (61%), Gaps = 51/145 (35%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+ +HQFMNAFTDHRDS+LLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  418  LGQPVHQFMNAFTDHRDSELLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  477

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            TM           RW                S+L A +I       +G +          
Sbjct  478  TM-----------RW---------------LSLLLAVTI-------SGLL----------  494

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
                    EAYTAQLDNAFIPL+F+
Sbjct  495  --------EAYTAQLDNAFIPLVFF  511



>gb|KEH39387.1| phosphatidate cytidylyltransferase family protein [Medicago truncatula]
Length=503

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 85/144 (59%), Gaps = 51/144 (35%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            G+ ++QFMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGDT
Sbjct  406  GQPINQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGDT  465

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfsllla  349
            M     H + +          +  T +G+                               
Sbjct  466  M-----HWFSLF---------LAVTVSGL-------------------------------  480

Query  348  vtlsglLEAYTAQLDNAFIPLMFY  277
                  LEAYTAQLDNAFIPL FY
Sbjct  481  ------LEAYTAQLDNAFIPLFFY  498



>ref|XP_010322411.1| PREDICTED: dolichol kinase isoform X2 [Solanum lycopersicum]
Length=500

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFMNAFTDHRD+DLL+VSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD
Sbjct  414  LGQLVHQFMNAFTDHRDTDLLVVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  473

Query  531  TM  526
            TM
Sbjct  474  TM  475



>ref|XP_011004788.1| PREDICTED: dolichol kinase isoform X2 [Populus euphratica]
Length=540

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+H+FMNAFTDHRDSDLLIVSHFSLLLGCALPIW+SSG+NDRPLAPFAGILSLGIGD
Sbjct  413  LGQLVHEFMNAFTDHRDSDLLIVSHFSLLLGCALPIWMSSGYNDRPLAPFAGILSLGIGD  472

Query  531  TMAS  520
            TM S
Sbjct  473  TMVS  476



>gb|KJB20357.1| hypothetical protein B456_003G144600 [Gossypium raimondii]
Length=493

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG+L+HQFM+AFTDHRDSDL+IVSHFSLLLGCALPIW+SSGFNDRPL PF+GILSLGIGD
Sbjct  418  LGQLVHQFMSAFTDHRDSDLIIVSHFSLLLGCALPIWMSSGFNDRPLTPFSGILSLGIGD  477

Query  531  TMASLV  514
            TM  L+
Sbjct  478  TMYELL  483



>gb|EYU36157.1| hypothetical protein MIMGU_mgv1a005517mg [Erythranthe guttata]
Length=481

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG L+HQFMNAFTDHRDSDLL+VSHFSLLLGCA+PIWLSSGF DRP+APFA ILSLGIGD
Sbjct  410  LGHLVHQFMNAFTDHRDSDLLVVSHFSLLLGCAIPIWLSSGFTDRPIAPFAEILSLGIGD  469

Query  531  TMA  523
            TM 
Sbjct  470  TMV  472



>ref|XP_001762080.1| predicted protein [Physcomitrella patens]
 gb|EDQ73184.1| predicted protein [Physcomitrella patens]
Length=788

 Score =   119 bits (299),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 59/101 (58%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFN-DRPLAPFAGILSLGIG  535
            LG+ +H F+ +FTD RDSD+LI+SHFSLLLGCA+P+WLS+  + DR LA +AGILSLGIG
Sbjct  578  LGEKIHIFLKSFTDSRDSDILIISHFSLLLGCAVPVWLSTTTSKDRQLAAYAGILSLGIG  637

Query  534  DTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSIL  412
            DT+AS+VG  +G ++ ++  KKT EGT AGI S++ A ++L
Sbjct  638  DTVASVVGFNFGSMQLNRWSKKTWEGTIAGILSLIVASALL  678



>gb|KIM39990.1| hypothetical protein M413DRAFT_446890 [Hebeloma cylindrosporum 
h7]
Length=497

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 81/145 (56%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G   H FMN F DHRDS   I+SHF LL GCA  +WL        L  F GIL+LG+GD
Sbjct  353  FGASFHLFMNEFLDHRDSGTAIISHFYLLTGCAGSVWLE---GPSMLLQFTGILTLGLGD  409

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
              AS+VG + GV RWS T  KT+EG+ A + SVLAA       L   GY+   +    L 
Sbjct  410  AAASIVGRRLGVHRWSPTTSKTLEGSLAFVLSVLAAVLC----LRLFGYVEPFSTIRYLS  465

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             V +S +LEA + Q DN  +PL  +
Sbjct  466  VVVISAVLEALSDQNDNLTLPLYMW  490



>dbj|GAM28688.1| hypothetical protein SAMD00019534_118640 [Acytostelium subglobosum 
LB1]
Length=221

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFND-------RPLAPFAGI  553
            L + L  +M+AF D RDS ++ ++H  LL+GC++P++L+  ++         PL+ F+G+
Sbjct  72   LSQPLSTYMDAFLDGRDSGIVTLTHIYLLVGCSIPVFLTFFYDSGERSTYLHPLSAFSGL  131

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GD+MAS VG KYG  +W  T  K++EGT  GI S   A ++LL L  T     + 
Sbjct  132  LTIGVGDSMASYVGIKYGKTKWFST-SKSLEGTIGGIVSCFIAGAMLL-LCVTNQTTTSI  189

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
             L  LL+  ++SGLLEA T Q+DN  +P++F+
Sbjct  190  QLIRLLIGSSISGLLEASTNQIDNIVLPILFF  221



>ref|XP_007765981.1| hypothetical protein CONPUDRAFT_119896 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW84223.1| hypothetical protein CONPUDRAFT_119896 [Coniophora puteana RWD-64-598 
SS2]
Length=822

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F DH+DS   I+SHF LL GCA  +WL    +   L+ + GIL+LG+GD
Sbjct  677  FGAAVHLFMNEFLDHKDSGTAILSHFYLLTGCAGSVWLE---DSSRLSLYTGILTLGVGD  733

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RWS +  KTIEG+AA + SV+ AC  LL L    G I   +      
Sbjct  734  ALASIVGKRIGRHRWSPSTSKTIEGSAAFVISVV-ACGCLLRL---CGLIEEFSTMRYAA  789

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             +T+S +LEA + Q DN  +PL  +
Sbjct  790  VITMSAVLEALSDQNDNLTLPLYMW  814



>ref|XP_005096549.1| PREDICTED: dolichol kinase-like isoform X1 [Aplysia californica]
 ref|XP_005096550.1| PREDICTED: dolichol kinase-like isoform X2 [Aplysia californica]
Length=560

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 94/148 (64%), Gaps = 8/148 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAP---FAGILSLG  541
            +GKLL     +F D RD  ++ ++H  LL G +LP+W+S       LAP   ++G+L+LG
Sbjct  413  IGKLLDDVQRSFVDERDQGVVFLTHIYLLAGLSLPLWISPNVLTADLAPLELYSGVLALG  472

Query  540  IGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfs  361
            IGDT+A + G  +G +RW  T KKT+EGTA+ + + LA  ++     +++G +  ++  S
Sbjct  473  IGDTIACIAGRAFGRIRWPGT-KKTMEGTASSVLAQLAFVAV----TSSSGLLTVESYTS  527

Query  360  lllavtlsglLEAYTAQLDNAFIPLMFY  277
            + + + LSGL+EA+T Q+DN  +PL+ Y
Sbjct  528  VTVGIVLSGLVEAFTDQIDNLILPLVLY  555



>emb|CEP13489.1| hypothetical protein [Parasitella parasitica]
Length=718

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 89/153 (58%), Gaps = 13/153 (8%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            GK LH F+  F D+RD   +I+SH  LLLGCA P+WL S      LA  +G+LSLG GD 
Sbjct  561  GKSLHVFLTEFIDNRDLGPVILSHIYLLLGCASPVWLGSS---NVLASLSGVLSLGFGDA  617

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTG------YIFTK--  373
             AS++G ++G  RW  T KKT+EGTAA I +V  + ++++   A  G      Y+ +   
Sbjct  618  AASIIGKRFGRYRWPGT-KKTVEGTAAFIVAVFVSSAVIVYSSALVGIDGAARYVASAGR  676

Query  372  -NlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
                +    +TL+ LLEA++ Q DN  IPL  Y
Sbjct  677  GEWLNYSAVITLTALLEAFSTQNDNIIIPLYMY  709



>gb|KDQ24532.1| hypothetical protein PLEOSDRAFT_1113830 [Pleurotus ostreatus 
PC15]
Length=613

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 83/144 (58%), Gaps = 7/144 (5%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            G  +H FMN F DH+DS   I+SHF LL GCA  +WL    +   L+ F GIL++G+GD 
Sbjct  470  GAAIHVFMNDFLDHKDSGTAILSHFYLLTGCAGSLWLEGPSH---LSQFTGILTIGVGDA  526

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfsllla  349
            +AS++G ++G  RWS T  KT+EG+ A   SV+A+      LL   G +   +       
Sbjct  527  LASIIGKRFGTHRWSPTSPKTVEGSMALTVSVVASAW----LLRILGLVEPFSTVQYAAT  582

Query  348  vtlsglLEAYTAQLDNAFIPLMFY  277
            V +S +LEA + Q DN  +PL  +
Sbjct  583  VAISSVLEALSVQNDNLTLPLFMW  606



>gb|KIJ66658.1| hypothetical protein HYDPIDRAFT_174072 [Hydnomerulius pinastri 
MD-312]
Length=1779

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 61/145 (42%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F D +DS   I+SHF LL GCA  +WL        L  + GIL+LG+GD
Sbjct  273  FGAAVHLFMNEFLDQKDSGTAILSHFYLLTGCAGSLWLEG---PSQLLQYTGILALGVGD  329

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RWS +  KT+EG+AA + S L  C+ LL L   T    T       +
Sbjct  330  ALASIVGKRIGRHRWSASSSKTVEGSAAFVVS-LVTCAWLLRLFGLTEEFST---LRYAV  385

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             V LS  LEA + Q DN  +PL  +
Sbjct  386  VVALSSALEALSDQNDNLTLPLYMW  410



>ref|XP_009526345.1| hypothetical protein PHYSODRAFT_504686 [Phytophthora sojae]
 gb|EGZ17287.1| hypothetical protein PHYSODRAFT_504686 [Phytophthora sojae]
Length=319

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 91/147 (62%), Gaps = 6/147 (4%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFN-DRPLAPFAGILSLGIGD  532
            G+ + +FM  F DHR++  +I++H  LLLGCALP+WL+  F+   PL    G+L+LG+GD
Sbjct  165  GRSIAEFMRTFIDHREAGRIILTHSYLLLGCALPLWLAPSFSGPSPLVVNTGVLALGVGD  224

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK--Nlfsl  358
             M ++VG   G  R    G KT+EG+AA   S+L A SI L    T  Y+  +   L  L
Sbjct  225  AMGAVVGSTLG--RRKVFGGKTLEGSAAVFFSMLIA-SIPLHDYHTRAYVDGEYVQLALL  281

Query  357  llavtlsglLEAYTAQLDNAFIPLMFY  277
             +AV L+ +LEA TAQ+DN  +PL FY
Sbjct  282  TVAVFLTSVLEAATAQIDNLVLPLFFY  308



>gb|EPB92011.1| hypothetical protein HMPREF1544_01074 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=649

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 89/153 (58%), Gaps = 13/153 (8%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            GK LH F+  F D+RD   +I+SH  LLLGCA P+WL S      LA  +G+LSLG GD 
Sbjct  492  GKSLHVFLTEFIDNRDLGPVILSHIYLLLGCASPVWLGSA---NVLASLSGVLSLGFGDA  548

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAAGITSV------LAACSILLPLLATTGYIFTK--  373
             AS+VG ++G  RW  T KKT+EGTAA I +V      +   S L+ +   + Y+ +   
Sbjct  549  AASIVGKRFGRYRWPGT-KKTVEGTAAFIIAVFFSSWLIVYSSALVGVDGASRYVASAGR  607

Query  372  -NlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
                +  + +TL+ LLEA++ Q DN  IPL  Y
Sbjct  608  GEWLNYSVVITLTALLEAFSTQNDNIIIPLYMY  640



>ref|XP_777440.1| hypothetical protein CNBB0140 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL22793.1| hypothetical protein CNBB0140 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=1011

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 83/142 (58%), Gaps = 7/142 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  866  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  922

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL A  I+       G +   N     +
Sbjct  923  ALASIVGRRIGRLRWCTVFGKTVEGSIAFFLSVLGASWIMWAF----GVVDNFNFKPYAI  978

Query  351  avtlsglLEAYTAQLDNAFIPL  286
             V LS LLEA++AQ DN  +P+
Sbjct  979  TVGLSTLLEAFSAQNDNLILPM  1000



>gb|KDR78911.1| hypothetical protein GALMADRAFT_64608 [Galerina marginata CBS 
339.88]
Length=758

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 83/145 (57%), Gaps = 9/145 (6%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            G  LH FMN F DHRD    I+SHF LL GCA  +WL        L  F GIL+LG+GD 
Sbjct  614  GASLHLFMNEFLDHRDGGTAILSHFYLLTGCAGSVWLE---GPSQLLQFTGILTLGLGDA  670

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAA-GITSVLAACSILLPLLATTGYIFTKNlfslll  352
             AS+VG + G+ +WS T  KT+EG+ A GI   +AA      LL  TGY+   +    L 
Sbjct  671  AASIVGRRLGIHKWSPTTSKTLEGSLAFGILVYMAAL-----LLRLTGYVEPFSSVRYLT  725

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AV ++ +LEA + Q DN  +PL  +
Sbjct  726  AVAIAAVLEALSDQNDNLTLPLYMW  750



>ref|XP_569044.1| dolichol kinase [Cryptococcus neoformans var. neoformans JEC21]
 gb|AAW41737.1| dolichol kinase, putative [Cryptococcus neoformans var. neoformans 
JEC21]
Length=1011

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 83/142 (58%), Gaps = 7/142 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  866  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  922

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL A  I+       G +   N     +
Sbjct  923  ALASIVGRRIGRLRWCTVFGKTVEGSIAFFLSVLGASWIMWAF----GVVDNFNFKPYAI  978

Query  351  avtlsglLEAYTAQLDNAFIPL  286
             V LS LLEA++AQ DN  +P+
Sbjct  979  TVGLSTLLEAFSAQNDNLILPM  1000



>ref|XP_007342961.1| hypothetical protein AURDEDRAFT_85412 [Auricularia delicata TFB-10046 
SS5]
 gb|EJD49062.1| hypothetical protein AURDEDRAFT_85412 [Auricularia delicata TFB-10046 
SS5]
Length=602

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 83/145 (57%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA+ +WL        +  F G+L+LG+GD
Sbjct  456  FGAAVHVFLNEFLDHKDSGTAILSHFYLLTGCAVTLWLEGSSR---ILEFTGVLALGVGD  512

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             MAS+VG + G  RWS    KT+EGTAA + SV+ AC++ L      G +   +++    
Sbjct  513  AMASIVGKRLGRRRWSAASGKTVEGTAAFVLSVV-ACAVGLRAF---GLVEKFSVWRYTC  568

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
                 GLLEA + Q DN  +PL  +
Sbjct  569  VGIAGGLLEALSVQNDNLTLPLYMW  593



>gb|KIR59719.1| dolichol kinase [Cryptococcus gattii CA1873]
Length=1010

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 83/143 (58%), Gaps = 7/143 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  865  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  921

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL A  I+       G +   N     +
Sbjct  922  ALASIVGRRIGRLRWCSVFGKTVEGSVAFFFSVLGASWIMWLF----GIVDDFNFKPYTI  977

Query  351  avtlsglLEAYTAQLDNAFIPLM  283
             V L+ LLEA++AQ DN  +P+ 
Sbjct  978  TVALATLLEAFSAQNDNLILPMF  1000



>gb|KIR46744.1| dolichol kinase [Cryptococcus gattii CA1280]
Length=1010

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 83/143 (58%), Gaps = 7/143 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  865  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  921

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL A  I+       G +   N     +
Sbjct  922  ALASIVGRRIGRLRWCSVFGKTVEGSVAFFFSVLGASWIMWLF----GIVDDFNFKPYTI  977

Query  351  avtlsglLEAYTAQLDNAFIPLM  283
             V L+ LLEA++AQ DN  +P+ 
Sbjct  978  TVALATLLEAFSAQNDNLILPMF  1000



>ref|XP_007848358.1| dolichol kinase [Moniliophthora roreri MCA 2997]
 gb|ESK92335.1| dolichol kinase [Moniliophthora roreri MCA 2997]
Length=889

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 82/143 (57%), Gaps = 7/143 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F D +DS   I+SHF LL GCA  +WL +G    PL  F GIL LG+GD
Sbjct  743  FGASIHLFMNEFLDQKDSGTAILSHFYLLTGCAGSLWLENG---SPLLEFTGILVLGVGD  799

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G+ RWS T  KT+EG+ A   SV+  C+ +L L    G +   + +    
Sbjct  800  ALASIVGKRVGIHRWSPTSSKTLEGSVAFTVSVV-ICAWVLRLF---GIVEAFSTYRYAG  855

Query  351  avtlsglLEAYTAQLDNAFIPLM  283
             +  S +LEA + Q DN  +PL 
Sbjct  856  VIGYSSVLEALSDQNDNLTLPLF  878



>gb|EGN99090.1| hypothetical protein SERLA73DRAFT_54621 [Serpula lacrymans var. 
lacrymans S7.3]
Length=1737

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G ++H FMN F DH+DS   I+SHF LL GCA  +WL        +  + GIL+LG+GD
Sbjct  158  FGAVVHLFMNEFLDHKDSGTAILSHFYLLTGCAGSLWLEG---PHQILQYTGILALGVGD  214

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RWS +  KT+EG+AA   S++A   IL     T  +   +       
Sbjct  215  ALASIVGKRIGKHRWSPSTSKTLEGSAAFTLSIVACVWILRICGLTEDFSIVR----YTA  270

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             V LS  LEA + Q DN  +PL  +
Sbjct  271  VVALSSALEALSDQNDNLTLPLYMW  295



>gb|KIR85359.1| dolichol kinase [Cryptococcus gattii IND107]
Length=1005

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 83/143 (58%), Gaps = 7/143 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  860  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  916

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL A  ++       G +   N     +
Sbjct  917  ALASIVGRRIGRLRWCSVFGKTVEGSVAFFFSVLGASWVMWLF----GIVDDFNFKPYTI  972

Query  351  avtlsglLEAYTAQLDNAFIPLM  283
             V L+ LLEA++AQ DN  +P+ 
Sbjct  973  TVALATLLEAFSAQNDNLILPMF  995



>ref|XP_003965290.1| PREDICTED: dolichol kinase-like [Takifugu rubripes]
Length=523

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP---------LAPFA  559
            LG++L Q +  F D RDS  LI++H  LLLG +LPIWL  G    P         L P+A
Sbjct  369  LGQVLRQVLTLFLDERDSGPLILTHIYLLLGMSLPIWLFPG-PCAPKGILPGAGGLIPYA  427

Query  558  GILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIF  379
            G+L++G+GDT+AS+ G   G +RW  T KKTIEGTA  + + + A +I   L+  TG   
Sbjct  428  GVLAVGVGDTVASVFGSTMGEIRWPGT-KKTIEGTATSVFAQIIAVAIF--LIFDTGINL  484

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   ++ ++TL  +LEAYT Q+DN
Sbjct  485  NSSYSWIVGSITLVAMLEAYTFQIDN  510



>ref|XP_007318681.1| Fph type histidine kinase [Serpula lacrymans var. lacrymans S7.9]
 gb|EGO24662.1| Fph type histidine kinase [Serpula lacrymans var. lacrymans S7.9]
Length=2436

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G ++H FMN F DH+DS   I+SHF LL GCA  +WL        +  + GIL+LG+GD
Sbjct  695  FGAVVHLFMNEFLDHKDSGTAILSHFYLLTGCAGSLWLEG---PHQILQYTGILALGVGD  751

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RWS +  KT+EG+AA   S++A   IL     T  +   +       
Sbjct  752  ALASIVGKRIGKHRWSPSTSKTLEGSAAFTLSIVACVWILRICGLTEDFSIVR----YTA  807

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             V LS  LEA + Q DN  +PL  +
Sbjct  808  VVALSSALEALSDQNDNLTLPLYMW  832



>gb|AFR93583.1| dolichol kinase [Cryptococcus neoformans var. grubii H99]
 gb|AGV15434.1| dolichol kinase, variant [Cryptococcus neoformans var. grubii 
H99]
Length=1011

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 83/142 (58%), Gaps = 7/142 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  866  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  922

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL    I+     T G +   N     +
Sbjct  923  ALASIVGRRIGRLRWCIVFGKTVEGSIAFFLSVLGVSWIMW----TFGIVDDFNFKPYAI  978

Query  351  avtlsglLEAYTAQLDNAFIPL  286
             V LS LLEA++AQ DN  +P+
Sbjct  979  TVGLSTLLEAFSAQNDNLILPM  1000



>ref|XP_009526336.1| hypothetical protein PHYSODRAFT_501611 [Phytophthora sojae]
 gb|EGZ17278.1| hypothetical protein PHYSODRAFT_501611 [Phytophthora sojae]
Length=319

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 90/147 (61%), Gaps = 6/147 (4%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFN-DRPLAPFAGILSLGIGD  532
            G+ + +FM  F DHR++  +I++H  LLLGCALP+WL+  F+   PL    G+L+LG+GD
Sbjct  165  GRSIAEFMRTFIDHREAGRIILTHSYLLLGCALPLWLAPSFSGPSPLVVNTGVLALGVGD  224

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK--Nlfsl  358
             M ++VG   G  R    G K +EG+AA   S+L A SI L    T  Y+  +   L  L
Sbjct  225  AMGAVVGSTLG--RRKVFGGKMLEGSAAVFFSMLIA-SIPLHDYHTRAYVDGEYVQLALL  281

Query  357  llavtlsglLEAYTAQLDNAFIPLMFY  277
             +AV L+ +LEA TAQ+DN  +PL FY
Sbjct  282  TVAVFLTSVLEAATAQIDNLVLPLFFY  308



>gb|KII89750.1| hypothetical protein PLICRDRAFT_52914 [Plicaturopsis crispa FD-325 
SS-3]
Length=2493

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 61/146 (42%), Positives = 83/146 (57%), Gaps = 9/146 (6%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F DH+D    I+SHF LL GCA  +WL       PL  F+GIL LG+GD
Sbjct  817  FGISVHLFMNEFLDHKDGGTAILSHFYLLTGCAGSLWLEGA---TPLLQFSGILVLGVGD  873

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITS-VLAACSILLPLLATTGYIFTKNlfsll  355
             +AS+VG + G  RWS +  KT+EG+ A + S V+ AC     LL   G     ++    
Sbjct  874  ALASIVGKRMGRHRWSPSTGKTLEGSLAFMLSIVVCAC-----LLQACGLTEKFSVGRYA  928

Query  354  lavtlsglLEAYTAQLDNAFIPLMFY  277
            + V++S LLEA + Q DN  +PL  +
Sbjct  929  VIVSVSSLLEALSDQNDNLTLPLYMW  954



>emb|CAG12437.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=518

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP---------LAPFA  559
            LG++L Q +  F D RDS  LI++H  LLLG +LPIWL  G    P         L P+A
Sbjct  364  LGQVLRQVLTLFLDERDSGPLILTHIYLLLGMSLPIWLFPG-PCAPKGVLPGAGGLVPYA  422

Query  558  GILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIF  379
            G+L++G+GDT+AS+ G   G +RW  T KKT+EGTA  + + + A ++   L+  +G   
Sbjct  423  GVLAVGVGDTVASVFGSTMGEIRWPGT-KKTVEGTATSVFAQIIAVAVF--LIFDSGINL  479

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
                  ++ ++ L  +LEAYT Q+DN
Sbjct  480  NSTYSWIVGSIALVAMLEAYTVQIDN  505



>gb|KIR80106.1| dolichol kinase [Cryptococcus gattii EJB2]
Length=1005

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 82/143 (57%), Gaps = 7/143 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  860  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  916

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL A  I+       G +   N     +
Sbjct  917  ALASIVGRRIGRLRWCSVFGKTVEGSVAFFFSVLGASWIMWLF----GIVDDFNFKPYTI  972

Query  351  avtlsglLEAYTAQLDNAFIPLM  283
             V L+ LLEA +AQ DN  +P+ 
Sbjct  973  TVALATLLEALSAQNDNLILPMF  995



>gb|KIR54076.1| dolichol kinase [Cryptococcus gattii Ru294]
Length=1005

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 82/143 (57%), Gaps = 7/143 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  860  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  916

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL A  I+       G +   N     +
Sbjct  917  ALASIVGRRIGRLRWCSVFGKTVEGSVAFFFSVLGASWIMWLF----GIVDDFNFKPYTI  972

Query  351  avtlsglLEAYTAQLDNAFIPLM  283
             V L+ LLEA +AQ DN  +P+ 
Sbjct  973  TVALATLLEALSAQNDNLILPMF  995



>ref|XP_003191093.1| dolichol kinase [Cryptococcus gattii WM276]
 gb|ADV19306.1| dolichol kinase, putative [Cryptococcus gattii WM276]
 gb|KIY34486.1| dolichol kinase [Cryptococcus gattii E566]
 gb|KJE05155.1| dolichol kinase [Cryptococcus gattii NT-10]
Length=1005

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 82/143 (57%), Gaps = 7/143 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+W   G +D  +  + G+LSLGIGD
Sbjct  860  FGVKVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWFE-GSSD--ILSYFGVLSLGIGD  916

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW     KT+EG+ A   SVL A  I+       G +   N     +
Sbjct  917  ALASIVGRRIGRLRWCSVFGKTVEGSVAFFFSVLGASWIMWLF----GIVDDFNFKPYTI  972

Query  351  avtlsglLEAYTAQLDNAFIPLM  283
             V L+ LLEA +AQ DN  +P+ 
Sbjct  973  TVALATLLEALSAQNDNLILPMF  995



>ref|XP_008893767.1| hypothetical protein PPTG_21066 [Phytophthora parasitica INRA-310]
 gb|ETN21266.1| hypothetical protein PPTG_21066 [Phytophthora parasitica INRA-310]
Length=319

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIGD  532
            G+L+ +FM +F DHR++  +I++H  LLLGCALP+WL  S     PL   AG+++LG+GD
Sbjct  166  GRLIAEFMRSFIDHREAGRVILTHSYLLLGCALPLWLVPSPVTPSPLVMNAGVVALGVGD  225

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             M ++VG   G  +    G KT+EG+AA   S+  A   +    A+  +      F L+ 
Sbjct  226  AMGAVVGSSIG--KHKIFGSKTVEGSAAVFFSMAFASLFVQNYHASVAHGEFTQAFLLIA  283

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             + L+ +LEA TAQ+DN  +PL FY
Sbjct  284  GIFLTTVLEAATAQIDNLVLPLFFY  308



>gb|KIK47436.1| hypothetical protein CY34DRAFT_73979 [Suillus luteus UH-Slu-Lm8-n1]
Length=808

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 82/144 (57%), Gaps = 7/144 (5%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            G  +H FMN F + +DS   I+SHF LL GCA P+WL        L  + GIL+LGIGD 
Sbjct  664  GAAVHLFMNEFLEQKDSGTAILSHFYLLTGCAGPLWLEEPSQ---LLQYTGILALGIGDA  720

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfsllla  349
            +AS++G + G  RWS T  KT+EG+AA + S L  C+ LL L   T    T       + 
Sbjct  721  LASIIGKRVGRHRWSSTSSKTLEGSAAFVLS-LVGCAWLLRLCGLTEEFST---LRYSIV  776

Query  348  vtlsglLEAYTAQLDNAFIPLMFY  277
            VTLS  LEA + Q DN  +PL  +
Sbjct  777  VTLSCALEALSDQNDNLTLPLYMW  800



>gb|EST08647.1| tRNA dihydrouridine synthase [Pseudozyma brasiliensis GHG001]
Length=712

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 81/145 (56%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  LH FM+ F DH+DS  +I+SHF LL GCA P+WL    + R L    G+L LG+GD
Sbjct  567  FGAALHVFMSEFLDHKDSGPVILSHFYLLTGCAGPLWLED--HSRILQQ-TGVLVLGVGD  623

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            ++AS+VG +YG   W     KT+EGT A +TS++A+      LL   G+    +      
Sbjct  624  SLASIVGRRYGRTYWPGGSSKTVEGTVAFVTSIMASAW----LLRLVGWCEQFSSIKYFT  679

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             V   GLLE  + Q DN  +P+  Y
Sbjct  680  VVASLGLLEGVSDQHDNLVLPIFGY  704



>gb|KIK10099.1| hypothetical protein K443DRAFT_139137 [Laccaria amethystina LaAM-08-1]
Length=804

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F DHRD    I+SHF LL GCA  +WL        L  F GIL+LG+GD
Sbjct  643  FGASVHLFMNEFLDHRDGGTAILSHFYLLTGCAGCLWLE---GPSQLLQFMGILTLGVGD  699

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILL  409
              AS+VG + GVLRWS T  KT+EG+ A + SV   C+++L
Sbjct  700  AAASIVGRRVGVLRWSPTTTKTVEGSLAFVISV-TVCALIL  739



>ref|XP_007869006.1| hypothetical protein GLOTRDRAFT_117464 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ52743.1| hypothetical protein GLOTRDRAFT_117464 [Gloeophyllum trabeum 
ATCC 11539]
Length=1685

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 83/145 (57%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F DH+DS   I+SHF LL GCA  +WL    + R LA F GIL LG+GD
Sbjct  72   FGAAVHLFMNEFLDHKDSGTAILSHFYLLTGCAGSVWLEG--STRFLA-FTGILVLGVGD  128

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RWS T  KT+EG+ AG T  + AC+ LL L   T      ++     
Sbjct  129  AVASIVGKRIGRHRWSITTPKTLEGS-AGFTLSIVACAWLLQLCGLTERF---SIVRYAA  184

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
               LS +LEA + Q DN  +PL  +
Sbjct  185  VAALSSVLEALSQQNDNLTLPLYMW  209



>ref|XP_009266123.1| Rho guanine nucleotide exchange factor scd1 [Wallemia ichthyophaga 
EXF-994]
 gb|EOR03906.1| Rho guanine nucleotide exchange factor scd1 [Wallemia ichthyophaga 
EXF-994]
Length=1901

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 55/149 (37%), Positives = 78/149 (52%), Gaps = 26/149 (17%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            L   +H FM+ F D +DS   I+SHF LL G  + +W+ +G   R +   +G+L LG+GD
Sbjct  810  LSAKIHVFMSEFIDEKDSGAAILSHFYLLTGSMMCLWMENG---RTMDNLSGVLVLGVGD  866

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSI----LLPLLATTGYIFTKNlf  364
             MAS+VG K+G  RW+    K+IEGT     S+LA  S     ++P+L T          
Sbjct  867  AMASIVGKKWGRHRWTDASNKSIEGTLGFALSMLAVTSFKSSQVIPILVTA---------  917

Query  363  slllavtlsglLEAYTAQLDNAFIPLMFY  277
                      L+EAY+ Q DN  I  +FY
Sbjct  918  ----------LMEAYSVQNDNLIIGFIFY  936



>ref|XP_002680715.1| predicted protein [Naegleria gruberi]
 gb|EFC47971.1| predicted protein [Naegleria gruberi]
Length=315

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 19/155 (12%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPL---APFAGILSLG  541
            L + LH ++  FTD RDS   I++H  LL+GC +P  +    +++ +      +G++ LG
Sbjct  153  LARALHFYIKQFTDSRDSGTFILTHIYLLIGCMIPTCVEIFSHEKTINYHRILSGVMILG  212

Query  540  IGDTMASLVGHKYGVLRWSK--TGKKTIEGTAAGITSVLAACSILLPL-----LATTGYI  382
            IGDTMAS+VG  +G  +W+     KK++EGT A   SV     +++P+     L    YI
Sbjct  213  IGDTMASVVGFNFGKTKWNYPIDTKKSVEGTFASFLSVCFISYLVVPIHFTSNLELCSYI  272

Query  381  FTKNlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
            F             + +LEAYT Q+DN  +P+ FY
Sbjct  273  FC---------TLAASMLEAYTVQIDNLILPVFFY  298



>ref|XP_002470509.1| hypothetical histidine kinase [Postia placenta Mad-698-R]
 gb|EED84276.1| hypothetical histidine kinase [Postia placenta Mad-698-R]
Length=1591

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 54/145 (37%), Positives = 82/145 (57%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F D +DS   I+SHF LL+GCA  +W         L  + G L LG+GD
Sbjct  72   FGASVHVFMNEFLDQKDSGTAILSHFYLLIGCAGTVWFEG---PSQLLQYTGTLVLGVGD  128

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RW  T  KT+EG+AA   S++ AC+ +L +L  + +    ++    +
Sbjct  129  ALASIVGKRLGRHRWLATSPKTVEGSAAFALSIV-ACAWVLRVLGFSEHF---SVAKYAV  184

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
               L+ +LEA++ Q DN  +PL  +
Sbjct  185  VAVLASVLEAFSVQNDNVILPLYMW  209



>ref|XP_007393395.1| hypothetical protein PHACADRAFT_159124 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM58067.1| hypothetical protein PHACADRAFT_159124 [Phanerochaete carnosa 
HHB-10118-sp]
Length=1688

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F D +D    I+SHF LL GCA  +W         L  F GIL+LG+GD
Sbjct  162  FGAAVHVFMNEFLDVKDGGTAILSHFYLLTGCANSVWFEG---PSRLLQFTGILTLGVGD  218

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RWS    KTIEG+AA   SV+ AC+ LL +    G+    ++     
Sbjct  219  ALASIVGKRLGRHRWSAGTPKTIEGSAAFAMSVV-ACAWLLRI---CGFTEDFSIVRYGA  274

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
               L+ +LEA++ Q DN  +PL  +
Sbjct  275  VAALASVLEAFSVQNDNLTLPLYMW  299



>gb|ABQ22586.1| transmembrane protein 15-like protein [Callithrix jacchus]
Length=185

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  31   LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  90

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  91   VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  146

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  147  NYSYAWILGSISTVSLLEAYTTQIDN  172



>ref|XP_006459296.1| Tco6 SGD histidine kinase sensor protein [Agaricus bisporus var. 
bisporus H97]
 gb|EKV49219.1| Tco6 SGD histidine kinase sensor protein [Agaricus bisporus var. 
bisporus H97]
Length=1644

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 82/150 (55%), Gaps = 17/150 (11%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG  +H FMN F D +D    I+SHF LL GCA  +WL        L  + GIL+LG+GD
Sbjct  99   LGVTIHLFMNEFLDEKDDGTAILSHFYLLSGCAGSLWLEG---PSRLLQYTGILALGVGD  155

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPL-----LATTGYIFTKNl  367
             +AS+VG + G  RWS T  KT+EGT A + SV+ +  +L  L      +TT Y+     
Sbjct  156  AVASIVGKRIGKHRWSHTTSKTLEGTLAFVASVILSAWLLRLLGFAEPFSTTRYLL----  211

Query  366  fslllavtlsglLEAYTAQLDNAFIPLMFY  277
                  V +S +LEA + Q DN  +PL  +
Sbjct  212  -----GVAISAVLEALSDQNDNLTMPLYMW  236



>ref|XP_007330370.1| Tco6 SGD-HK type GAF domain related HK [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78666.1| Tco6 SGD-HK type GAF domain related HK [Agaricus bisporus var. 
burnettii JB137-S8]
Length=1686

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 82/150 (55%), Gaps = 17/150 (11%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG  +H FMN F D +D    I+SHF LL GCA  +WL        L  + GIL+LG+GD
Sbjct  128  LGVTIHLFMNEFLDEKDDGTAILSHFYLLSGCAGSLWLEG---PSRLLQYTGILALGVGD  184

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPL-----LATTGYIFTKNl  367
             +AS+VG + G  RWS T  KT+EGT A + SV+ +  +L  L      +TT Y+     
Sbjct  185  AVASIVGKRIGKHRWSHTTSKTLEGTLAFVASVILSAWLLRLLGFAEPFSTTRYLL----  240

Query  366  fslllavtlsglLEAYTAQLDNAFIPLMFY  277
                  V +S +LEA + Q DN  +PL  +
Sbjct  241  -----GVAISAVLEALSDQNDNLTMPLYMW  265



>ref|XP_007007861.1| hypothetical protein TREMEDRAFT_74797 [Tremella mesenterica DSM 
1558]
 gb|EIW66340.1| hypothetical protein TREMEDRAFT_74797 [Tremella mesenterica DSM 
1558]
Length=982

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 88/142 (62%), Gaps = 8/142 (6%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+N F DH+DS   I+SHF LL GCA P+WL    +   +A F G+L++G+GD
Sbjct  838  FGVSVHLFLNEFLDHKDSGTAILSHFYLLAGCAAPLWLEG--SSSVMANF-GVLAVGVGD  894

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G LRW+ +G KTIEG+ A   SVL +  +L  +    G +   N+ +  L
Sbjct  895  ALASIVGKRLGHLRWTSSG-KTIEGSMAFFLSVLLSTVVLWMM----GLVGDFNISAYTL  949

Query  351  avtlsglLEAYTAQLDNAFIPL  286
              +L  LLEA++AQ DN  +PL
Sbjct  950  TTSLVTLLEAFSAQNDNLILPL  971



>gb|KIJ52540.1| hypothetical protein M422DRAFT_43384 [Sphaerobolus stellatus 
SS14]
Length=2410

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 85/145 (59%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G ++H F+N F D++DS   I+SHF LL GCA P+WL  G     +  F G+L LG+GD
Sbjct  627  FGAVVHLFLNEFLDNKDSGTAILSHFYLLTGCAGPLWLEGGSR---IVEFTGLLCLGVGD  683

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RWS +  KT+EG+ A   SV+  C+ LL +    G +   ++    +
Sbjct  684  ALASIVGRRLGRNRWSPSTPKTVEGSIAYTISVV-FCAWLLRV---CGLVPGFSVVWYTV  739

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            A  LS +LEA + Q DN  +P+  +
Sbjct  740  AAGLSAMLEAVSVQNDNLTLPIYMW  764



>gb|KIM84287.1| hypothetical protein PILCRDRAFT_87687 [Piloderma croceum F 1598]
Length=563

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 81/145 (56%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G ++H FM+ F DH+DS   I+SHF LL GCA  +WL        L  F GIL+LG+GD
Sbjct  418  FGAVVHLFMHEFLDHKDSGTAILSHFYLLTGCAGSVWLE---GPSQLLQFTGILALGVGD  474

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             MAS+VG K G  RWS T  KT+EG+ A   S++A        L   G +   +L   ++
Sbjct  475  AMASIVGKKLGKYRWSATTSKTLEGSVAFTISIVAFAWA----LRLCGVVEHFSLMRYMV  530

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             V  S +LEA + Q DN  +PL  +
Sbjct  531  VVAFSSVLEALSDQNDNLTLPLYMW  555



>gb|KIY64571.1| hypothetical protein CYLTODRAFT_90406 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=770

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G ++H FMN F DHRD+   I+SHF LL GCA  +W  +      L  F G+L LGIGD
Sbjct  625  FGAMIHLFMNEFLDHRDNGTAILSHFYLLTGCAGSLWFEASTK---LVCFTGVLVLGIGD  681

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG K G  RWS +  KT+EG+ A   S++ +  I    L   G +   +     L
Sbjct  682  ALASIVGKKIGTHRWSPSTPKTLEGSIAFAVSIIGSAWI----LRLFGLVDPFSTKRYTL  737

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             V++   LEA++ Q DN  +PL  +
Sbjct  738  IVSIGAALEAFSDQNDNLTLPLYLW  762



>ref|XP_009014801.1| hypothetical protein HELRODRAFT_76716 [Helobdella robusta]
 gb|ESO07423.1| hypothetical protein HELRODRAFT_76716 [Helobdella robusta]
Length=202

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 86/142 (61%), Gaps = 16/142 (11%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFND-RPLAPFAGILSLGIG  535
            +G+L   F+    D RDS L++++H  LL+GC+ P+W S G  D   L P AGI+S+G+G
Sbjct  59   IGRLYRDFL----DSRDSGLVVLTHIYLLIGCSGPLWTSIGQPDLNDLFPLAGIISVGVG  114

Query  534  DTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACS--ILLPLLATTGYIFTKNlf-  364
            DTMAS VG KYG L+W K   K++EGT A       ACS  I + LL   G I    +  
Sbjct  115  DTMASFVGSKYGRLKW-KYSDKSVEGTVA------CACSQLIFIFLLNKFGIISLVGVAN  167

Query  363  -slllavtlsglLEAYTAQLDN  301
              ++ AV L+ LLEA+T Q+DN
Sbjct  168  GKIVAAVVLTSLLEAFTDQIDN  189



>ref|XP_010899421.1| PREDICTED: dolichol kinase [Esox lucius]
Length=523

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 11/145 (8%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP--------LAPFAG  556
            LG++L Q ++ F D RDS  LI++H  LLLG +LPIWL  G             L P+AG
Sbjct  369  LGQVLRQLLSLFLDERDSGPLILTHIYLLLGMSLPIWLFPGPCAPKGILPGAGGLVPYAG  428

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFT  376
            +L++G+GDT+AS+ G   G +RW  T +KT+EGTA  + + + A +I   L+  +     
Sbjct  429  VLAVGVGDTVASVFGSSLGEIRWPGT-RKTVEGTATSVFAQIIAVAIF--LIFDSAINLN  485

Query  375  KNlfslllavtlsglLEAYTAQLDN  301
                 ++ ++TL  +LEAYT+Q+DN
Sbjct  486  STYSWIVGSITLVAMLEAYTSQIDN  510



>ref|XP_004671842.1| PREDICTED: dolichol kinase [Jaculus jaculus]
Length=536

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LP+WL         S    R LAP+AG
Sbjct  382  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPVWLVPRPCTQKGSLGGARALAPYAG  441

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  442  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  497

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              N   +L +++   LLEAYT Q+DN
Sbjct  498  NYNYAWILGSISTVSLLEAYTTQIDN  523



>gb|ABQ22725.1| transmembrane protein 15-like protein [Callithrix jacchus]
Length=185

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIW+         S    R L P+AG
Sbjct  31   LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWVIPRPCTQKGSLGGARALVPYAG  90

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  91   VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  146

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  147  NYSYAWILGSISTVSLLEAYTTQIDN  172



>ref|XP_007263024.1| hypothetical protein FOMMEDRAFT_117686 [Fomitiporia mediterranea 
MF3/22]
 gb|EJD06760.1| hypothetical protein FOMMEDRAFT_117686 [Fomitiporia mediterranea 
MF3/22]
Length=736

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 82/141 (58%), Gaps = 7/141 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F+  FTD +DS   I+SHF LL GCA  +WL    +   L  F G+L LGIGD
Sbjct  590  FGAAIHVFLTEFTDDKDSGTAILSHFYLLTGCASTVWLE---DYSKLLNFTGVLVLGIGD  646

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             MAS+VG + G  RWS +  KT+EG+AA + SV+  C+ +L L    G + + +      
Sbjct  647  AMASIVGRRIGKTRWSASSSKTLEGSAAFVVSVV-ICAWILRL---CGLVESFSTVRYTA  702

Query  351  avtlsglLEAYTAQLDNAFIP  289
             VT++ +LEA + Q DN  +P
Sbjct  703  VVTIAAVLEALSVQNDNLTLP  723



>gb|ETP15210.1| hypothetical protein F441_09951 [Phytophthora parasitica CJ01A1]
Length=587

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIGD  532
            G+L+ +FM +F DHR++  +I++H  LLLGCALP+WL  S     PL   AG+++LG+GD
Sbjct  434  GRLIAEFMRSFIDHREAGRVILTHSYLLLGCALPLWLVPSPVTPSPLVMNAGVVALGVGD  493

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             M ++VG   G  +    G KT+EG+AA   S+  A   +    A+  +      F L+ 
Sbjct  494  AMGAVVGSSIG--KHKIFGSKTVEGSAAVFFSMAFASLFVQNYHASVAHGEFTQAFLLIA  551

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             + L+ +LEA TAQ+DN  +PL FY
Sbjct  552  GIFLTTVLEAATAQIDNLVLPLFFY  576



>gb|ETK85356.1| hypothetical protein L915_09801 [Phytophthora parasitica]
 gb|ETL38781.1| hypothetical protein L916_09708 [Phytophthora parasitica]
Length=587

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIGD  532
            G+L+ +FM +F DHR++  +I++H  LLLGCALP+WL  S     PL   AG+++LG+GD
Sbjct  434  GRLIAEFMRSFIDHREAGRVILTHSYLLLGCALPLWLVPSPVTPSPLVMNAGVVALGVGD  493

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             M ++VG   G  +    G KT+EG+AA   S+  A   +    A+  +      F L+ 
Sbjct  494  AMGAVVGSSIG--KHKIFGSKTVEGSAAVFFSMAFASLFVQNYHASVAHGEFTQAFLLIA  551

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             + L+ +LEA TAQ+DN  +PL FY
Sbjct  552  GIFLTTVLEAATAQIDNLVLPLFFY  576



>gb|ETP43290.1| hypothetical protein F442_09905 [Phytophthora parasitica P10297]
Length=587

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIGD  532
            G+L+ +FM +F DHR++  +I++H  LLLGCALP+WL  S     PL   AG+++LG+GD
Sbjct  434  GRLIAEFMRSFIDHREAGRVILTHSYLLLGCALPLWLVPSPVTPSPLVMNAGVVALGVGD  493

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             M ++VG   G  +    G KT+EG+AA   S+  A   +    A+  +      F L+ 
Sbjct  494  AMGAVVGSSIG--KHKIFGSKTVEGSAAVFFSMAFASLFVQNYHASVAHGEFTQAFLLIA  551

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             + L+ +LEA TAQ+DN  +PL FY
Sbjct  552  GIFLTTVLEAATAQIDNLVLPLFFY  576



>gb|ETO74044.1| hypothetical protein F444_10097 [Phytophthora parasitica P1976]
Length=587

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIGD  532
            G+L+ +FM +F DHR++  +I++H  LLLGCALP+WL  S     PL   AG+++LG+GD
Sbjct  434  GRLIAEFMRSFIDHREAGRVILTHSYLLLGCALPLWLVPSPVTPSPLVMNAGVVALGVGD  493

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             M ++VG   G  +    G KT+EG+AA   S+  A   +    A+  +      F L+ 
Sbjct  494  AMGAVVGSSIG--KHKIFGSKTVEGSAAVFFSMAFASLFVQNYHASVAHGEFTQAFLLIA  551

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             + L+ +LEA TAQ+DN  +PL FY
Sbjct  552  GIFLTTVLEAATAQIDNLVLPLFFY  576



>gb|ETL91903.1| hypothetical protein L917_09629 [Phytophthora parasitica]
Length=587

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIGD  532
            G+L+ +FM +F DHR++  +I++H  LLLGCALP+WL  S     PL   AG+++LG+GD
Sbjct  434  GRLIAEFMRSFIDHREAGRVILTHSYLLLGCALPLWLVPSPVTPSPLVMNAGVVALGVGD  493

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             M ++VG   G  +    G KT+EG+AA   S+  A   +    A+  +      F L+ 
Sbjct  494  AMGAVVGSSIG--KHKIFGSKTVEGSAAVFFSMAFASLFVQNYHASVAHGEFTQAFLLIA  551

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             + L+ +LEA TAQ+DN  +PL FY
Sbjct  552  GIFLTTVLEAATAQIDNLVLPLFFY  576



>gb|ETI45409.1| hypothetical protein F443_10005 [Phytophthora parasitica P1569]
 gb|ETM45197.1| hypothetical protein L914_09676 [Phytophthora parasitica]
Length=587

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIGD  532
            G+L+ +FM +F DHR++  +I++H  LLLGCALP+WL  S     PL   AG+++LG+GD
Sbjct  434  GRLIAEFMRSFIDHREAGRVILTHSYLLLGCALPLWLVPSPVTPSPLVMNAGVVALGVGD  493

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             M ++VG   G  +    G KT+EG+AA   S+  A   +    A+  +      F L+ 
Sbjct  494  AMGAVVGSSIG--KHKIFGSKTVEGSAAVFFSMAFASLFVQNYHASVAHGEFTQAFLLIA  551

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             + L+ +LEA TAQ+DN  +PL FY
Sbjct  552  GIFLTTVLEAATAQIDNLVLPLFFY  576



>gb|EMD34151.1| hypothetical protein CERSUDRAFT_117640 [Ceriporiopsis subvermispora 
B]
Length=974

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 82/144 (57%), Gaps = 7/144 (5%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            G  +H FM  F D++DS   I+SHF LL GCA  +W         L  F GIL LGIGD 
Sbjct  830  GATVHLFMYEFLDNKDSGTAILSHFYLLTGCANTLWFEGPSR---LLEFTGILVLGIGDA  886

Query  528  MASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfsllla  349
            +AS+VG ++G  RW  T  KT+EG+AA + S++ AC+    LL   GY    ++    + 
Sbjct  887  LASIVGKRWGRHRWIPTSPKTLEGSAAFVCSIV-ACAW---LLRVCGYTENFSVVRYTVV  942

Query  348  vtlsglLEAYTAQLDNAFIPLMFY  277
              LSG LEA++ Q DN  +PL  +
Sbjct  943  AVLSGALEAFSVQNDNLTLPLYMW  966



>emb|CBQ69732.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=1185

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 85/145 (59%), Gaps = 8/145 (6%)
 Frame = -3

Query  711   LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
              G  LH FM+ F DH+DS  +I+SHF LL GCA P+WL    + R L    G+L LGIGD
Sbjct  1041  FGAALHVFMSEFLDHKDSGPVILSHFYLLTGCAGPLWLEG--HSRILQQ-TGVLVLGIGD  1097

Query  531   TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             ++AS+VG +YG L W  +  KT+EGTAA +TS++A+      LL   G+    +     +
Sbjct  1098  SLASVVGRRYGRLYWPGS-SKTVEGTAAFVTSIMASAW----LLRLVGWCEPFDSAKYFV  1152

Query  351   avtlsglLEAYTAQLDNAFIPLMFY  277
              +   GLLE  + Q DN  +P+  Y
Sbjct  1153  VIAALGLLEGVSDQHDNLVLPIFGY  1177



>gb|EFA86315.1| hypothetical protein PPL_00105 [Polysphondylium pallidum PN500]
Length=534

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 92/154 (60%), Gaps = 10/154 (6%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALP------IWLSSGFND---RPLAPFA  559
            L   L  +M++F D RDS ++ ++H  LLLGC++P         S+  N     PL+  +
Sbjct  377  LATQLSTYMDSFLDSRDSGVITLTHIYLLLGCSIPAITCFFFESSTAINTSHLHPLSALS  436

Query  558  GILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIF  379
            G+L++G+GD++ASLVG K+G  +W  T  K+IEGT  GI S   A  ILL  +  T    
Sbjct  437  GLLTIGVGDSLASLVGTKFGRTKWFGTS-KSIEGTLGGIISTFTAGVILLIAIQPTSATL  495

Query  378  TKNlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
              ++  LL+A  LSG+LEA T Q+DN  +P++F+
Sbjct  496  FSDVIKLLIASFLSGILEASTTQIDNIILPIIFF  529



>ref|NP_055723.1| dolichol kinase [Homo sapiens]
 ref|XP_001162301.1| PREDICTED: dolichol kinase [Pan troglodytes]
 ref|XP_008974155.1| PREDICTED: dolichol kinase [Pan paniscus]
 sp|Q9UPQ8.1|DOLK_HUMAN RecName: Full=Dolichol kinase; AltName: Full=Transmembrane protein 
15 [Homo sapiens]
 gb|AAH35556.1| Dolichol kinase [Homo sapiens]
 gb|AAQ89119.1| TREC2422 [Homo sapiens]
 gb|EAW87849.1| transmembrane protein 15 [Homo sapiens]
 dbj|BAG09967.1| transmembrane protein 15 [synthetic construct]
 gb|ADZ15912.1| dolichol kinase [synthetic construct]
Length=538

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L  F++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>gb|EJU04762.1| hypothetical protein DACRYDRAFT_47116 [Dacryopinax sp. DJM-731 
SS1]
Length=651

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H F++ F DHRDS   I+SHF LL GCA  IWL    + +P+    G+L LG+GD
Sbjct  506  FGAAVHVFLSEFLDHRDSGTAILSHFYLLTGCAGSIWLE---DSKPILELTGVLVLGVGD  562

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS++G K G  RWS    K++EG+AA   SV   C++LL L   +G +   +L+    
Sbjct  563  ALASIIGRKIGKHRWSSASGKSVEGSAALAGSVW-LCALLLRL---SGIVDPFSLWKYGC  618

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            A+ L  LLEA + Q DN  +PL  +
Sbjct  619  AIGLGSLLEALSMQNDNLVLPLYVW  643



>gb|KIP08064.1| hypothetical protein PHLGIDRAFT_70027 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=1620

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 56/145 (39%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F D +DS   I+SHF LL GCA  +W         L  + GIL LG+GD
Sbjct  127  FGAAVHVFMNEFLDSKDSGTAILSHFYLLTGCANSVWFEG---PSRLLHYTGILVLGVGD  183

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RW+ +  KT+EG+AA + SV+  C+  L L   T      ++     
Sbjct  184  ALASIVGKRLGRHRWASSTPKTVEGSAAFVVSVV-MCAWALRLCGCTEEF---SIMRYGA  239

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
              TL+ +LEA++ Q DN  +PL  +
Sbjct  240  VATLASVLEAFSVQNDNLILPLYMW  264



>ref|XP_004048758.1| PREDICTED: dolichol kinase [Gorilla gorilla gorilla]
Length=538

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L  F++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_009243213.1| PREDICTED: dolichol kinase [Pongo abelii]
Length=538

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L  F++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYTWILGSISTVSLLEAYTTQIDN  525



>dbj|BAA83046.2| KIAA1094 protein [Homo sapiens]
Length=544

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L  F++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  390  LGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  449

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  450  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  505

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  506  NYSYAWILGSISTVSLLEAYTTQIDN  531



>gb|KIK62538.1| hypothetical protein GYMLUDRAFT_242694 [Gymnopus luxurians FD-317 
M1]
Length=875

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 78/145 (54%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F D +DS   I+SHF LL GCA  +WL       PL  F G L LG+GD
Sbjct  730  FGAAVHLFMNEFLDQKDSGTAILSHFYLLTGCAGSLWLE---GSSPLLQFTGTLVLGVGD  786

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G+ RWS T  KT+EG+ A   SV+ +  I    L   G   + +      
Sbjct  787  ALASIVGKRVGIHRWSPTTNKTLEGSFAFTLSVVISAWI----LRLFGLAESFSTLRYTA  842

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             + +S +LEA + Q DN  +PL  Y
Sbjct  843  VMGMSSMLEALSDQNDNVMLPLFSY  867



>ref|XP_003726510.1| PREDICTED: dolichol kinase-like [Strongylocentrotus purpuratus]
Length=219

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 12/147 (8%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPF-------AGIL  550
            G L+H  ++AFT+ +DS + I++   LL+G   P+  S   ND  L+ F       +G+L
Sbjct  67   GDLIHDALSAFTNEQDSGIAILTPMCLLIGLYQPLHYS---NDASLSEFQSKLFLYSGVL  123

Query  549  SLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKN  370
            S GIGDT AS++G +YG +RW  + KKTIEGT   + S L AC +LL +       F+  
Sbjct  124  STGIGDTAASIIGSRYGTMRWPGS-KKTIEGTLGAVVSQLIAC-VLLSIFLGVEPSFSSA  181

Query  369  lfslllavtlsglLEAYTAQLDNAFIP  289
              S+   + L+ LLEA+T+Q+DN  +P
Sbjct  182  WISITWVIILTSLLEAFTSQIDNLVLP  208



>gb|KIM54348.1| hypothetical protein SCLCIDRAFT_1222049 [Scleroderma citrinum 
Foug A]
Length=862

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 79/145 (54%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F DH+DS   I+SHF LL GCA  +WL        L  + GIL+LG+GD
Sbjct  718  FGAAVHLFMNEFLDHKDSGTAILSHFYLLTGCAGSVWLEGPSR---LHLYTGILALGVGD  774

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RW     KT+EGTAA + S++   S    LL   G +   ++     
Sbjct  775  ALASIVGKRIGRHRWFAGSPKTVEGTAAFVVSIVTCAS----LLRVFGLVDDFSIARYAG  830

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             VTL+   E ++ Q DN  +PL  +
Sbjct  831  VVTLASAYEGFSDQNDNLTLPLYMW  855



>ref|XP_003264273.1| PREDICTED: dolichol kinase [Nomascus leucogenys]
Length=538

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (59%), Gaps = 11/145 (8%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L  F++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFT  376
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   I + + + +++  L+  +G    
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGTMTSIFAQIISVAVI--LIFDSGVDLN  500

Query  375  KNlfslllavtlsglLEAYTAQLDN  301
             +   +L +++   LLEAYT Q+DN
Sbjct  501  YSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_002907865.1| dolichol kinase, putative [Phytophthora infestans T30-4]
 gb|EEY60948.1| dolichol kinase, putative [Phytophthora infestans T30-4]
Length=320

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 10/149 (7%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIGD  532
            G+ + +FM +F DHR++  +I++H  LLLGCALP+WL  S     PL   AG+L+LGIGD
Sbjct  166  GRTIAKFMRSFIDHREAGRVILTHSYLLLGCALPLWLVPSSSASSPLVMNAGVLALGIGD  225

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAG-ITSVLAACSILLPLLATTGYI---FTKNlf  364
             M ++VG + G  +    G KT+EG+ A  IT VLA  SI L    T  ++   +T+ + 
Sbjct  226  AMGAVVGSRIG--KHKIFGSKTVEGSVAVFITMVLA--SISLQNYHTRYFVNGDYTQ-VI  280

Query  363  slllavtlsglLEAYTAQLDNAFIPLMFY  277
             L  AV L+ +LEA TAQ+DN  +PL  Y
Sbjct  281  LLTAAVFLTTVLEAATAQIDNLVLPLFLY  309



>ref|NP_001086008.1| dolichol kinase [Xenopus laevis]
 gb|AAH73693.1| MGC83595 protein [Xenopus laevis]
Length=521

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 17/151 (11%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL------SSGFNDRPLAPFAGILS  547
            G+ L   +  F D RDS  LI++H  LLLG +LP+WL      +S      L P+AG+L+
Sbjct  370  GQTLRNLLTLFLDERDSGPLILTHIYLLLGMSLPVWLFPRVCSTSLTGSSTLLPYAGVLA  429

Query  546  LGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLAT----TGYIF  379
            +G+GDT+AS+ G   G LRW  T KKT EGT   I + + A +++L   ++    +GY++
Sbjct  430  VGVGDTIASVCGSAMGELRWPGT-KKTFEGTMMSIFAQIIAAALILIFDSSVNLNSGYVW  488

Query  378  TKNlfslllavtlsglLEAYTAQLDNAFIPL  286
                     ++TL  LLEA+T Q+DN  +PL
Sbjct  489  ILG------SITLVSLLEAFTTQIDNVILPL  513



>ref|NP_001103954.1| dolichol kinase [Danio rerio]
 gb|AAI34947.1| Zgc:162284 protein [Danio rerio]
Length=524

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 85/144 (59%), Gaps = 11/144 (8%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGF--------NDRPLAPFAGI  553
            G  L + +  F D RDS  LI++H  LLLG +LP+WL+ G             L P+AG+
Sbjct  371  GAPLRRLLTLFLDERDSGPLILTHIYLLLGVSLPLWLTPGMCTPKGGLGGASGLVPYAGV  430

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GDT+AS+ G   G +RW  T KKT EGTA+ + + + A  +   L+A +      
Sbjct  431  LAVGVGDTVASVFGSNVGEIRWPGT-KKTFEGTASSVFAQIIAVVVF--LIADSSINLNA  487

Query  372  NlfslllavtlsglLEAYTAQLDN  301
            +   ++ ++++  +LEAYT+Q+DN
Sbjct  488  SYSWVVGSISMVAMLEAYTSQIDN  511



>ref|XP_002911424.1| dolichol kinase [Coprinopsis cinerea okayama7#130]
 gb|EFI27930.1| dolichol kinase [Coprinopsis cinerea okayama7#130]
Length=732

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 79/142 (56%), Gaps = 7/142 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F DHRD    I+SHF LL GC+  +WL    +   L    GIL+LG+GD
Sbjct  583  FGAAIHLFMNDFLDHRDGGTAILSHFYLLTGCSGSLWLE---DPSKLRQVTGILTLGVGD  639

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
              AS+VG + G+ RWS T  KT+EG+ A + S+ A    L  L    G++ T      LL
Sbjct  640  AAASIVGRRIGLRRWSPTTGKTVEGSLAFVGSIFATAWFLRLL----GFVETFPSLRYLL  695

Query  351  avtlsglLEAYTAQLDNAFIPL  286
             +  + LLEA + Q DN  +PL
Sbjct  696  TLMCAALLEALSDQNDNLTLPL  717



>ref|XP_010738697.1| PREDICTED: dolichol kinase [Larimichthys crocea]
Length=523

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (59%), Gaps = 11/145 (8%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP--------LAPFAG  556
            +G+LL Q +  F D RDS  LI++H  LLLG +LPIWL  G             L P+AG
Sbjct  369  VGQLLRQVLTLFLDERDSGPLILTHIYLLLGMSLPIWLFPGPCAPKGVLPGAGGLVPYAG  428

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFT  376
            +L++G+GDT+AS+ G   G +RW  T KKT+EGTA  + + + A ++ L    +      
Sbjct  429  VLAVGVGDTVASVFGSTMGEIRWPGT-KKTMEGTATSVFAQIIAVAMFLIFDGSIN--LN  485

Query  375  KNlfslllavtlsglLEAYTAQLDN  301
                 ++ +VTL  +LEAYT+Q+DN
Sbjct  486  STYSWIVGSVTLVAMLEAYTSQIDN  510



>emb|CDS08742.1| hypothetical protein LRAMOSA10103 [Absidia idahoensis var. thermophila]
Length=659

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 91/154 (59%), Gaps = 15/154 (10%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
            GK +H F+  F D RD   +I+SH  LLLGCA P+WL+S      LA  +GIL+LG GDT
Sbjct  503  GKSIHLFLTEFIDSRDLGPVILSHIYLLLGCAAPVWLNSS---NLLASISGILALGFGDT  559

Query  528  MASLVGHKYGVLRWSKTG-KKTIEGTAAGITSVLAAC------SILLPLLATTGYIF---  379
             AS+VG +YG  RW   G KKTIEGT A + ++ A+       S  L + + T ++    
Sbjct  560  AASIVGKRYG--RWHWPGSKKTIEGTMAFVVTMYASVVFIMYGSAFLGISSATQFVVNMT  617

Query  378  TKNlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
            + +    L+  +L+GLLEA ++Q DN  IPL  +
Sbjct  618  SADWAGFLITASLTGLLEALSSQNDNIIIPLYIF  651



>ref|XP_008489660.1| PREDICTED: dolichol kinase [Calypte anna]
Length=523

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 91/149 (61%), Gaps = 11/149 (7%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL----SSGFNDRP----LAPFAGI  553
            G+ L Q ++ F D RDS  LI++H  LLLG +LP+WL     +     P    LAP++G+
Sbjct  370  GQTLRQLLSLFLDERDSGPLILTHIYLLLGMSLPVWLFPRSCAPKGTLPGVGALAPYSGV  429

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GDT+AS+ G   G ++W  T KKT+EGT   I + + A +++L   ++       
Sbjct  430  LAVGVGDTIASVFGSTMGEIKWPGT-KKTVEGTMTAIFAQIIAVALILIFDSSVN--LNS  486

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPL  286
            +   +L++VTL  LLEAYT Q+DN  +PL
Sbjct  487  SYAWILVSVTLVSLLEAYTTQIDNLLLPL  515



>gb|KFO99048.1| Dolichol kinase, partial [Calypte anna]
Length=522

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 91/149 (61%), Gaps = 11/149 (7%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL----SSGFNDRP----LAPFAGI  553
            G+ L Q ++ F D RDS  LI++H  LLLG +LP+WL     +     P    LAP++G+
Sbjct  370  GQTLRQLLSLFLDERDSGPLILTHIYLLLGMSLPVWLFPRSCAPKGTLPGVGALAPYSGV  429

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GDT+AS+ G   G ++W  T KKT+EGT   I + + A +++L   ++       
Sbjct  430  LAVGVGDTIASVFGSTMGEIKWPGT-KKTVEGTMTAIFAQIIAVALILIFDSSVN--LNS  486

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPL  286
            +   +L++VTL  LLEAYT Q+DN  +PL
Sbjct  487  SYAWILVSVTLVSLLEAYTTQIDNLLLPL  515



>ref|XP_002110921.1| hypothetical protein TRIADDRAFT_54357 [Trichoplax adhaerens]
 gb|EDV26925.1| hypothetical protein TRIADDRAFT_54357 [Trichoplax adhaerens]
Length=493

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 83/149 (56%), Gaps = 6/149 (4%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSS-----GFNDRPLAPFAGILSL  544
            G  +H  +  F D RDS ++I++H  LL+GCALP+WL          D     +AG++SL
Sbjct  337  GPWIHDHLQIFIDTRDSGIVILTHIYLLVGCALPLWLCQSTSVLNVTDNVALMYAGVMSL  396

Query  543  GIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlf  364
            GIGDT ASLVG   G  RW     +T+EGTA  + S+L    +L  +       F  N  
Sbjct  397  GIGDTFASLVGITIGKRRWPG-NNRTLEGTAGSVLSMLLLYYLLWHIGGEKFIKFGGNWQ  455

Query  363  slllavtlsglLEAYTAQLDNAFIPLMFY  277
            +++LA  ++ L EA T Q+DN  +PL+ Y
Sbjct  456  TIILAFIITSLTEALTTQIDNLILPLVLY  484



>ref|NP_001172797.1| Os02g0142250 [Oryza sativa Japonica Group]
 dbj|BAH91526.1| Os02g0142250, partial [Oryza sativa Japonica Group]
Length=58

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  672  DHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDTMAS  520
            D  ++  ++ SHFSLLLGCALP W+SSGFNDRPL PFAGILSLGIGDTM S
Sbjct  3    DRPNTIFVLFSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGDTMVS  53



>ref|XP_006817759.1| PREDICTED: dolichol kinase-like [Saccoglossus kowalevskii]
Length=259

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 86/152 (57%), Gaps = 20/152 (13%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDR--PLAPFAGILSLGIG  535
            G+ LH   + F D RD  + I++H  LLLG +LP+WL    +D+   L  ++G+LSLGIG
Sbjct  113  GEALHDAFSVFIDDRDVGIPILTHIYLLLGFSLPVWLYPLQHDQGCTLLMYSGVLSLGIG  172

Query  534  DTMASLVGHKYGVLRWSKTGKKTIEGTAAGIT------SVLAACSILLPLLATTGYIFTK  373
            DT A+L G  YG  +W  + KKT EGTAA I        +L+ C + +P  A+   IF  
Sbjct  173  DTAAALFGSMYGHYKWPGS-KKTKEGTAAAIVLQILFCCLLSLCGVKIPSWASV--IFA-  228

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
                    V  + LLE++T+Q+DN  +PL  Y
Sbjct  229  --------VVCTSLLESFTSQIDNIILPLFMY  252



>gb|KDN39447.1| hypothetical protein K437DRAFT_239479 [Tilletiaria anomala UBC 
951]
Length=899

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 7/108 (6%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL-SSGFNDRPLAPFAGILSLGIG  535
            LG  LH FM+ F DH+DS  +I+SHF LL GCALP+WL SS F  R     +G L LG+G
Sbjct  755  LGAPLHIFMSEFLDHKDSGPVILSHFYLLSGCALPLWLESSTFVTR----CSGTLVLGVG  810

Query  534  DTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATT  391
            D +AS++G +YG L W  +  KT+EG+AA I+S+   C + L  LA +
Sbjct  811  DALASVIGRRYGRLHWPFS-SKTVEGSAAFISSIY-FCGLALQRLAPS  856



>dbj|GAC98366.1| tRNA dihydrouridine synthase [Pseudozyma hubeiensis SY62]
Length=1174

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 82/145 (57%), Gaps = 7/145 (5%)
 Frame = -3

Query  711   LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
              G  LH F++ F DH+DS  +I+SHF LL GCA P+WL    + R L    G+L LG+GD
Sbjct  1029  FGAALHVFISEFLDHKDSGPVILSHFYLLTGCAGPLWLEG--HSRILQQ-TGVLVLGVGD  1085

Query  531   TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             ++AS+VG +YG   W     KT+EGT A ITS++A+      LL   G+    +      
Sbjct  1086  SLASVVGRRYGRTYWPGGSSKTVEGTVAFITSIMASAW----LLRLVGWCEKFDSIKYFA  1141

Query  351   avtlsglLEAYTAQLDNAFIPLMFY  277
              VT  GLLE  + Q DN  +P+  Y
Sbjct  1142  VVTSLGLLEGVSDQHDNLVLPIFGY  1166



>ref|XP_006272364.1| PREDICTED: dolichol kinase [Alligator mississippiensis]
Length=523

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 87/149 (58%), Gaps = 11/149 (7%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL------SSGF--NDRPLAPFAGI  553
            G++L   ++ F D RDS  LI++H  LLLG +LP+WL        GF      L P++G+
Sbjct  370  GQMLRHLLSLFLDERDSGPLILTHIYLLLGMSLPVWLFPRPCAHKGFLSGTGALVPYSGV  429

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GDT+AS+ G   G ++W  T KKT EGT   I + + A +++L            
Sbjct  430  LAVGVGDTIASVFGSTMGEIKWPGT-KKTFEGTMTAIFAQIIAVALILIFDINVN--LNS  486

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPL  286
            +   +L +++L  LLEAYT Q+DN F+PL
Sbjct  487  SYAWILGSISLVSLLEAYTTQIDNLFLPL  515



>ref|XP_005982749.1| PREDICTED: dolichol kinase [Pantholops hodgsonii]
Length=538

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLAGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_011391647.1| hypothetical protein UMAG_04779 [Ustilago maydis 521]
 gb|KIS66715.1| hypothetical protein UMAG_04779 [Ustilago maydis 521]
Length=1142

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
 Frame = -3

Query  711   LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
              G +LH FM+ F DH+DS  +I+SHF LL GCA P+WL        +    G+L LG+GD
Sbjct  997   FGAVLHVFMSEFLDHKDSGPVILSHFYLLTGCAGPLWLEGHSR---IVQQTGVLVLGVGD  1053

Query  531   TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSIL  412
             ++AS+VG +YG   W     KT+EG+ A +TS++A+  +L
Sbjct  1054  SLASVVGRRYGRTYWPGGSSKTVEGSLAFVTSIMASAWLL  1093



>ref|NP_808316.1| dolichol kinase [Mus musculus]
 sp|Q8R2Y3.1|DOLK_MOUSE RecName: Full=Dolichol kinase; AltName: Full=Transmembrane protein 
15 [Mus musculus]
 gb|AAH26973.1| Dolichol kinase [Mus musculus]
 dbj|BAE26024.1| unnamed protein product [Mus musculus]
 gb|EDL08455.1| transmembrane protein 15 [Mus musculus]
 dbj|BAF82000.1| human KIAA1094 protein homologue [Mus musculus]
Length=534

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  380  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKDSLEGARALVPYAG  439

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  440  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  495

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  496  NYSYAWILGSISTVSLLEAYTTQIDN  521



>ref|XP_638216.1| hypothetical protein DDB_G0285689 [Dictyostelium discoideum AX4]
 gb|EAL64682.1| hypothetical protein DDB_G0285689 [Dictyostelium discoideum AX4]
Length=635

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 89/155 (57%), Gaps = 15/155 (10%)
 Frame = -3

Query  699  LHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL----------SSGFNDRP---LAPFA  559
            +  +M+ F D RDS L+  +H  LLLGC++P++L          SSG        L+PF+
Sbjct  477  IRHYMDRFLDDRDSGLITTTHIYLLLGCSIPLFLTFFMDLIHLGSSGIQSNSYHFLSPFS  536

Query  558  GILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIF  379
            GIL++GIGDTMAS  G KYG  +W  + +K+IEGT AG    + A  +L    + +G   
Sbjct  537  GILTIGIGDTMASYFGVKYGRNKWFGS-QKSIEGTVAGSIFTIIASLLLYWFCSASGSSL  595

Query  378  T-KNlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
            T  ++  +++  T   L+EA T Q+DN  +PL ++
Sbjct  596  TISSILKIIVTSTSCSLMEASTTQIDNLILPLFYF  630



>ref|XP_007527131.1| PREDICTED: dolichol kinase [Erinaceus europaeus]
Length=543

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  389  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  448

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLA-ACSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  449  VLAVGVGDTVASICGSTMGEIRWPGT-KKTFEGT---MTSIFAQVISVALILIFDSGVDL  504

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  505  NYSYAWILGSISTVSLLEAYTTQIDN  530



>ref|XP_004879784.1| PREDICTED: dolichol kinase [Heterocephalus glaber]
 ref|XP_004849216.1| PREDICTED: dolichol kinase [Heterocephalus glaber]
 gb|EHA99940.1| Dolichol kinase [Heterocephalus glaber]
Length=538

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTVGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   LL +++   LLEAYT+Q+DN
Sbjct  500  NYSYTWLLGSISAVSLLEAYTSQIDN  525



>ref|XP_004713321.1| PREDICTED: dolichol kinase [Echinops telfairi]
Length=538

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHPLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCSQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT+Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTSQIDN  525



>dbj|GAN04081.1| diacylglycerol o-acyltransferase [Mucor ambiguus]
Length=1059

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 5/107 (5%)
 Frame = -3

Query  708   GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
             GK LH F+  F D+RD   +I+SH  LLLGCA P+WL S      LA  +GILSLG GD 
Sbjct  958   GKSLHVFLTEFIDNRDLGPVILSHIYLLLGCASPVWLGSS---NVLASLSGILSLGFGDA  1014

Query  528   MASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTG  388
              AS++G ++G  RW  T KKT+EGTAA + + +   ++LL L    G
Sbjct  1015  AASIIGKRFGRYRWPGT-KKTVEGTAAFVIA-MELLAMLLRLAEVNG  1059



>ref|XP_002935551.1| PREDICTED: dolichol kinase isoform X1 [Xenopus (Silurana) tropicalis]
 ref|XP_004916746.1| PREDICTED: dolichol kinase isoform X2 [Xenopus (Silurana) tropicalis]
Length=521

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 17/151 (11%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL------SSGFNDRPLAPFAGILS  547
            G+ L   +  F D RDS  LI++H  LLLG +LP+WL      +S      L P+AG+L+
Sbjct  370  GQTLRNLLTLFLDERDSGPLILTHIYLLLGMSLPVWLFPRVCATSLTGSSTLLPYAGVLA  429

Query  546  LGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLAT----TGYIF  379
            +G+GDT+AS+ G   G LRW  T KKT EGT   I + + A +++L   ++    +GY++
Sbjct  430  VGVGDTVASVCGSAMGELRWPGT-KKTFEGTMMSIFAQIIAAALILIFDSSVNLNSGYVW  488

Query  378  TKNlfslllavtlsglLEAYTAQLDNAFIPL  286
                     ++TL  LLEA+T Q+DN  +PL
Sbjct  489  ILG------SITLVSLLEAFTTQIDNLVLPL  513



>gb|ACA57898.1| transmembrane protein 15 (predicted) [Callicebus moloch]
Length=538

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_008577675.1| PREDICTED: dolichol kinase [Galeopterus variegatus]
Length=538

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_001928954.1| PREDICTED: dolichol kinase [Sus scrofa]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_004332137.1| PREDICTED: LOW QUALITY PROTEIN: dolichol kinase [Tursiops truncatus]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_004269170.1| PREDICTED: dolichol kinase [Orcinus orca]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_003794961.1| PREDICTED: dolichol kinase [Otolemur garnettii]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LP+WL         S    R L P+AG
Sbjct  384  LGHTLRNLLSLFLDERDSGPLILTHIYLLLGMSLPVWLVPRPCTQKGSFGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYTWILGSISTVSLLEAYTTQIDN  525



>ref|XP_010349052.1| PREDICTED: dolichol kinase [Saimiri boliviensis boliviensis]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASVFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>gb|KIJ14276.1| hypothetical protein PAXINDRAFT_135282 [Paxillus involutus ATCC 
200175]
Length=797

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 81/145 (56%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F D +D    I+SHF LL GCA  +WL      R L  + GIL+LG+GD
Sbjct  652  FGAAVHLFMNEFLDQKDRGTAILSHFYLLTGCAGSVWLEG--PSRFLL-YTGILALGVGD  708

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             MAS+VG + G  RWS +  KT+EG+AA + S L  C+ +L LL  T    T        
Sbjct  709  AMASIVGKRIGRHRWSTSSSKTVEGSAAFVVS-LVMCAWVLRLLGLTEDFSTVR---YGA  764

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
             V LS +LEA + Q DN  +PL  +
Sbjct  765  VVGLSSVLEALSDQNDNLTLPLYMW  789



>ref|XP_006181973.1| PREDICTED: dolichol kinase [Camelus ferus]
 ref|XP_010949536.1| PREDICTED: dolichol kinase [Camelus bactrianus]
 ref|XP_010982547.1| PREDICTED: dolichol kinase [Camelus dromedarius]
 gb|EPY83308.1| dolichol kinase [Camelus ferus]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQNGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_006205500.1| PREDICTED: dolichol kinase [Vicugna pacos]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>gb|ABY84169.1| transmembrane protein 15 (predicted) [Callithrix jacchus]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_003514016.1| PREDICTED: dolichol kinase [Cricetulus griseus]
 ref|XP_007632622.1| PREDICTED: dolichol kinase [Cricetulus griseus]
 gb|EGW14161.1| Dolichol kinase [Cricetulus griseus]
 gb|ERE71282.1| dolichol kinase-like protein [Cricetulus griseus]
Length=536

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  382  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKDSLGGARALVPYAG  441

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  442  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  497

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  498  NYSYAWILGSISTVSLLEAYTTQIDN  523



>emb|CDH60498.1| peptide chain release factor 1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1077

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 92/154 (60%), Gaps = 15/154 (10%)
 Frame = -3

Query  708   GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGDT  529
             GK +H F+  F D RD   +I+SH  LLLGCA P+WL+S      LA  +GIL+LG GDT
Sbjct  922   GKSIHLFLAEFIDSRDLGPVILSHIYLLLGCAAPVWLNSS---NLLASVSGILALGFGDT  978

Query  528   MASLVGHKYGVLRWSKTG-KKTIEGTAAGITSVLAAC------SILLPLLATTGYIF---  379
              AS+VG +YG  RW   G KKT+EGT A + ++ A+       S  L + + T +I    
Sbjct  979   AASIVGKRYG--RWHWPGSKKTVEGTMAFVVTMYASAVLIMYGSAFLGIHSATHFIVSMT  1036

Query  378   TKNlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
             + +  + L+  +L+GLLEA ++Q DN  IPL  +
Sbjct  1037  SADWAAFLITASLTGLLEALSSQNDNIIIPLYIF  1070



>ref|NP_001270562.1| uncharacterized protein LOC101925965 [Macaca fascicularis]
 dbj|BAE91315.1| unnamed protein product [Macaca fascicularis]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|NP_001162452.1| dolichol kinase [Papio anubis]
 ref|NP_001253847.1| dolichol kinase [Macaca mulatta]
 ref|XP_008004189.1| PREDICTED: dolichol kinase [Chlorocebus sabaeus]
 gb|ABY56110.1| dolichol kinase (predicted) [Papio anubis]
 gb|EHH23758.1| hypothetical protein EGK_07298 [Macaca mulatta]
 gb|EHH57059.1| hypothetical protein EGM_06620 [Macaca fascicularis]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_010359211.1| PREDICTED: dolichol kinase [Rhinopithecus roxellana]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHALRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_005687279.1| PREDICTED: dolichol kinase [Capra hircus]
Length=538

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|NP_001030442.2| dolichol kinase [Bos taurus]
 ref|XP_005908840.1| PREDICTED: dolichol kinase [Bos mutus]
 ref|XP_006065385.1| PREDICTED: dolichol kinase [Bubalus bubalis]
 ref|XP_010855115.1| PREDICTED: dolichol kinase [Bison bison bison]
 sp|Q58CR4.1|DOLK_BOVIN RecName: Full=Dolichol kinase; AltName: Full=Transmembrane protein 
15 [Bos taurus]
 gb|AAX46730.1| transmembrane protein 15 [Bos taurus]
 gb|AAI26570.1| DOLK protein [Bos taurus]
 tpg|DAA24174.1| TPA: dolichol kinase [Bos taurus]
 gb|ELR46832.1| Dolichol kinase [Bos mutus]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_007103846.1| PREDICTED: dolichol kinase [Physeter catodon]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_004005635.1| PREDICTED: dolichol kinase [Ovis aries]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|NP_001101296.1| dolichol kinase [Rattus norvegicus]
 gb|EDL93328.1| transmembrane protein 15 (predicted) [Rattus norvegicus]
Length=536

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  382  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCAQKGSLGGARALVPYAG  441

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  442  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  497

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  498  NYSYAWILGSISTVSLLEAYTTQIDN  523



>ref|XP_008039045.1| hypothetical protein TRAVEDRAFT_21010 [Trametes versicolor FP-101664 
SS1]
 gb|EIW57386.1| hypothetical protein TRAVEDRAFT_21010 [Trametes versicolor FP-101664 
SS1]
Length=672

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 77/145 (53%), Gaps = 7/145 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            LG  +H FMN F D +D    I+SHF LL GCA  +W         L  F G L LG+GD
Sbjct  525  LGAAVHLFMNEFLDSKDGGTAILSHFYLLTGCANSVWFE---GPSRLLQFTGTLVLGVGD  581

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
             +AS+VG + G  RW     KTIEG+AA +TSV  AC+    LL   G     ++    +
Sbjct  582  ALASIVGKRLGRHRWFAANPKTIEGSAAFVTSV-CACAW---LLRVCGVAEDFSVGRYAV  637

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
               L+  LEA++ Q DN  +PL  +
Sbjct  638  VGGLAAALEAFSVQNDNVTLPLYMW  662



>ref|XP_005085543.1| PREDICTED: dolichol kinase [Mesocricetus auratus]
Length=536

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  382  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKDSLGGARALVPYAG  441

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  442  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  497

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  498  NYSYAWILGSISTVSLLEAYTTQIDN  523



>ref|XP_007471862.1| PREDICTED: dolichol kinase [Lipotes vexillifer]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHALRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_005346195.1| PREDICTED: dolichol kinase [Microtus ochrogaster]
Length=536

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  382  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCAQKDSLGGARALVPYAG  441

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  442  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  497

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  498  NYSYAWILGSISTVSLLEAYTTQIDN  523



>ref|XP_007942437.1| PREDICTED: dolichol kinase [Orycteropus afer afer]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASVFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_007256629.1| PREDICTED: dolichol kinase [Astyanax mexicanus]
Length=524

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 83/145 (57%), Gaps = 11/145 (8%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSG--------FNDRPLAPFAG  556
            LG  L + +  F D RDS  LI++H  LLLG +LP+WL+ G             L P+AG
Sbjct  370  LGAPLRRLLTLFLDERDSGPLILTHIYLLLGVSLPLWLTPGPCTPKGGLGGAGGLVPYAG  429

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFT  376
            +L++GIGDT+AS+ G   G +RW  T KKT EGTA  + + + A +I   L+A       
Sbjct  430  VLAVGIGDTVASVFGSTVGEIRWPGT-KKTFEGTATSVFAQVIAVAIF--LIADASINLN  486

Query  375  KNlfslllavtlsglLEAYTAQLDN  301
             +   ++ ++ +  +LEAYT Q+DN
Sbjct  487  ASYSWVVGSIAMVAMLEAYTLQIDN  511



>ref|XP_008046802.1| PREDICTED: dolichol kinase [Tarsius syrichta]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LP+WL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPVWLIPRPCAQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NHSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_007194596.1| PREDICTED: dolichol kinase [Balaenoptera acutorostrata scammoni]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 84/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L  ++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGCISTVSLLEAYTTQIDN  525



>ref|XP_006918105.1| PREDICTED: dolichol kinase [Pteropus alecto]
 gb|ELK07256.1| Dolichol kinase [Pteropus alecto]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDTMAS+ G   G + W  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTMASIFGSTMGEIHWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L ++++  LLEAYT Q+DN
Sbjct  500  NDSYAWILGSISMVSLLEAYTTQIDN  525



>ref|XP_008824325.1| PREDICTED: dolichol kinase [Nannospalax galili]
Length=538

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHPLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLEGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_004463151.1| PREDICTED: dolichol kinase [Dasypus novemcinctus]
 gb|ACO15816.1| transmembrane protein 15 (predicted) [Dasypus novemcinctus]
Length=537

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  383  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  442

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  443  VLAVGVGDTVASVFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  498

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  499  NYSYAWILGSISTVSLLEAYTTQIDN  524



>ref|XP_006024405.1| PREDICTED: dolichol kinase [Alligator sinensis]
Length=523

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 88/153 (58%), Gaps = 19/153 (12%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP------------LAP  565
            G++L   ++ F D RDS  LI++H  LLLG +LP+WL      RP            L P
Sbjct  370  GQMLRHLLSLFLDERDSGPLILTHIYLLLGMSLPVWL----FPRPCAHKGVLSGTGALVP  425

Query  564  FAGILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGY  385
            ++G+L++G+GDT+AS+ G   G ++W  T KKT EGT   I + + A +++  L+     
Sbjct  426  YSGVLAVGVGDTIASVFGSTMGEIKWPGT-KKTFEGTMTAIFAQIIAVALI--LIFDINV  482

Query  384  IFTKNlfslllavtlsglLEAYTAQLDNAFIPL  286
                +   +L +++L  LLEAYT Q+DN F+PL
Sbjct  483  NLNSSYAWILGSISLVSLLEAYTTQIDNLFLPL  515



>ref|XP_006172139.1| PREDICTED: LOW QUALITY PROTEIN: dolichol kinase [Tupaia chinensis]
Length=540

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LP+WL         S    R L P+AG
Sbjct  386  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPVWLVPRPCTQKGSLGGARALVPYAG  445

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  446  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  501

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  502  NYSYAWILGSISTVSLLEAYTTQIDN  527



>ref|XP_003738877.1| PREDICTED: dolichol kinase-like [Metaseiulus occidentalis]
Length=213

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 80/146 (55%), Gaps = 10/146 (7%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSG----FNDRPLAPFAGILSL  544
            LG  + +  +AF D +D   L+VSH  LLLGC+LP  L  G     +   L    G+  L
Sbjct  64   LGSSIQKIFDAFLDEKDQGPLVVSHIYLLLGCSLPFLLYPGEDYSRDGVTLTLLTGVTIL  123

Query  543  GIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlf  364
            G+GDT+A++ G +YG  RW  + KKT+EGT A I + LA C    P+ A   + F K   
Sbjct  124  GVGDTVAAVFGARYGRTRWPNS-KKTLEGTLAAIVAQLAFCMFFAPVTADIVF-FAK---  178

Query  363  slllavtlsglLEAYTAQLDNAFIPL  286
             L + + LS  LEA T Q DN  +PL
Sbjct  179  -LSVILVLSSCLEATTEQNDNLAVPL  203



>ref|XP_009072581.1| PREDICTED: dolichol kinase [Acanthisitta chloris]
Length=523

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 87/149 (58%), Gaps = 11/149 (7%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAGI  553
            G+ L Q ++ F D RDS  LI++H  LLLG +LP+WL         S      L P++G+
Sbjct  370  GQTLRQLLSLFLDERDSGPLILTHIYLLLGMSLPVWLFPRSCAPKGSLSGAGALVPYSGV  429

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GDT+AS+ G   G ++W  T KKT EGT   I + + A +++L   ++       
Sbjct  430  LAVGVGDTIASVFGSSMGEIKWPGT-KKTFEGTMTAIFAQIIAVALILIFDSSVN--LNS  486

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPL  286
            +   +L +V+L  LLEAYT Q+DN  +PL
Sbjct  487  SYAWILASVSLVSLLEAYTTQIDNLLLPL  515



>ref|XP_004423608.1| PREDICTED: dolichol kinase [Ceratotherium simum simum]
Length=538

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LP+WL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPVWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSAMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L ++++  LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISIVSLLEAYTTQIDN  525



>gb|KFP79949.1| Dolichol kinase, partial [Acanthisitta chloris]
Length=522

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 87/149 (58%), Gaps = 11/149 (7%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAGI  553
            G+ L Q ++ F D RDS  LI++H  LLLG +LP+WL         S      L P++G+
Sbjct  370  GQTLRQLLSLFLDERDSGPLILTHIYLLLGMSLPVWLFPRSCAPKGSLSGAGALVPYSGV  429

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GDT+AS+ G   G ++W  T KKT EGT   I + + A +++L   ++       
Sbjct  430  LAVGVGDTIASVFGSSMGEIKWPGT-KKTFEGTMTAIFAQIIAVALILIFDSSVN--LNS  486

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPL  286
            +   +L +V+L  LLEAYT Q+DN  +PL
Sbjct  487  SYAWILASVSLVSLLEAYTTQIDNLLLPL  515



>ref|XP_004677320.1| PREDICTED: dolichol kinase [Condylura cristata]
Length=538

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LP+WL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPVWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTIGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_004640527.1| PREDICTED: dolichol kinase [Octodon degus]
Length=536

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  382  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGVRALVPYAG  441

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  442  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  497

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   LL +++   LLEAYT Q+DN
Sbjct  498  NYSYAWLLGSISTVSLLEAYTTQIDN  523



>ref|XP_011362452.1| PREDICTED: dolichol kinase [Pteropus vampyrus]
Length=538

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDTMAS+ G   G + W  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTMASIFGSTMGEIYWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L ++++  LLEAYT Q+DN
Sbjct  500  NDSYAWILGSISMVSLLEAYTTQIDN  525



>ref|XP_005413657.1| PREDICTED: dolichol kinase [Chinchilla lanigera]
Length=538

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGVRALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   LL +++   LLEAYT Q+DN
Sbjct  500  NYSYAWLLGSISAVSLLEAYTTQIDN  525



>ref|XP_010227041.1| PREDICTED: dolichol kinase [Tinamus guttatus]
Length=523

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 88/153 (58%), Gaps = 19/153 (12%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP------------LAP  565
            G+ L   ++ F D RDS  LI++H  LLLG +LP+WL      RP            L P
Sbjct  370  GQTLRHLLSLFLDERDSGPLILTHIYLLLGMSLPVWL----FPRPCAPKGTLSGAGALVP  425

Query  564  FAGILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGY  385
            ++G+L++G+GDTMAS++G   G ++W  T KKT EGT   I + + A +++L   ++   
Sbjct  426  YSGVLAVGVGDTMASVLGSTMGEIKWPGT-KKTFEGTMMAIFAQIIAVALILIFDSSVN-  483

Query  384  IFTKNlfslllavtlsglLEAYTAQLDNAFIPL  286
                +   +L +V+L  LLEAYT Q+DN  +PL
Sbjct  484  -LNSSYAWILGSVSLVSLLEAYTTQIDNLLLPL  515



>gb|KGL72442.1| Dolichol kinase, partial [Tinamus guttatus]
Length=522

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 88/153 (58%), Gaps = 19/153 (12%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP------------LAP  565
            G+ L   ++ F D RDS  LI++H  LLLG +LP+WL      RP            L P
Sbjct  370  GQTLRHLLSLFLDERDSGPLILTHIYLLLGMSLPVWL----FPRPCAPKGTLSGAGALVP  425

Query  564  FAGILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGY  385
            ++G+L++G+GDTMAS++G   G ++W  T KKT EGT   I + + A +++L   ++   
Sbjct  426  YSGVLAVGVGDTMASVLGSTMGEIKWPGT-KKTFEGTMMAIFAQIIAVALILIFDSSVN-  483

Query  384  IFTKNlfslllavtlsglLEAYTAQLDNAFIPL  286
                +   +L +V+L  LLEAYT Q+DN  +PL
Sbjct  484  -LNSSYAWILGSVSLVSLLEAYTTQIDNLLLPL  515



>gb|ACC64536.1| transmembrane protein 15 (predicted) [Rhinolophus ferrumequinum]
Length=538

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 84/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   +  F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLCLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKDSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NHSYAWILGSISTVSLLEAYTTQIDN  525



>ref|XP_009048761.1| hypothetical protein LOTGIDRAFT_96453, partial [Lottia gigantea]
 gb|ESP00642.1| hypothetical protein LOTGIDRAFT_96453, partial [Lottia gigantea]
Length=204

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 15/155 (10%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSG-------FN---DRPLAPF  562
            LG ++ Q  + F D RD  ++I++H  LL+G +LP+WL+         FN      ++ +
Sbjct  52   LGCVIDQSFSMFIDDRDQGVVILTHLYLLIGLSLPLWLTKSLYKGMKHFNFEMTTSISLY  111

Query  561  AGILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYI  382
            +G+LSLGIGDT+AS++G   G + W  + KKT+EGT + I S      IL  L    G I
Sbjct  112  SGVLSLGIGDTVASIIGSSIGRIHWPGS-KKTVEGTTSSIFSQCLTVYILYSL----GII  166

Query  381  FTKNlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
             T     +++A+ L+ L EA+T Q+DN  +P+  +
Sbjct  167  ETVYWQKVIMAIILTSLYEAFTFQIDNLVLPVFIF  201



>ref|XP_010625639.1| PREDICTED: dolichol kinase [Fukomys damarensis]
 gb|KFO31913.1| Dolichol kinase [Fukomys damarensis]
Length=538

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LP+WL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPVWLIPRPCAQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT EGT   +TS+ A   S+ L L+  +G   
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTFEGT---MTSIFAQIISVALILIFDSGVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   LL +++   LLEAYT Q+DN
Sbjct  500  NYSYAWLLGSISTVSLLEAYTTQIDN  525



>gb|KDQ19948.1| hypothetical protein BOTBODRAFT_101902 [Botryobasidium botryosum 
FD-172 SS1]
Length=550

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 7/143 (5%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             G  +H FMN F D +D   +I+SHF LL GCA  +WL      R LA   G+L LG+GD
Sbjct  401  FGASVHLFMNEFLDEKDGGTVILSHFYLLTGCAGSVWLEG--PSRILA-LTGVLVLGVGD  457

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            ++AS+VG ++G  RWS +  KTIEG+ A  T VLA+      LL+  G + + ++    L
Sbjct  458  SLASVVGKRHGRHRWSASTPKTIEGSVAFATCVLASAW----LLSVFGLVESFSIPRYAL  513

Query  351  avtlsglLEAYTAQLDNAFIPLM  283
            AV    +LEA + Q DN  +P  
Sbjct  514  AVGFGSVLEALSLQNDNLVLPFF  536



>ref|XP_009683324.1| PREDICTED: dolichol kinase [Struthio camelus australis]
Length=523

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 19/153 (12%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP------------LAP  565
            G+ L   ++ F D RDS  LI++H  LLLG +LP+WL      RP            L P
Sbjct  370  GQTLRHLLSLFLDERDSGPLILTHIYLLLGMSLPVWL----FPRPCAPKGVLSGAGALVP  425

Query  564  FAGILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGY  385
            ++G+L++G+GDTMAS+ G   G ++W  T KKT EGT   I + + A +++L   ++   
Sbjct  426  YSGVLAVGVGDTMASVFGSAMGEIKWPGT-KKTFEGTMTAIFAQIIAVALILIFDSSVN-  483

Query  384  IFTKNlfslllavtlsglLEAYTAQLDNAFIPL  286
                +   +L +V+L  LLEAYT Q+DN  +PL
Sbjct  484  -LNSSYAWILGSVSLVSLLEAYTTQIDNLLLPL  515



>gb|KFH63327.1| hypothetical protein MVEG_10737 [Mortierella verticillata NRRL 
6337]
Length=1074

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 4/111 (4%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
             GK +H F+  F D RD   +I+SH  LL+GCA P+WL+       LA  +GI +LG+GD
Sbjct  864  FGKEIHLFLVGFLDERDGGPIILSHLYLLMGCAAPVWLA---EHHILAGLSGIFALGVGD  920

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIF  379
             MAS+VG ++G  RW  T  KT+EGT A + SV+AA   +   +    ++F
Sbjct  921  AMASIVGKRFGRHRWPGT-IKTVEGTMAFVGSVMAAAGAIFVGMWLMSFVF  970



>gb|KFV86493.1| Dolichol kinase, partial [Struthio camelus australis]
Length=522

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 19/153 (12%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRP------------LAP  565
            G+ L   ++ F D RDS  LI++H  LLLG +LP+WL      RP            L P
Sbjct  370  GQTLRHLLSLFLDERDSGPLILTHIYLLLGMSLPVWL----FPRPCAPKGVLSGAGALVP  425

Query  564  FAGILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGY  385
            ++G+L++G+GDTMAS+ G   G ++W  T KKT EGT   I + + A +++L   ++   
Sbjct  426  YSGVLAVGVGDTMASVFGSAMGEIKWPGT-KKTFEGTMTAIFAQIIAVALILIFDSSVN-  483

Query  384  IFTKNlfslllavtlsglLEAYTAQLDNAFIPL  286
                +   +L +V+L  LLEAYT Q+DN  +PL
Sbjct  484  -LNSSYAWILGSVSLVSLLEAYTTQIDNLLLPL  515



>dbj|GAK66682.1| dolichol kinase [Pseudozyma antarctica]
Length=1160

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  711   LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
              G  LH FM+ F DH+DS  +I+SHF LL GCA P+WL    N R L    G+L LG+GD
Sbjct  1015  FGAALHVFMSEFLDHKDSGPVILSHFYLLTGCAGPLWLEG--NSRILQQ-TGVLVLGVGD  1071

Query  531   TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
              +AS+VG +YG + W     KT+EG+ A + S++ A   L       G++   +      
Sbjct  1072  ALASVVGRRYGRVYWPGGSSKTVEGSLAFVGSIMVAAWALR----LVGWVEDFSSLKYGA  1127

Query  351   avtlsglLEAYTAQLDNAFIPLMFY  277
              VT  GLLE  + Q DN  +P+  Y
Sbjct  1128  VVTALGLLEGVSDQHDNLVLPIFGY  1152



>gb|ENN71694.1| hypothetical protein YQE_11617, partial [Dendroctonus ponderosae]
Length=472

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 86/154 (56%), Gaps = 12/154 (8%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL---------SSGFNDRPLAPFA  559
            +GK L +    F D +D+ LL ++   LL G +LPIWL         S  F   PL   +
Sbjct  318  VGKQLQKGFEIFKDEKDAGLLALTPIYLLAGVSLPIWLHPSPCDVTNSVQFTVLPL--LS  375

Query  558  GILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIF  379
            GILS+G+GDT AS  G  +G L+W+ +  KT+EGT A + S L  C  L  +     YI 
Sbjct  376  GILSIGVGDTAASYFGSSFGRLKWANS-SKTVEGTLACVLSQLGVCYFLHWISGFPAYIS  434

Query  378  TKNlfslllavtlsglLEAYTAQLDNAFIPLMFY  277
             ++L  L++++    ++EA T+Q+DN  +PL+ Y
Sbjct  435  PQDLVKLVVSIFAVSIVEAKTSQIDNLVLPLIMY  468



>ref|XP_004375794.1| PREDICTED: dolichol kinase-like [Trichechus manatus latirostris]
Length=538

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 13/146 (9%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL--------SSGFNDRPLAPFAG  556
            LG  L   ++ F D RDS  LI++H  LLLG +LPIWL         S    R L P+AG
Sbjct  384  LGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVPYAG  443

Query  555  ILSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAA-CSILLPLLATTGYIF  379
            +L++G+GDT+AS+ G   G +RW  T KKT+EGT   +TSV A   S+ L L+  +    
Sbjct  444  VLAVGVGDTVASIFGSTMGEIRWPGT-KKTLEGT---MTSVFAQIISVALILIFDSEVDL  499

Query  378  TKNlfslllavtlsglLEAYTAQLDN  301
              +   +L +++   LLEAYT Q+DN
Sbjct  500  NYSYAWVLGSISTVSLLEAYTTQIDN  525



>ref|XP_009997212.1| PREDICTED: dolichol kinase [Chaetura pelagica]
Length=523

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 88/149 (59%), Gaps = 11/149 (7%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL----SSGFNDRP----LAPFAGI  553
            G+ L Q ++ F D RDS  LI++H  LLLG +LPIWL     +     P    L P++G+
Sbjct  370  GQTLRQLLSLFLDERDSGPLILTHIYLLLGMSLPIWLFPRSCAPKGTLPGAGALVPYSGV  429

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GDT+AS+ G   G ++W  T KKT EGT   I + + A +++L   ++       
Sbjct  430  LAVGVGDTIASVCGSTMGEIKWPGT-KKTFEGTMTAIFAQIIAVALILIFDSSVN--LNS  486

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPL  286
            +   +L +VTL  LLEAYT Q+DN  +PL
Sbjct  487  SYAWILASVTLVSLLEAYTTQIDNLLLPL  515



>gb|ETS60555.1| dolichol kinase [Pseudozyma aphidis DSM 70725]
Length=1158

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  711   LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
              G  LH FM+ F DH+DS  +I+SHF LL GCA P+WL    N R L    G+L LG+GD
Sbjct  1013  FGAALHVFMSEFLDHKDSGPVILSHFYLLTGCAGPLWLEG--NSRILQQ-TGVLVLGVGD  1069

Query  531   TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
              +AS+VG +YG + W     KT+EG+ A + S++ A   L       G++   +      
Sbjct  1070  ALASVVGRRYGRVYWPGGSSKTVEGSLAFVGSIMVAAWALR----LVGWVEDFSSLKYGA  1125

Query  351   avtlsglLEAYTAQLDNAFIPLMFY  277
              VT  GLLE  + Q DN  +P+  Y
Sbjct  1126  VVTALGLLEGVSDQHDNLVLPIFGY  1150



>gb|KFU90632.1| Dolichol kinase [Chaetura pelagica]
Length=527

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 88/149 (59%), Gaps = 11/149 (7%)
 Frame = -3

Query  708  GKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWL----SSGFNDRP----LAPFAGI  553
            G+ L Q ++ F D RDS  LI++H  LLLG +LPIWL     +     P    L P++G+
Sbjct  374  GQTLRQLLSLFLDERDSGPLILTHIYLLLGMSLPIWLFPRSCAPKGTLPGAGALVPYSGV  433

Query  552  LSLGIGDTMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTK  373
            L++G+GDT+AS+ G   G ++W  T KKT EGT   I + + A +++L   ++       
Sbjct  434  LAVGVGDTIASVCGSTMGEIKWPGT-KKTFEGTMTAIFAQIIAVALILIFDSSVN--LNS  490

Query  372  NlfslllavtlsglLEAYTAQLDNAFIPL  286
            +   +L +VTL  LLEAYT Q+DN  +PL
Sbjct  491  SYAWILASVTLVSLLEAYTTQIDNLLLPL  519



>gb|EMS26024.1| dolichol kinase [Rhodosporidium toruloides NP11]
 emb|CDR38434.1| RHTO0S03e09472g1_1 [Rhodosporidium toruloides]
Length=987

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 90/145 (62%), Gaps = 9/145 (6%)
 Frame = -3

Query  711  LGKLLHQFMNAFTDHRDSDLLIVSHFSLLLGCALPIWLSSGFNDRPLAPFAGILSLGIGD  532
            +G  LH F + F D +D+  +I+SHF LL GCA  +WL     +R    F G+L LG+GD
Sbjct  844  IGAPLHIFFSEFVDSKDNGPVIISHFYLLTGCAGGVWLEGKGINR----FTGVLVLGVGD  899

Query  531  TMASLVGHKYGVLRWSKTGKKTIEGTAAGITSVLAACSILLPLLATTGYIFTKNlfslll  352
            ++AS+VG   G  RW  T  KT+EGTAA + SV+  CS LL L+   G + + +L   +L
Sbjct  900  SLASIVGKLVGRTRWPGT-SKTVEGTAAFVASVV-LCSWLLRLI---GVVPSFSLPRYIL  954

Query  351  avtlsglLEAYTAQLDNAFIPLMFY  277
            AVTL+GLLEA + Q DN  IPL  +
Sbjct  955  AVTLAGLLEASSTQNDNLVIPLYMW  979



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380