BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001N14

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             271   3e-86   
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      271   3e-86   Populus euphratica
gb|KDP29212.1|  hypothetical protein JCGZ_16601                         268   5e-85   Jatropha curcas
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    268   6e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        267   2e-84   Tarenaya hassleriana [spider flower]
emb|CDX95399.1|  BnaC04g27590D                                          267   2e-84   
emb|CDY70033.1|  BnaCnng66420D                                          262   3e-84   Brassica napus [oilseed rape]
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      266   3e-84   Vitis vinifera
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             266   3e-84   Capsella rubella
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      265   1e-83   Brassica rapa
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    265   2e-83   Camelina sativa [gold-of-pleasure]
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      263   2e-83   Glycine soja [wild soybean]
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    264   3e-83   Glycine max [soybeans]
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             264   3e-83   Eutrema salsugineum [saltwater cress]
ref|XP_002519426.1|  o-methyltransferase, putative                      262   1e-82   Ricinus communis
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             262   2e-82   Eutrema salsugineum [saltwater cress]
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    262   2e-82   Arabis alpina [alpine rockcress]
emb|CAN65776.1|  hypothetical protein VITISV_030414                     261   3e-82   Vitis vinifera
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              261   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    260   8e-82   
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      259   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    259   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        259   2e-81   Nicotiana tomentosiformis
emb|CBI30187.3|  unnamed protein product                                251   3e-81   Vitis vinifera
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      257   1e-80   Prunus mume [ume]
gb|KJB62320.1|  hypothetical protein B456_009G411600                    257   2e-80   Gossypium raimondii
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     254   2e-80   Eucalyptus grandis [rose gum]
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    256   4e-80   Eucalyptus grandis [rose gum]
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     255   4e-80   Eucalyptus grandis [rose gum]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             256   7e-80   Prunus persica
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    255   1e-79   Solanum lycopersicum
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      250   6e-79   
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             253   6e-79   Phaseolus vulgaris [French bean]
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    253   7e-79   Solanum tuberosum [potatoes]
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      252   1e-78   Gossypium arboreum [tree cotton]
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    251   4e-78   Pyrus x bretschneideri [bai li]
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    251   4e-78   Pyrus x bretschneideri [bai li]
ref|XP_007027514.1|  O-methyltransferase family protein                 250   6e-78   
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 250   7e-78   Morus notabilis
gb|KEH38506.1|  caffeic acid O-methyltransferase                        250   8e-78   Medicago truncatula
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    249   1e-77   Cicer arietinum [garbanzo]
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      247   1e-76   Fragaria vesca subsp. vesca
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      245   1e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    242   3e-74   Elaeis guineensis
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       238   4e-73   Cucumis sativus [cucumbers]
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      237   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    234   6e-72   Sesamum indicum [beniseed]
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      233   3e-71   Cucumis melo [Oriental melon]
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    234   6e-71   
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    227   5e-69   Solanum tuberosum [potatoes]
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   221   4e-68   Citrus sinensis [apfelsine]
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      224   6e-68   Brachypodium distachyon [annual false brome]
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             222   2e-67   Citrus clementina [clementine]
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    222   2e-67   
gb|ACN25427.1|  unknown                                                 222   6e-67   Zea mays [maize]
gb|KJB62323.1|  hypothetical protein B456_009G411600                    221   6e-67   Gossypium raimondii
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             219   1e-66   
ref|NP_001149617.1|  LOC100283243                                       220   4e-66   
gb|AAP03057.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    214   4e-66   Limonium latifolium
gb|AAP03056.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    215   4e-66   Limonium latifolium
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          219   7e-66   Sorghum bicolor [broomcorn]
dbj|BAJ96291.1|  predicted protein                                      219   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    218   1e-65   Citrus sinensis [apfelsine]
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    214   1e-65   Limonium latifolium
ref|NP_001048569.1|  Os02g0823400                                       219   1e-65   
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    218   2e-65   Sesamum indicum [beniseed]
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        217   4e-65   Medicago sativa subsp. x varia
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    217   6e-65   Cicer arietinum [garbanzo]
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    217   9e-65   Limonium latifolium
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    215   2e-64   Setaria italica
gb|AES72848.2|  caffeic acid O-methyltransferase                        214   5e-64   Medicago truncatula
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 213   1e-63   
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg             209   1e-63   Citrus clementina [clementine]
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                   207   8e-63   Citrus sinensis [apfelsine]
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 209   3e-62   Medicago truncatula
gb|AAP03051.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    202   7e-62   Limonium latifolium
ref|XP_009787879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    200   2e-61   Nicotiana sylvestris
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    207   4e-61   
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg             199   4e-60   
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   200   3e-59   Citrus sinensis [apfelsine]
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             196   8e-58   
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg             189   3e-56   
gb|EMT14045.1|  Caffeic acid 3-O-methyltransferase                      187   1e-55   
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   184   9e-53   Citrus sinensis [apfelsine]
gb|EEC74273.1|  hypothetical protein OsI_09508                          176   1e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             167   1e-46   
ref|XP_006428523.1|  hypothetical protein CICLE_v10013676mg             159   6e-46   
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          164   8e-45   Amborella trichopoda
gb|AGO50639.1|  caffeic acid O-methyltransferase                        154   8e-41   Linum usitatissimum
gb|AAA80579.1|  3' flavonoid O-methyltransferase                        152   2e-40   Chrysosplenium americanum [water-carpet]
gb|KJB23958.1|  hypothetical protein B456_004G125600                    150   6e-40   Gossypium raimondii
gb|AAZ32409.1|  S-methyltransferase                                     151   8e-40   Catharanthus roseus [chatas]
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                      151   9e-40   Glycine soja [wild soybean]
gb|ADK97702.1|  putative caffeic acid O-methyltransferase               151   1e-39   Citrus aurantium [bitter orange]
gb|KJB23954.1|  hypothetical protein B456_004G125600                    151   1e-39   Gossypium raimondii
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                      151   1e-39   Gossypium hirsutum [American cotton]
ref|XP_002988275.1|  caffeic acid O-methyltransferase                   150   1e-39   Selaginella moellendorffii
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    151   1e-39   Citrus sinensis [apfelsine]
ref|XP_002963872.1|  caffeic acid O-methyltransferase                   150   1e-39   Selaginella moellendorffii
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like      150   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADN27527.1|  caffeic acid O-methyltransferase                        150   2e-39   Camellia sinensis [black tea]
gb|KDO42947.1|  hypothetical protein CISIN_1g030025mg                   145   2e-39   Citrus sinensis [apfelsine]
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    150   2e-39   Citrus sinensis [apfelsine]
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    150   2e-39   Elaeis guineensis
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                      150   2e-39   Gossypium arboreum [tree cotton]
ref|XP_008343815.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    144   2e-39   
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg             150   3e-39   
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg             149   3e-39   Citrus clementina [clementine]
gb|AID68566.1|  caffeic O-methyltransferase                             150   3e-39   Punica granatum [granado]
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    149   3e-39   Cucumis sativus [cucumbers]
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase               149   3e-39   Hibiscus cannabinus [bimli-jute]
ref|XP_008362842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    147   4e-39   
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    149   4e-39   
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    149   4e-39   Cucumis melo [Oriental melon]
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    149   4e-39   Malus domestica [apple tree]
gb|ABI54118.1|  caffeic acid O-methyltransferase                        149   4e-39   Malus domestica [apple tree]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase               149   4e-39   Betula pendula [white birch]
gb|KHN19569.1|  Caffeic acid 3-O-methyltransferase                      146   4e-39   Glycine soja [wild soybean]
emb|CBI23095.3|  unnamed protein product                                146   4e-39   Vitis vinifera
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg             149   5e-39   Citrus clementina [clementine]
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                      149   5e-39   Betula platyphylla [Asian white birch]
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    149   5e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGS49204.1|  O-methyltransferase                                     149   6e-39   Zea mays [maize]
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    149   7e-39   Elaeis guineensis
ref|XP_010934981.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    145   7e-39   
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase      149   8e-39   Prunus mume [ume]
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...    149   8e-39   Prunus dulcis [sweet almond]
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg             149   8e-39   Prunus persica
gb|AGS49202.1|  O-methyltransferase                                     148   1e-38   Zea mays [maize]
ref|XP_008382714.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    145   1e-38   
gb|ADR31597.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    143   1e-38   Populus trichocarpa [western balsam poplar]
gb|EMT30204.1|  Caffeic acid 3-O-methyltransferase                      147   1e-38   
gb|AHM25237.1|  noraucuparin O-methyltransferase                        148   1e-38   Sorbus aucuparia [European mountain ash]
gb|ABI54117.1|  caffeic acid O-methyltransferase                        148   1e-38   Malus domestica [apple tree]
gb|AIY22648.1|  caffeic acid 3-O-methyl transferase                     144   1e-38   Saccharum arundinaceum
gb|AGS49209.1|  O-methyltransferase                                     148   2e-38   Zea mays [maize]
gb|ABG27066.1|  caffeic acid O-methyltransferase                        148   2e-38   Boehmeria nivea [Chinese silk-plant]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g             147   2e-38   Phaseolus vulgaris [French bean]
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    149   2e-38   
ref|NP_001242325.1|  uncharacterized protein LOC100805999               147   2e-38   
ref|XP_002525818.1|  o-methyltransferase, putative                      147   2e-38   Ricinus communis
gb|EYU31472.1|  hypothetical protein MIMGU_mgv1a019059mg                144   2e-38   Erythranthe guttata [common monkey flower]
gb|ABS57468.1|  caffeic acid O-methyl transferase                       147   2e-38   Leucaena leucocephala [cassie]
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase      147   2e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|AAY86361.1|  caffeic acid O-methyltransferase                        147   2e-38   Acacia auriculiformis x Acacia mangium
gb|AGS49206.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49189.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49205.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    147   3e-38   Elaeis guineensis
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...    147   3e-38   Rosa chinensis [China rose]
gb|ADR31603.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    143   3e-38   Populus trichocarpa [western balsam poplar]
gb|AGS49187.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    147   3e-38   Glycine max [soybeans]
ref|NP_001106047.1|  catechol O-methyltransferase                       147   3e-38   Zea mays [maize]
gb|AGS49217.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49213.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49191.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49190.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49215.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49207.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49195.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg             147   3e-38   Citrus clementina [clementine]
gb|AAQ24337.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                      147   3e-38   Zea nicaraguensis
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...    147   3e-38   Zea mays [maize]
gb|AAQ24338.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
gb|AGS49185.1|  O-methyltransferase                                     147   3e-38   Zea mays [maize]
ref|XP_009395003.1|  PREDICTED: flavone O-methyltransferase 1-like      147   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIJ28474.1|  O-methyltransferase                                     147   4e-38   Vaccinium corymbosum [American blueberry]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    147   4e-38   Glycine max [soybeans]
gb|ADR31598.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    143   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase      146   4e-38   
gb|AFK40372.1|  unknown                                                 147   4e-38   Lotus japonicus
gb|ADR31604.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    143   4e-38   Populus trichocarpa [western balsam poplar]
gb|AGS49199.1|  O-methyltransferase                                     146   4e-38   Zea mays [maize]
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    146   5e-38   Citrus sinensis [apfelsine]
gb|AIY22649.1|  caffeic acid 3-O-methyl transferase                     143   5e-38   Saccharum arundinaceum
gb|ADR31595.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    143   5e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg             146   5e-38   Citrus clementina [clementine]
gb|KDP30064.1|  hypothetical protein JCGZ_18389                         146   6e-38   Jatropha curcas
ref|NP_001240003.1|  uncharacterized protein LOC100780100               146   6e-38   Glycine max [soybeans]
gb|AEV93478.1|  caffeic acid O-methyltransferase                        146   6e-38   Caragana korshinskii
ref|XP_010696333.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    142   7e-38   
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...    146   7e-38   Vitis vinifera
gb|AGS49181.1|  O-methyltransferase                                     146   7e-38   Zea mays [maize]
gb|EPS67212.1|  hypothetical protein M569_07558                         146   7e-38   Genlisea aurea
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    145   7e-38   
gb|ACT87981.1|  caffeic acid O-methyltransferase                        146   7e-38   Jatropha curcas
gb|ABI54120.1|  caffeic acid O-methyltransferase                        146   7e-38   Malus domestica [apple tree]
gb|AAQ24339.1|  O-methyltransferase                                     146   7e-38   Zea mays [maize]
dbj|BAK42963.1|  caffeic acid O-methylltransferase                      145   8e-38   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABI54119.1|  caffeic acid O-methyltransferase                        146   8e-38   Malus domestica [apple tree]
gb|AGS49196.1|  O-methyltransferase                                     146   8e-38   Zea mays [maize]
gb|AGS49210.1|  O-methyltransferase                                     146   8e-38   Zea mays [maize]
gb|AGS49211.1|  O-methyltransferase                                     146   8e-38   Zea mays [maize]
ref|XP_003559686.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    146   8e-38   Brachypodium distachyon [annual false brome]
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    145   9e-38   Cicer arietinum [garbanzo]
gb|AAQ24348.1|  O-methyltransferase                                     145   9e-38   Zea mays [maize]
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase           145   9e-38   Carthamus tinctorius
gb|AAQ24342.1|  O-methyltransferase                                     145   9e-38   Zea mays [maize]
gb|AAQ24344.1|  O-methyltransferase                                     145   9e-38   Zea mays [maize]
gb|AAQ24361.1|  O-methyltransferase                                     145   9e-38   Zea mays [maize]
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    147   9e-38   
gb|AAQ24351.1|  O-methyltransferase                                     145   9e-38   Zea mays [maize]
gb|AAQ24343.1|  O-methyltransferase                                     145   9e-38   Zea mays [maize]
gb|AAQ24345.1|  O-methyltransferase                                     145   1e-37   Zea mays [maize]
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...    146   1e-37   
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      145   1e-37   Eucalyptus grandis [rose gum]
gb|ADB82906.1|  caffeic O-methyltransferase1                            145   1e-37   Eucalyptus camaldulensis
gb|ACY66932.1|  caffeic O-methyltransferase 1                           145   1e-37   Eucalyptus camaldulensis
gb|AEW26161.1|  caffeic acid-O-methyltransferase                        142   1e-37   Medicago sativa subsp. x varia
gb|AGS49183.1|  O-methyltransferase                                     145   1e-37   Zea mays [maize]
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase      145   1e-37   Fragaria vesca subsp. vesca
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                  145   2e-37   Liquidambar styraciflua [American sweet gum]
ref|NP_001268100.1|  caffeic acid O-methyltransferase                   145   2e-37   Vitis vinifera
gb|AGS49184.1|  O-methyltransferase                                     145   2e-37   Zea mays [maize]
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    145   2e-37   Populus sieboldii x Populus grandidentata
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    145   2e-37   Pyrus x bretschneideri [bai li]
gb|AAF28353.1|AF220491_1  O-methyltransferase                           145   2e-37   Fragaria x ananassa
gb|AEW26209.1|  caffeic acid-O-methyltransferase                        141   2e-37   Medicago sativa subsp. caerulea
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...    145   2e-37   Clarkia breweri [fairy fans]
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    145   2e-37   Eucalyptus grandis [rose gum]
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                   144   2e-37   Citrus sinensis [apfelsine]
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase      144   2e-37   Nicotiana sylvestris
gb|AAQ24355.1|  O-methyltransferase                                     144   2e-37   Zea mays [maize]
gb|ADX98508.1|  caffeic acid 3-O-methyltransferase                      144   2e-37   Panicum virgatum
gb|KDP36008.1|  hypothetical protein JCGZ_10407                         144   3e-37   Jatropha curcas
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    144   3e-37   Pyrus x bretschneideri [bai li]
gb|AEW26163.1|  caffeic acid-O-methyltransferase                        141   3e-37   Medicago sativa subsp. x varia
gb|AGS49219.1|  O-methyltransferase                                     144   3e-37   Zea mays [maize]
gb|AGS49188.1|  O-methyltransferase                                     144   3e-37   Zea mays [maize]
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    144   3e-37   Tarenaya hassleriana [spider flower]
gb|AGS49200.1|  O-methyltransferase                                     144   3e-37   Zea mays [maize]
gb|AGS49197.1|  O-methyltransferase                                     144   3e-37   Zea mays [maize]
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    144   3e-37   Chrysosplenium americanum [water-carpet]
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    144   3e-37   Chrysosplenium americanum [water-carpet]
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    144   4e-37   Eucalyptus grandis [rose gum]
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    144   4e-37   
ref|XP_002518944.1|  o-methyltransferase, putative                      142   4e-37   
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...    144   4e-37   Eucalyptus gunnii
ref|XP_010478733.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    144   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1        144   4e-37   Tarenaya hassleriana [spider flower]
dbj|BAD14923.1|  caffeic acid o-methyl transferase                      142   4e-37   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC78827.1|  caffeic acid O-methyltransferase                       144   4e-37   Rosa chinensis var. spontanea
ref|XP_004972800.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    144   4e-37   Setaria italica
gb|AFK34973.1|  unknown                                                 139   5e-37   Lotus japonicus
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                     145   5e-37   Eucalyptus grandis [rose gum]
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    144   5e-37   Malus domestica [apple tree]
dbj|BAO79382.1|  hypothetical plant O-methyltransferase                 144   5e-37   Anthriscus sylvestris
gb|AFZ78575.1|  caffeic acid O-methyltransferase                        144   6e-37   Populus tomentosa [Chinese white poplar]
emb|CDY19037.1|  BnaC01g20310D                                          144   6e-37   Brassica napus [oilseed rape]
gb|AGS49216.1|  O-methyltransferase                                     143   6e-37   Zea mays [maize]
gb|AGS49198.1|  O-methyltransferase                                     143   7e-37   Zea mays [maize]
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                  143   7e-37   
gb|AGS49186.1|  O-methyltransferase                                     143   7e-37   Zea mays [maize]
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1               143   8e-37   
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    142   8e-37   
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    143   8e-37   Populus tremuloides
prf||2119166A  caffeic acid O-methyltransferase                         143   8e-37
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    143   8e-37   Ocimum basilicum [basil]
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                      144   9e-37   Gossypium arboreum [tree cotton]
emb|CDY18302.1|  BnaC09g30520D                                          139   9e-37   Brassica napus [oilseed rape]
gb|AGS49194.1|  O-methyltransferase                                     143   9e-37   Zea mays [maize]
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                      143   9e-37   Saccharum hybrid cultivar [sugarcane]
gb|KDP32876.1|  hypothetical protein JCGZ_12168                         143   9e-37   Jatropha curcas
gb|KJB52492.1|  hypothetical protein B456_008G264900                    143   1e-36   Gossypium raimondii
gb|KDP32878.1|  hypothetical protein JCGZ_12170                         143   1e-36   Jatropha curcas
ref|XP_006420931.1|  hypothetical protein CICLE_v10005230mg             143   1e-36   Citrus clementina [clementine]
ref|XP_002317838.1|  Chain A family protein                             143   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    143   1e-36   Phoenix dactylifera
ref|XP_009398124.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    143   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    143   1e-36   Malus domestica [apple tree]
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...    142   1e-36   Saccharum officinarum [noble cane]
gb|AGS49182.1|  O-methyltransferase                                     142   1e-36   Zea mays [maize]
gb|EAZ05653.1|  hypothetical protein OsI_27880                          142   1e-36   Oryza sativa Indica Group [Indian rice]
emb|CDP20700.1|  unnamed protein product                                142   1e-36   Coffea canephora [robusta coffee]
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    142   2e-36   Glycine max [soybeans]
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3    142   2e-36   Populus euphratica
ref|XP_009388361.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    142   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFM73597.1|  caffeate O-methyltransferase                            140   2e-36   
gb|AGS49214.1|  O-methyltransferase                                     142   2e-36   
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                     142   2e-36   
gb|AEO14871.1|  caffeic acid O-methyltransferase                        142   2e-36   
gb|EAZ41571.1|  hypothetical protein OsJ_26105                          142   2e-36   
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase      142   2e-36   
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                      142   2e-36   
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    142   2e-36   
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    142   2e-36   
gb|KEH20132.1|  caffeic acid O-methyltransferase                        142   2e-36   
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase      142   2e-36   
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    142   2e-36   
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    142   2e-36   
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase      142   2e-36   
gb|KHN06374.1|  Anthranilate N-methyltransferase                        142   2e-36   
ref|XP_002893750.1|  O-methyltransferase family 2 protein               142   2e-36   
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...    142   2e-36   
ref|XP_003528760.1|  PREDICTED: anthranilate N-methyltransferase        142   3e-36   
gb|AFO69477.1|  caffeic acid O-methyltransferase                        142   3e-36   
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase                 142   3e-36   
gb|AEW26176.1|  caffeic acid-O-methyltransferase                        138   3e-36   
ref|NP_001061031.1|  Os08g0157500                                       142   3e-36   
gb|AAO43609.1|  caffeic acid O-methyltransferase                        141   3e-36   
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase      141   3e-36   
ref|XP_010048400.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    141   4e-36   
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250          141   4e-36   
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase              141   4e-36   
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                      141   4e-36   
gb|AGS49192.1|  O-methyltransferase                                     141   4e-36   
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    141   4e-36   
sp|Q41086.1|COMT2_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    141   5e-36   
ref|XP_007139027.1|  hypothetical protein PHAVU_009G258800g             141   5e-36   
ref|XP_007139034.1|  hypothetical protein PHAVU_009G259500g             141   5e-36   
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    141   5e-36   
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    141   5e-36   
ref|XP_002869549.1|  hypothetical protein ARALYDRAFT_354029             141   5e-36   
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860          141   5e-36   
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                      141   5e-36   
gb|AAL57301.1|AF387790_1  O-methyltransferase                           141   5e-36   
gb|AEO14870.1|  caffeic acid O-methyltransferase                        141   5e-36   
gb|AFK39562.1|  unknown                                                 141   6e-36   
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)              141   6e-36   
prf||1906376A  O-methyltransferase                                      141   6e-36
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...    141   6e-36   
gb|AAF60951.1|  O-methyltransferase                                     141   6e-36   
gb|AFK41218.1|  unknown                                                 141   6e-36   
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase                 141   6e-36   
gb|AFK35470.1|  unknown                                                 140   6e-36   
ref|XP_003626617.1|  Caffeic acid 3-O-methyltransferase                 140   6e-36   
ref|XP_004509702.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    141   6e-36   
gb|AAN03726.1|  caffeic acid O-methyltransferase                        140   6e-36   
ref|XP_006442372.1|  hypothetical protein CICLE_v10020761mg             140   7e-36   
gb|AID69230.1|  caffeic acid O-methyltransferase                        136   7e-36   
gb|AET00984.2|  caffeic acid O-methyltransferase                        140   7e-36   
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                    140   7e-36   
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    140   7e-36   
ref|XP_002321948.1|  Chain A family protein                             140   7e-36   
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                       140   7e-36   
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    140   7e-36   
ref|XP_002302676.2|  eugenol O-methyltransferase family protein         140   8e-36   
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    140   8e-36   
ref|XP_006386660.1|  hypothetical protein POPTR_0002s18130g             140   8e-36   
gb|EAY85717.1|  hypothetical protein OsI_07085                          140   8e-36   
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                   140   9e-36   
ref|XP_002302677.1|  eugenol O-methyltransferase family protein         140   9e-36   
ref|XP_004509701.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    140   9e-36   
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                      140   1e-35   
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    140   1e-35   
emb|CAA52462.1|  catechol O-methyltransferase                           140   1e-35   
ref|XP_006477839.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    140   1e-35   
ref|XP_006386659.1|  hypothetical protein POPTR_0002s18120g             140   1e-35   
ref|XP_008382917.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    137   1e-35   
gb|AGS49203.1|  O-methyltransferase                                     140   1e-35   
gb|AFK39235.1|  unknown                                                 140   2e-35   
ref|XP_006305218.1|  hypothetical protein CARUB_v10009584mg             139   2e-35   
gb|ADO16247.1|  caffeic acid O-methyltransferase                        139   2e-35   
gb|AFZ78574.1|  caffeic acid O-methyltransferase                        139   2e-35   
gb|EPS64988.1|  hypothetical protein M569_09791                         139   2e-35   
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    139   2e-35   
gb|AAQ01670.1|  catechol O-methyltransferase                            139   2e-35   
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    139   2e-35   
gb|AGS49208.1|  O-methyltransferase                                     139   2e-35   
gb|AFX98069.1|  caffeic acid O-methyltransferase                        139   2e-35   
ref|XP_009802353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    139   2e-35   
ref|XP_003626614.1|  Caffeic acid 3-O-methyltransferase                 139   2e-35   
ref|XP_004494877.1|  PREDICTED: anthranilate N-methyltransferase-...    139   2e-35   
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg             139   3e-35   
ref|XP_002864309.1|  O-methyltransferase 1                              139   3e-35   
ref|XP_009384339.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    139   3e-35   
gb|KDP35860.1|  hypothetical protein JCGZ_10599                         139   3e-35   
ref|XP_007099684.1|  Caffeic acid 3-O-methyltransferase 1               139   3e-35   
ref|NP_174579.1|  O-methyltransferase-like protein                      139   3e-35   
dbj|BAJ95117.1|  predicted protein                                      139   3e-35   
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...    139   3e-35   
ref|XP_007139032.1|  hypothetical protein PHAVU_009G259300g             139   3e-35   
ref|XP_011070409.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    139   3e-35   
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                      139   4e-35   
ref|XP_007135330.1|  hypothetical protein PHAVU_010G120200g             139   4e-35   
ref|XP_010461123.1|  PREDICTED: quercetin 3-O-methyltransferase 1       138   4e-35   
ref|XP_004148264.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    138   5e-35   
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    139   5e-35   
ref|XP_002515087.1|  o-methyltransferase, putative                      138   5e-35   
gb|AFK42771.1|  unknown                                                 139   5e-35   
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                    138   5e-35   
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...    138   6e-35   
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    138   6e-35   
ref|XP_010520934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    138   6e-35   
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    138   6e-35   
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...    138   6e-35   
emb|CAA52461.1|  catechol O-methyltransferase                           138   6e-35   
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1        138   6e-35   
gb|ACI42878.1|  caffeic acid ortho-methyltransferase                    137   7e-35   
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg             138   7e-35   
emb|CDX84055.1|  BnaC08g07320D                                          138   7e-35   
ref|XP_004169229.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    138   8e-35   
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase      137   8e-35   
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...    137   8e-35   
gb|AHY28751.1|  caffeate O-methyltransferase                            132   9e-35   
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                     137   9e-35   
gb|AJK93385.1|  caffeic acid O-methyltransferase                        137   9e-35   
gb|AAV36305.1|  caffeate O-methyltransferase                            132   1e-34   
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                      137   1e-34   
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...    137   1e-34   
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    137   1e-34   
ref|XP_004150935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    137   1e-34   
ref|XP_011084579.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    137   1e-34   
ref|XP_002515090.1|  o-methyltransferase, putative                      137   1e-34   
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                      137   1e-34   
ref|XP_006415131.1|  hypothetical protein EUTSA_v10008040mg             137   1e-34   
ref|XP_011039447.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    137   1e-34   
gb|EMT16763.1|  Caffeic acid 3-O-methyltransferase                      137   1e-34   
dbj|BAJ34520.1|  unnamed protein product                                137   1e-34   
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...    137   1e-34   
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    137   1e-34   
gb|ABP93669.1|  O-methyltransferase 3                                   137   1e-34   
ref|XP_002320237.1|  eugenol O-methyltransferase family protein         137   1e-34   
ref|XP_006434352.1|  hypothetical protein CICLE_v10001555mg             137   1e-34   
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...    137   1e-34   
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    137   1e-34   
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    137   1e-34   
gb|EMT17011.1|  Caffeic acid 3-O-methyltransferase                      137   2e-34   
gb|AAC18623.1|  bispecific caffeic acid/5-hydroxyferulic acid O-m...    137   2e-34   
ref|XP_002267543.1|  PREDICTED: caffeic acid 3-O-methyltransferase      137   2e-34   
gb|EMS54069.1|  Tricetin 3',4',5'-O-trimethyltransferase                136   2e-34   
ref|XP_010024703.1|  PREDICTED: inositol 4-methyltransferase-like       137   2e-34   
gb|AAV36309.1|  caffeate O-methyltransferase                            132   2e-34   
ref|XP_011025357.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    137   2e-34   
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase                137   2e-34   
emb|CDP18417.1|  unnamed protein product                                136   2e-34   
gb|AAD10255.1|  caffeic acid O-methyltransferase                        137   2e-34   
ref|XP_010660322.1|  PREDICTED: caffeic acid 3-O-methyltransferase      136   2e-34   
ref|XP_010538869.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    137   3e-34   
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...    136   3e-34   
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                     136   3e-34   
ref|XP_004494876.1|  PREDICTED: anthranilate N-methyltransferase-...    137   3e-34   
gb|AAK68910.1|  caffeic acid O-methyltransferase                        136   3e-34   
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg             136   3e-34   
ref|XP_007219351.1|  hypothetical protein PRUPE_ppa019437mg             137   3e-34   
gb|AFK45226.1|  unknown                                                 136   3e-34   
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...    136   3e-34   
emb|CDM87233.1|  unnamed protein product                                136   3e-34   
ref|XP_010473409.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    136   3e-34   
gb|ABI54121.1|  caffeic acid O-methyltransferase                        133   3e-34   
emb|CDY18306.1|  BnaC09g30560D                                          136   3e-34   
gb|AAB96879.1|  O-methyltransferase 1                                   136   3e-34   
ref|XP_007211258.1|  hypothetical protein PRUPE_ppa021447mg             136   3e-34   
gb|AHY28756.1|  caffeate O-methyltransferase                            131   3e-34   
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    134   3e-34   
gb|AAK68907.1|  caffeic acid O-methyltransferase                        136   4e-34   
gb|AJK93384.1|  caffeic acid O-methyltransferase                        136   4e-34   
gb|EYU45322.1|  hypothetical protein MIMGU_mgv1a009747mg                135   4e-34   
gb|ACN40509.1|  unknown                                                 132   4e-34   
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                     136   4e-34   
ref|XP_008465607.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    133   4e-34   
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...    135   5e-34   
ref|XP_006659136.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    135   5e-34   
ref|XP_009107965.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    135   5e-34   
ref|XP_007139029.1|  hypothetical protein PHAVU_009G259000g             136   5e-34   
gb|AAT08695.1|  O-methyltransferase                                     132   5e-34   
ref|XP_004148286.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    135   5e-34   
dbj|BAJ90613.1|  predicted protein                                      135   5e-34   
gb|EMT25448.1|  Caffeic acid 3-O-methyltransferase                      135   5e-34   
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                  135   5e-34   
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    135   5e-34   
ref|XP_002864307.1|  O-methyltransferase 1                              135   6e-34   
gb|ACU24201.1|  unknown                                                 135   6e-34   
ref|XP_009387952.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    132   6e-34   
ref|XP_010433307.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    135   6e-34   
sp|Q6T1F6.1|BMT_AMMMJ  RecName: Full=Bergaptol O-methyltransferas...    135   6e-34   
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                  135   6e-34   
ref|XP_009384410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    132   6e-34   
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase      135   6e-34   
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg             135   6e-34   
emb|CDY29856.1|  BnaA03g48770D                                          135   7e-34   
ref|XP_010048410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    135   7e-34   
ref|XP_010438549.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    135   7e-34   
gb|AJK93388.1|  caffeic acid O-methyltransferase                        135   7e-34   
gb|AAK68908.1|  caffeic acid O-methyltransferase                        135   7e-34   
gb|KFK45045.1|  hypothetical protein AALP_AA1G337000                    135   8e-34   
gb|KJB55395.1|  hypothetical protein B456_009G073900                    132   8e-34   
ref|XP_010267679.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    135   9e-34   
ref|XP_009418618.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    135   9e-34   
ref|XP_003573470.1|  PREDICTED: flavone O-methyltransferase 1           135   9e-34   
ref|XP_007015117.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1     135   9e-34   
ref|XP_009784058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    135   9e-34   
ref|XP_007139030.1|  hypothetical protein PHAVU_009G259100g             135   1e-33   
ref|XP_008245734.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    134   1e-33   
gb|AFD53036.1|  caffeic acid-O-methyltransferase                        134   1e-33   
gb|ABQ58825.1|  flavonoid O-methyltransferase                           134   1e-33   
gb|KHN11367.1|  Caffeic acid 3-O-methyltransferase                      134   1e-33   
emb|CBI38723.3|  unnamed protein product                                130   1e-33   
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    134   1e-33   
ref|XP_010448093.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    134   1e-33   
ref|XP_010418164.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    134   1e-33   
ref|XP_009384362.1|  PREDICTED: flavone O-methyltransferase 1-like      134   1e-33   
emb|CDY43839.1|  BnaC03g14720D                                          134   1e-33   
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1        134   1e-33   
ref|XP_007218135.1|  hypothetical protein PRUPE_ppa007229mg             134   1e-33   
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase         134   2e-33   
gb|AAK68909.1|  caffeic acid O-methyltransferase                        134   2e-33   
emb|CBI19007.3|  unnamed protein product                                134   2e-33   



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHP + QGINFDLPEVV KAP IPG+T+VGGDMFKSIP+GDAIFMKW+
Sbjct  208  GSAGDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPGVTNVGGDMFKSIPDGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D ECK IM +CY ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYRAK
Sbjct  268  LTTWTDNECKLIMENCYKALPVGGKLIACEPVLPKDSDDSHRTRALLEGDIFVMTIYRAK  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE++QL +SVGFS FRAFYVD+FYTVLEFQK
Sbjct  328  GKHRTEEEFKQLGQSVGFSYFRAFYVDYFYTVLEFQK  364



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHP + QGINFDLPEVV KAP IPG+T+VGGDMFKSIP+GDAIFMKW+
Sbjct  208  GSAGDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPGVTNVGGDMFKSIPDGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D ECK IM +CY ALP GGKLVACEPVLP  +DD+ RTR LLEGDIFVMTIYR K
Sbjct  268  LTTWTDNECKLIMENCYKALPMGGKLVACEPVLPKDSDDSHRTRALLEGDIFVMTIYRTK  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE++QL +SVGFS FRAFYVD+FYTVLEFQK
Sbjct  328  GKHRTEEEFKQLGQSVGFSHFRAFYVDYFYTVLEFQK  364



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++K+P+I +GINFDLPEVV KAPNIPG+THVGGDMFKSIP+ D IFMKW+
Sbjct  201  GSAGDCLRMILKKYPNIREGINFDLPEVVAKAPNIPGVTHVGGDMFKSIPSADGIFMKWV  260

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP Q+DD+ RTR LLEGDIFVMTIYRAK
Sbjct  261  LTTWTDEECKQIMENCYKALPVGGKLIACEPVLPKQSDDSHRTRALLEGDIFVMTIYRAK  320

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRT EE++ L +SVGFS F+AFY+D+FYTVLEF K
Sbjct  321  GKHRTAEEFKLLGQSVGFSHFQAFYIDYFYTVLEFHK  357



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+E+ P++ +GINFDLPEVV KAP+IPG+THVGGDMF+SIP+GDAIFMKW+
Sbjct  199  GSAGDCLRMILEQFPNVREGINFDLPEVVAKAPSIPGVTHVGGDMFQSIPSGDAIFMKWV  258

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  259  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  318

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  319  GKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  355



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ K P++ QGINFDLPEVV KAP IPG+THVGGDMFKSIP+GDAIFMKW+
Sbjct  198  GSAGDCLRMILRKFPNVRQGINFDLPEVVSKAPPIPGVTHVGGDMFKSIPSGDAIFMKWV  257

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR+K
Sbjct  258  LTTWTDEECKQIMRNCYNALPPGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRSK  317

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE++QL  + GFS FR FY+D+FYTVLEFQK
Sbjct  318  GKHRTEEEFKQLGLASGFSLFRPFYIDYFYTVLEFQK  354



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+++ P++ QGINFDLPEVV KAP IPG+TH+GGDMF+S+P+GDAIFMKW+
Sbjct  203  GSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVTHMGGDMFQSVPSGDAIFMKWV  262

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKLVACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  263  LTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  322

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEEY++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  323  GKHRTEEEYKELGLSAGFSTFRPFYIDYFYTILEFQK  359



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+++ P++ QGINFDLPEVV KAP IPG+TH+GGDMF+S+P+GDAIFMKW+
Sbjct  74   GSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVTHMGGDMFQSVPSGDAIFMKWV  133

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKLVACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  134  LTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  193

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  194  GKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  230



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH +I +GINFDLPEVV KAPNIPG+THVGGDMFKS+P+GDAIFMKW+
Sbjct  202  GSAGDCLRMILQKHTNIKEGINFDLPEVVAKAPNIPGVTHVGGDMFKSVPDGDAIFMKWV  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK IM +CY ALP GGK++ACEPVLP ++D++ RTR LLEGDIFVMTIYRAK
Sbjct  262  LTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAK  321

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+RQL  S GF   RAFY+D FYTVLEFQK
Sbjct  322  GKHRTEEEFRQLGLSAGFPHLRAFYIDHFYTVLEFQK  358



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++  P++ +GINFDLPEVV KAPNIPG++HVGGDMF+S+P+GDAIFMKW+
Sbjct  203  GSAGDCLRMILQHFPNVREGINFDLPEVVAKAPNIPGVSHVGGDMFQSVPSGDAIFMKWV  262

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECKEIM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  263  LTTWTDEECKEIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  322

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GF +FR FY+D+FYT+LEFQK
Sbjct  323  GKHRTEEEFKELGLSAGFPTFRPFYIDYFYTILEFQK  359



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+++ P++ QGINFDLPEVV KAP IPG+TH+GGDMF+S+P+GDAIFMKW+
Sbjct  203  GSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVTHMGGDMFQSVPSGDAIFMKWV  262

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKLVACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  263  LTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPQETDDSHRTRALLEGDIFVMTIYRTK  322

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  323  GKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  359



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C RMI+E+ P++ +GINFDLPEVV KAP+IPG+THVGGDMF+SIP+GDAIFMKW+
Sbjct  229  GSAGVCLRMILEQFPNVREGINFDLPEVVAKAPSIPGVTHVGGDMFQSIPSGDAIFMKWV  288

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  289  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  348

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  349  GKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  385



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHP+I +GINFDLPEVV KAP IP +THVGGDMFKSIP GDAIFMKW+
Sbjct  181  GSGGDCLRMILQKHPTIKEGINFDLPEVVAKAPQIPCVTHVGGDMFKSIPQGDAIFMKWV  240

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK IM SC+ ALP+GGKL+ACEPVLP  +D++ RTR LLEGDIFVMTIYRAK
Sbjct  241  LTTWTDEECKHIMQSCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAK  300

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  301  GKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  337



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHP+I +GINFDLPEVV KAP IP +THVGGDMFKSIP GDAIFMKW+
Sbjct  200  GSGGDCLRMILQKHPTIKEGINFDLPEVVAKAPQIPCVTHVGGDMFKSIPQGDAIFMKWV  259

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK IM SC+ ALP+GGKL+ACEPVLP  +D++ RTR LLEGDIFVMTIYRAK
Sbjct  260  LTTWTDEECKHIMQSCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAK  319

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  320  GKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  356



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+E+ P++ +GINFDL EVV KAP IPG+TH+GGDMF+S+P+GDAIFMKW+
Sbjct  205  GSAGDCLRMIIEQFPNVRRGINFDLLEVVAKAPKIPGVTHIGGDMFQSVPSGDAIFMKWV  264

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  265  LTTWTDEECKQIMKNCYNALPAGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  324

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  325  GKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  361



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC + I++K+P++ +GINFDLPEVV KAPNIPG+THVGGDMFKS+P+ DAIFMKW+
Sbjct  201  GSAGDCLKTILQKYPNVREGINFDLPEVVAKAPNIPGVTHVGGDMFKSVPSADAIFMKWI  260

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGKL+ACEPVLP QTDD+ RTR LLEGDIFVMTIYRAK
Sbjct  261  LTTWTDDECKVIMENCYKALPVGGKLIACEPVLPNQTDDSHRTRALLEGDIFVMTIYRAK  320

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  SVGFS FR  Y D F+TVLEFQK
Sbjct  321  GKHRTEEEFKKLGHSVGFSHFRPLYFDHFHTVLEFQK  357



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+++ P++ +GINFDLPEVV KAP IPG+THVGGDMF S+P+GDAIFMKW+
Sbjct  207  GSAGDCLRMILKQFPNVREGINFDLPEVVAKAPKIPGVTHVGGDMFLSVPSGDAIFMKWV  266

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEG+IFVMTIYR K
Sbjct  267  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGNIFVMTIYRTK  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GF SFR FY+D+FYT+LEFQK
Sbjct  327  GKHRTEEEFKELGLSAGFPSFRPFYIDYFYTILEFQK  363



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+E+ P++ +GINFDLPEVV KAP IPG+ H+GGDMF+S+P+GDAIFMKW+
Sbjct  204  GSAGDCLRMILEQFPNVREGINFDLPEVVAKAPKIPGVIHMGGDMFQSVPSGDAIFMKWV  263

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  264  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  323

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GFS+FR FY+D+FYT+ EFQK
Sbjct  324  GKHRTEEEFKELGLSAGFSTFRPFYIDYFYTIFEFQK  360



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH +I +GINFDLPEVV KAP IPG+THVGGDMFKS+P+GDAIFMKW+
Sbjct  202  GSAGDCLRMILQKHTNIKEGINFDLPEVVAKAPTIPGVTHVGGDMFKSVPDGDAIFMKWV  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK IM +CY ALP GGK++ACEPVLP ++D++ RTR LLEGDIFVMTIYRAK
Sbjct  262  LTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAK  321

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+RQL  S GF    AFY+D FYTVLEFQK
Sbjct  322  GKHRTEEEFRQLGLSAGFPHLXAFYIDXFYTVLEFQK  358



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+++ P++ +GINFDLPEVV KAPNIPG+THVGGDMF+S+P+ DAIFMKW+
Sbjct  203  GSAGDCLRMILQQFPNVREGINFDLPEVVAKAPNIPGVTHVGGDMFQSVPSADAIFMKWV  262

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TD++ RTR LLEGDIFVMTIYR K
Sbjct  263  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDESHRTRALLEGDIFVMTIYRTK  322

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+ +L  S GF +FR FY+D+FYT+LEFQK
Sbjct  323  GKHRTEEEFIELGLSAGFPTFRPFYIDYFYTILEFQK  359



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   260 bits (664),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+EKHP+I +GINFDLPEVV KAP IP +THVGGDMFK IP GDAIFMKW+
Sbjct  199  GSGGDCLRMILEKHPTIKEGINFDLPEVVAKAPQIPFVTHVGGDMFKFIPQGDAIFMKWV  258

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK IM +C+ ALP+GGKL+ACEPVLP  +D++ RTR LLEGDIFVMTIYRAK
Sbjct  259  LTTWTDEECKHIMQNCHKALPEGGKLIACEPVLPEDSDESHRTRALLEGDIFVMTIYRAK  318

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  319  GKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  355



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ KHP + +GINFDLPEVV KAPNIPG+THVGGDMF+SIP GDAIFMKW+
Sbjct  198  GSAGDCLRMILHKHPHVREGINFDLPEVVAKAPNIPGVTHVGGDMFESIPAGDAIFMKWV  257

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGK++ACEPVLP ++D + RTR LLEGDIFVM IYRAK
Sbjct  258  LTTWTDDECKLIMRNCYEALPPGGKMIACEPVLPKESDRSHRTRALLEGDIFVMAIYRAK  317

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE++QL  + GF  FRAFY+D FYTVLEFQK
Sbjct  318  GKHRTEEEFKQLGLASGFPHFRAFYIDQFYTVLEFQK  354



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+E+ P++ +GINFDL EVV KAP IPG+ HVGGDMF+SIP G+AIFMKW+
Sbjct  200  GSAGDCLRMILEQFPNVREGINFDLHEVVAKAPTIPGVIHVGGDMFQSIPTGEAIFMKWV  259

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR K
Sbjct  260  LTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTK  319

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  320  GKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  356



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC +MI+EKH SI  GINFDLPEVV KAP IP I H+GGDMFK +P GDAIFMKW+
Sbjct  209  GSGGDCLKMILEKHQSIQLGINFDLPEVVGKAPKIPRINHIGGDMFKYVPKGDAIFMKWV  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK+IM SCY ALP+ GKL+ACEPVLP  TDD++RTR LLEGDIFVMTIYRAK
Sbjct  269  LTTWTDDECKQIMKSCYNALPEKGKLIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAK  328

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTE+EYRQL RS GF+  R FY+D F+T+LEFQK
Sbjct  329  GKHRTEDEYRQLGRSAGFADCRGFYIDHFFTILEFQK  365



>emb|CBI30187.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   251 bits (642),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  641  MIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEE  462
            MI++KH +I +GINFDLPEVV KAPNIPG+THVGGDMFKS+P+GDAIFMKW+LTTW DEE
Sbjct  1    MILQKHTNIKEGINFDLPEVVAKAPNIPGVTHVGGDMFKSVPDGDAIFMKWVLTTWTDEE  60

Query  461  CKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEE  282
            CK IM +CY ALP GGK++ACEPVLP ++D++ RTR LLEGDIFVMTIYRAKGKHRTEEE
Sbjct  61   CKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKHRTEEE  120

Query  281  YRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            +RQL  S GF   RAFY+D FYTVLEFQK
Sbjct  121  FRQLGLSAGFPHLRAFYIDHFYTVLEFQK  149



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHPS+ +GINFDLPEVV KAP I G++HVGGDMFKSIP+GDAIFMKW+
Sbjct  212  GSAGDCLRMILQKHPSVREGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPSGDAIFMKWV  271

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L+TW D ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLE D+FVMTIYRAK
Sbjct  272  LSTWTDSECKLIMENCYKALPVGGKLIACEPVLPTKSDDSSRTRALLENDVFVMTIYRAK  331

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK+RTEEE RQL  S GFS FR  Y+D+FYT+LEFQK
Sbjct  332  GKNRTEEELRQLGLSAGFSHFRPIYIDYFYTLLEFQK  368



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++K+P + +GINFDLPEVV KAP+IPG+THVGGDMF+SIP  DAIFMKW+
Sbjct  206  GSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPGVTHVGGDMFESIPAADAIFMKWV  264

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLEGDIFVMTIYRAK
Sbjct  265  LTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAK  324

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  325  GKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  361



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMIM KH  + +GINFDLPEVV KAP IPG+THVGGDMFKSIP GDAIFM+W+
Sbjct  129  GSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVTHVGGDMFKSIPAGDAIFMRWI  188

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYRAK
Sbjct  189  LTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAK  248

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  249  GKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  285



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMIM KH  + +GINFDLPEVV KAP IPG+THVGGDMFKSIP GDAIFM+W+
Sbjct  204  GSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVTHVGGDMFKSIPAGDAIFMRWI  263

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYRAK
Sbjct  264  LTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAK  323

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  324  GKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  360



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMIM KH  + +GINFDLPEVV KAP IPG+THVGGDMFKSIP GDAIFM+W+
Sbjct  189  GSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVTHVGGDMFKSIPAGDAIFMRWI  248

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYRAK
Sbjct  249  LTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAK  308

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  309  GKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  345



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHPS+ +GINFDLPEVV KAP I G++HVGGDMFKSIP+GDAIFMKW+
Sbjct  212  GSAGDCLRMILQKHPSVREGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPSGDAIFMKWV  271

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L+TW D ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLE DIFVMTIYRAK
Sbjct  272  LSTWTDSECKLIMENCYKALPVGGKLIACEPVLPTKSDDSPRTRALLENDIFVMTIYRAK  331

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK+RTE+E RQL  S GFS F+  Y+D+FYTVLEFQK
Sbjct  332  GKNRTEDELRQLGLSAGFSHFKPIYIDYFYTVLEFQK  368



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC +MI+EKH  I  GINFDLPEVV+KAP IP I HVGGDMF  IP GDAIFMKW+
Sbjct  204  GSGGDCLKMILEKHTDIELGINFDLPEVVEKAPQIPSIKHVGGDMFDYIPKGDAIFMKWV  263

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECKEIM SCY ALP+ GK +ACEPVLP  TDD++RTR LLEGDIFVMTIYRAK
Sbjct  264  LTTWTDDECKEIMKSCYNALPEKGKFIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAK  323

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEEYRQL R+ GF+  + FY+D F+T+LEF K
Sbjct  324  GKHRTEEEYRQLGRAAGFNECKGFYIDHFFTILEFHK  360



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   250 bits (639),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHP++ +GINFDLPEVV KAP I G++HVGGDMFKSIP GDAIF+KW+
Sbjct  128  GSAGDCLRMILQKHPNVREGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPRGDAIFLKWI  187

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L+TW D ECK I+ +CY ALP+GGKL+ACEPVLP ++D++ RTR LLE DIFVMTIYRAK
Sbjct  188  LSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAK  247

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK+R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  248  GKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  284



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ K+P+I +GINFDLPEVV KAP  P +THVGGDMFKSIP GDAIFMKW+
Sbjct  198  GSGGDCLRMILLKYPNIKEGINFDLPEVVAKAPPTPCVTHVGGDMFKSIPQGDAIFMKWV  257

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEE K+IM +C+ ALP+GGKL+ACEPVLP  +D++ RTR LLEGDIFVMTIYRAK
Sbjct  258  LTTWTDEEIKQIMQNCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAK  317

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE++RQL+   GF  FRAF VD FYTVLEFQK
Sbjct  318  GKHRTEEQFRQLANDAGFPRFRAFNVDHFYTVLEFQK  354



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   253 bits (645),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC +MI++KH +I  GINFDLPEVV+KAP IP I HVGGDMF  IP GDAIFMKW+
Sbjct  204  GSGGDCLKMILDKHTNIELGINFDLPEVVEKAPQIPSIKHVGGDMFDYIPKGDAIFMKWV  263

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECKEIM SCY ALP+ GK +ACEPVLP  TDD++RTR LLEGDIFVMTIYRAK
Sbjct  264  LTTWTDDECKEIMKSCYIALPEKGKFIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAK  323

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEEYRQL R+ GF+  + FY+D F+T+LEF K
Sbjct  324  GKHRTEEEYRQLGRAAGFNDCKGFYIDHFFTILEFHK  360



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++K+P + +GINFDLPEVV KAP+IPG+T+VGGDM +SIP  DAIFMKW+
Sbjct  206  GSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPGVTYVGGDMLESIPVADAIFMKWV  264

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLEGDIFVMTIYRAK
Sbjct  265  LTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAK  324

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  325  GKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  361



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   251 bits (641),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHP++ +GINFDLPEVV KAP I G++HVGGDMFKSIP GDAIF KW+
Sbjct  213  GSAGDCLRMILQKHPNVKEGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPRGDAIFFKWI  272

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L+TW D ECK I+ +CY ALP+GGKL+ACEPVLP ++D++ RTR LLE DIFVMTIYRAK
Sbjct  273  LSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAK  332

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK+R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  333  GKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  369



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   251 bits (641),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KHP++ +GINFDLPEVV KAP I G++HVGGDMFKSIP GDAIF KW+
Sbjct  216  GSAGDCLRMILQKHPNVKEGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPRGDAIFFKWI  275

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L+TW D ECK I+ +CY ALP+GGKL+ACEPVLP ++D++ RTR LLE DIFVMTIYRAK
Sbjct  276  LSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAK  335

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK+R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  336  GKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  372



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+C RMI++KHP + +GINFDLPEVV KAP IPG++HVGGDMFKSIP+GD IFMKW+
Sbjct  200  GSVGECLRMILQKHPHVEEGINFDLPEVVAKAPTIPGVSHVGGDMFKSIPSGDGIFMKWV  259

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L TW D+ECK IM +CY ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYR K
Sbjct  260  LVTWTDDECKLIMENCYKALPVGGKLIACEPVLPKDSDDSHRTRALLEGDIFVMTIYRTK  319

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEE++QL  S GF  FRAF  D FY+VLEFQK
Sbjct  320  GKHRTEEEFKQLGLSAGFPHFRAFCFDDFYSVLEFQK  356



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++K+P++T+ INFDLPEVV +AP++PG+THVGGDMFK IP  DAIFMKW+
Sbjct  203  GSAGDCLRMILQKYPNVTEAINFDLPEVVARAPHVPGVTHVGGDMFKLIPEADAIFMKWI  262

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+EC+ IM SC  A+P GGKL+ACEPVLP +TDD+ RTR LL GDIFVMTIYRAK
Sbjct  263  LTTWTDDECQAIMESCCKAVPGGGKLIACEPVLPKETDDSHRTRALLSGDIFVMTIYRAK  322

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTE+EYR+L  + GF  F+AFY+D+F+TVLEF K
Sbjct  323  GKHRTEDEYRKLGLAAGFPHFQAFYIDYFHTVLEFTK  359



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++K+P+I QG NFDLPEVV KAP IPG+THVGGDMFK IP  DAIFMKW+
Sbjct  198  GSGGDCLRMILQKYPNIKQGFNFDLPEVVAKAPQIPGVTHVGGDMFKYIPQADAIFMKWV  257

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEE K IM +CY ALP GGKL+ACEPVLP  +DD+ RTR  L GDIFVMTIYRAK
Sbjct  258  LTTWTDEEIKHIMLNCYKALPAGGKLIACEPVLPETSDDSHRTRASLAGDIFVMTIYRAK  317

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE++RQL+ S GF+ F++F+VD+F+ VLEFQK
Sbjct  318  GKHRTEEQFRQLAISAGFNLFKSFHVDYFHIVLEFQK  354



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ K+PSI + INFDLP+VV KAP IPG+THVGGDMFK +P GDAIFMKW+
Sbjct  197  GSGGDCLRMILHKYPSIKEAINFDLPQVVAKAPQIPGVTHVGGDMFKYVPQGDAIFMKWV  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L TW D+E K IM +CY ALP GGKL+ACEPVLP  +DD+ RTR LL+GDIFVMTIYRAK
Sbjct  257  LITWTDKEIKHIMQNCYKALPAGGKLIACEPVLPEDSDDSHRTRALLQGDIFVMTIYRAK  316

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE+++QL  S GF+ F+AF+VD FY VLEFQK
Sbjct  317  GKHRTEEQFKQLGISAGFNLFKAFHVDHFYAVLEFQK  353



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC +MIM+++P++ +GINFDLPEVV KAP I G+THVGGDMFKSIP+ D IFMKW+
Sbjct  202  GSAGDCLKMIMDRYPNVREGINFDLPEVVAKAPTIAGVTHVGGDMFKSIPSADVIFMKWI  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L+TW D ECK I+ +CY ALP GGKL+ACEPV+P ++DD+ RTR LLE DIFVMTIYR K
Sbjct  262  LSTWTDCECKLILENCYKALPAGGKLIACEPVVPRKSDDSHRTRALLENDIFVMTIYRTK  321

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK+RTEEE RQL  S GFS FR  Y+D+FYTVLEFQK
Sbjct  322  GKNRTEEELRQLGHSAGFSHFRPIYIDYFYTVLEFQK  358



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC +MIM K+  I +GINFDLPEVV +AP IPG+THVGGDMFKSIP GDAIFMKW+
Sbjct  227  GSAGDCLKMIMSKYGGIKEGINFDLPEVVAQAPQIPGVTHVGGDMFKSIPCGDAIFMKWV  286

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+E K IM +CY +LP GGKL+ACEPVLP  +DD+ RTR LL GDIFVMTIY AK
Sbjct  287  LTTWTDDEIKLIMKNCYDSLPAGGKLIACEPVLPETSDDSHRTRALLSGDIFVMTIYGAK  346

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+HR EEEYRQL  S GF  FRA ++D+F+TVLEFQK
Sbjct  347  GRHRMEEEYRQLGNSAGFPHFRAVHIDYFFTVLEFQK  383



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC R IM++ P++ +G+NFDLPEVV KAP  PG+THVGGDMFK+IP GDAIFMKW+
Sbjct  253  GSSGDCLRAIMQRVPTVQRGVNFDLPEVVAKAPKYPGMTHVGGDMFKAIPAGDAIFMKWV  312

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L TW DEEC  I+ +CY ALP+ GK++ACEPVLP +TD++QRTR LLE DIFVMTIYR +
Sbjct  313  LMTWTDEECMLILKNCYKALPEKGKVIACEPVLPEETDNSQRTRALLENDIFVMTIYRVQ  372

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ RTEEE+RQ+  SVGFS+F+AFY D FYT+LEFQK
Sbjct  373  GRGRTEEEFRQIGLSVGFSNFKAFYSDHFYTILEFQK  409



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++K+P I +GINFDLPEVV +AP IPG++HVGGDMFKSIP GDAIFMKW+
Sbjct  214  GSAGDCLRMILQKYPHIKEGINFDLPEVVARAPTIPGVSHVGGDMFKSIPTGDAIFMKWV  273

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L+TW D+ECK I+ +C  +LP GGKL+ACEP LP +TD++ RTR LL  D+F+MTIY+AK
Sbjct  274  LSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAK  333

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
             K RTEE++RQL  S GFS+ R F++D+FY +LEFQK
Sbjct  334  SKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFQK  370



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM + PS+ +GINFDLPEVV +AP + G+THVGG+MF+SIP GDAIFMKW+
Sbjct  214  GSSGACLDMIMRRFPSVKRGINFDLPEVVAEAPPLAGVTHVGGNMFESIPTGDAIFMKWV  273

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW DEEC  I+ +CY ALP+GGK++ACEPVLP++TD+++RTR LLEGDIFVM IYR  
Sbjct  274  LTTWTDEECTAILRNCYNALPEGGKVIACEPVLPVETDNSRRTRALLEGDIFVMAIYRTL  333

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ RTEEE+RQL   VGF++FRA Y+D FY V+E+QK
Sbjct  334  GRERTEEEFRQLGGVVGFTAFRAIYLDPFYAVVEYQK  370



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMIM K+PSI +G+NFDLPEVV+KAP IPG+ HVGGD+ K+IP+   IFMKW+
Sbjct  197  GSAGDCLRMIMSKNPSIKKGVNFDLPEVVEKAPKIPGVEHVGGDLLKTIPSAVDIFMKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK I+ +C+ ALP GGK+VACEPVLP  TD++ R+R LLEGDIFVMTIYR+K
Sbjct  257  LTTWTDDECKHILKNCHDALPPGGKVVACEPVLPNHTDNSHRSRALLEGDIFVMTIYRSK  316

Query  305  GKHRTEEEYRQLSRSVGFSSFRA-FYVDFFYTVLEFQK  195
            GKHRTE EYR+L  + GF  F+A   +D FYTVLEFQK
Sbjct  317  GKHRTEMEYRELGIAAGFRYFKAKILLDQFYTVLEFQK  354



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++K+PSI +GINFDLPEVV +AP IPG++HVGGDMFKSIP  DA+FMKW+
Sbjct  215  GSAGDCLRMILQKYPSIKEGINFDLPEVVARAPPIPGVSHVGGDMFKSIPTADAMFMKWV  274

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L+TW D+ECK I+ +C  +LP GGKL+ACEP LP +TD++ RTR LL  D+F+MTIY+AK
Sbjct  275  LSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAK  334

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
             K RTEE++RQL  S GFS+ R F++D+FY +LEF K
Sbjct  335  SKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFTK  371



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 130/159 (82%), Gaps = 2/159 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIP--GITHVGGDMFKSIPNGDAIFMK  492
            G+ GDC RMI++K+P I +GINFDLPEVV +AP IP  G++HVGGDMFKSIP GDAIFMK
Sbjct  251  GSAGDCLRMILQKYPHIKEGINFDLPEVVARAPTIPETGVSHVGGDMFKSIPTGDAIFMK  310

Query  491  WMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYR  312
            W+L+TW D+ECK I+ +C  +LP GGKL+ACEP LP +TD++ RTR LL  D+F+MTIY+
Sbjct  311  WVLSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYK  370

Query  311  AKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            AK K RTEE++RQL  S GFS+ R F++D+FY +LEFQK
Sbjct  371  AKSKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFQK  409



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC +MI+EKHPSI  GINFDLP+VV+KAP IP I HVGGDM   IP GDAIFMKW+
Sbjct  204  GSVGDCLKMILEKHPSIELGINFDLPKVVEKAPQIPRIKHVGGDMLDYIPKGDAIFMKWI  263

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  + ++ECK+IM SCY ALP+ GK + C+PVLP  TDD++RTR LLE DI+ M IYRA+
Sbjct  264  LAIFTEDECKQIMKSCYNALPEKGKFIICDPVLPHHTDDSKRTRALLEIDIYGMAIYRAQ  323

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEEYRQL R+ GF+  +  Y+D F+T+LEF K
Sbjct  324  GKHRTEEEYRQLGRAAGFTDCKGVYIDHFFTILEFYK  360



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+
Sbjct  106  GSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWV  165

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAK
Sbjct  166  LTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  225

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            G HRTE+E++QL    GF   R + V
Sbjct  226  GNHRTEQEFKQLGFFAGFPHLRLYRV  251



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM +  +I QGINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  206  GSSGACLDMIMRRVGTIAQGINFDLPDVVAAAPPIAGVRHVGGDMFKSIPSGDAIFMKWV  265

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW ++EC  I+ +CYGALP+GGKL+ACEPV+P  TD + RTR LLE DIFVMT YR +
Sbjct  266  LTTWTNDECTAILKNCYGALPEGGKLIACEPVVPETTDTSTRTRALLENDIFVMTTYRTQ  325

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+EEE+RQL  + GF++FRA Y+D FY VLE+ K
Sbjct  326  GRERSEEEFRQLGLAAGFTAFRAIYLDPFYAVLEYLK  362



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+
Sbjct  169  GSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWV  228

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAK
Sbjct  229  LTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  288

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            G HRTE+E++QL    GF   R + V
Sbjct  289  GNHRTEQEFKQLGFFAGFPHLRLYRV  314



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM +  +I +G+NFDLP+VV  AP IPG+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  157  GSSGACLEMIMRRVRTIREGLNFDLPDVVAAAPPIPGVKHVGGDMFKSIPSGDAIFMKWV  216

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW ++EC  I+ +CY ALP GGKLVACEPV+P  TD + RTR LLE DIFVMT YR +
Sbjct  217  LTTWTNDECTAILRNCYAALPAGGKLVACEPVVPDTTDGSTRTRALLENDIFVMTTYRTQ  276

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+EEE+RQL  +VGF+ FRA Y+D FY +LE+ K
Sbjct  277  GRERSEEEFRQLGLAVGFTFFRAIYLDPFYALLEYTK  313



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM + P+IT+GINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  217  GSSGACLEMIMRRVPTITEGINFDLPDVVAAAPPIAGVRHVGGDMFKSIPSGDAIFMKWV  276

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+EC  I+ +C+ ALP GGKLVACEPV+P +TD + RTR LLE DIFVMT YR +
Sbjct  277  LTTWTDDECTAILRNCHAALPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQ  336

Query  305  GKHRTEEEYRQLS-RSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+EEE+R L   + GF++FRA Y+D FY VLE+ K
Sbjct  337  GRERSEEEFRHLGVDAAGFTAFRAIYLDPFYAVLEYTK  374



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 123/157 (78%), Gaps = 15/157 (10%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++K+P + +GINFDLPEVV KAP              SIP  DAIFMKW+
Sbjct  206  GSAGDCLRMILQKYPHV-EGINFDLPEVVAKAP--------------SIPAADAIFMKWV  250

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLEGDIFVMTIYRAK
Sbjct  251  LTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAK  310

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  311  GKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  347



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH  I +G+NFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+
Sbjct  157  GSAGDCLRMILQKHRFICEGMNFDLPEVVGEAPSIPGVTHIGGDMFKSIPATDAIFMKWV  216

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIF MTIYRAK
Sbjct  217  LTTWTDDECKLIMENCYKALPTGGKLIACEPVLPDDSNESQRTRALLEGDIFFMTIYRAK  276

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GKH TE+E++QL  S GF   R + V
Sbjct  277  GKHMTEQEFKQLGFSTGFPHLRLYRV  302



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM + P+IT+GINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  217  GSSGACLEMIMRRVPTITEGINFDLPDVVAAAPPIAGVRHVGGDMFKSIPSGDAIFMKWV  276

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+EC  I+ +C+  LP GGKLVACEPV+P +TD + RTR LLE DIFVMT YR +
Sbjct  277  LTTWTDDECTAILRNCHAXLPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQ  336

Query  305  GKHRTEEEYRQLS-RSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+EEE+R L   + GF++FRA Y+D FY VLE+ K
Sbjct  337  GRERSEEEFRHLGVDAAGFTAFRAIYLDPFYAVLEYTK  374



>gb|AAP03057.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=188

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+S+P+GDAIF+KW+
Sbjct  32   GSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFESVPSGDAIFVKWV  91

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL  DIF+MT YRAK
Sbjct  92   LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  151

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  152  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  188



>gb|AAP03056.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=206

 Score =   215 bits (547),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+S+P+GDAIF+KW+
Sbjct  50   GSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFESVPSGDAIFVKWV  109

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL  DIF+MT YRAK
Sbjct  110  LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  169

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  170  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  206



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM + P+I +GINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  221  GSSGACLEMIMRRVPTIKEGINFDLPDVVADAPAIAGVRHVGGDMFKSIPSGDAIFMKWV  280

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW ++EC  I+ +C+ ALP GGKLVACEPV+P +TD + RTR LLE DIFVMT YR +
Sbjct  281  LTTWTNDECTAILRNCHAALPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRTQ  340

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+EEE+  L  + GF+ FRA Y+D FY VLE+ K
Sbjct  341  GRERSEEEFHHLGIAAGFTGFRAIYLDPFYAVLEYTK  377



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM + P+I +G+NFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  211  GSSGACLEMIMRRVPTIREGVNFDLPDVVAAAPPIAGVKHVGGDMFKSIPSGDAIFMKWV  270

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW ++EC  I+  C+ ALP GGKLVACEPV+P  TD + RTR LLE DIFVMT YR +
Sbjct  271  LTTWTNDECTAILKKCHDALPDGGKLVACEPVVPETTDASTRTRALLENDIFVMTTYRTQ  330

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+EEE+RQL  + GF+ FRA Y+D FY +LE+ K
Sbjct  331  GRERSEEEFRQLGIAAGFAGFRALYLDPFYALLEYVK  367



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+
Sbjct  169  GSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWV  228

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAK
Sbjct  229  LTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  288

Query  305  GKHRTEEEYRQLSRSVGFSSF  243
            GKH TE+E++QL  S+  SS 
Sbjct  289  GKHMTEQEFKQLGFSLHSSSL  309



>gb|AAP03055.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=234

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+S+P+GDAIF+KW+
Sbjct  78   GSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFESVPSGDAIFVKWV  137

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL  DIF+MT YRAK
Sbjct  138  LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  197

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  198  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  234



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM +  +I  G+NFDLP+VV  AP IPG+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  209  GSSGACLEMIMRRVRTIRDGVNFDLPDVVAAAPPIPGVRHVGGDMFKSIPSGDAIFMKWV  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW +EEC  I+S+C+ ALP GGK++ACEPV+P  TD + RTR LLE DIFVM  YR +
Sbjct  269  LTTWTNEECTAILSNCHKALPGGGKVIACEPVVPDTTDGSTRTRALLENDIFVMATYRTQ  328

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+EEE+R L  + GF+SFRA Y+D FY VLE+ K
Sbjct  329  GRERSEEEFRHLGLAAGFASFRAIYLDPFYAVLEYTK  365



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKS-IPNGDAIFMKW  489
            G  GDC R+IM K+ SI +GINFDLPEVV+KAP IPGI HVGGD+ KS IP GDAIFMKW
Sbjct  197  GNSGDCLRLIMNKYKSIKKGINFDLPEVVEKAPKIPGIEHVGGDLLKSNIPPGDAIFMKW  256

Query  488  MLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRA  309
            +L T  DEECK I+ +C  ALP GGKL+ C+P+LP  TDD+ R+R +LE DI++MT+YR 
Sbjct  257  LLVTCTDEECKHILKNCSDALPSGGKLIICDPLLPNHTDDSHRSRAILEADIYIMTMYRT  316

Query  308  KGKHRTEEEYRQLSRSVGFSSFRA-FYVDFFYTVLEFQK  195
            KGKHRTE EYR L  + GF++ +A F +D ++TVLEF+K
Sbjct  317  KGKHRTETEYRALGVAAGFTNLKANFKIDNYFTVLEFEK  355



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MIM K+P+I +GINFDLP+++  AP +PGITHVGGD  +S+P GDAIF KW 
Sbjct  202  GNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLPGITHVGGDALESVPAGDAIFTKWT  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            + TW DEECK+++ +CY ALP  GKL+ CEPV P  TD++QRTR LL GDIF+MT+YR K
Sbjct  262  MLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYRTK  321

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  322  GKHRTEEQFKQLGISTGFLRFRAFHIDPYFPVLEFQK  358



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 117/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G C  MIM K+P+I +GIN+D P +V  AP  P ITH+GGD  +S+P GDAIFMKW+
Sbjct  205  GNSGVCLNMIMNKYPNIRKGINYDFPAMVSSAPEFPDITHIGGDALQSVPAGDAIFMKWI  264

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DEECK+ + +CY ALP  GKL+ CEPVLP  TD++QRTR LL GDIF+MT+YR K
Sbjct  265  FLAWTDEECKKTLQNCYKALPVDGKLIVCEPVLPELTDESQRTRALLGGDIFIMTMYRTK  324

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE+++QL  S GF  FRAFY+D +  VLEFQK
Sbjct  325  GKHRTEEQFKQLGASTGFFRFRAFYIDPYLAVLEFQK  361



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+S+P+GDAIF+KW+
Sbjct  219  GSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFESVPSGDAIFVKWV  278

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL  DIF+MT YRAK
Sbjct  279  LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  338

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  339  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  375



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  MIM +  +I +GINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  186  GSSGACLEMIMRRVDTIREGINFDLPDVVAAAPPIVGVRHVGGDMFKSIPSGDAIFMKWV  245

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW +EEC  I+ +CY ALP GGK++ACEPV+P +TD + RTR LLE DIFVMT YR +
Sbjct  246  LTTWTNEECTAILGNCYSALPDGGKVIACEPVVPEETDGSTRTRALLENDIFVMTTYRTQ  305

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+E+E+R L  + GF+ FRA Y+D  Y VLE+ K
Sbjct  306  GRERSEDEFRNLGIAAGFTGFRAIYLDPLYAVLEYTK  342



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MIM K+P+I +GINFDLP+++  AP +PGITHVGGD  + +P GDAIF KW 
Sbjct  179  GNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLPGITHVGGDALELVPAGDAIFTKWT  238

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            + TW DEECK+++ +CY ALP  GKL+ CEPV P  TD++QRTR LL GDIF+MT+Y+ K
Sbjct  239  MLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYKTK  298

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  299  GKHRTEEQFKQLGISAGFLRFRAFHIDPYFPVLEFQK  335



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MIM K+P+I +GINFDLP+++  AP +PGITHVGGD  + +P GDAIF KW 
Sbjct  202  GNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLPGITHVGGDALELVPAGDAIFTKWT  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            + TW DEECK+++ +CY ALP  GKL+ CEPV P  TD++QRTR LL GDIF+MT+Y+ K
Sbjct  262  MLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYKTK  321

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  322  GKHRTEEQFKQLGISAGFLRFRAFHIDPYFPVLEFQK  358



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH  I +GINFD+PEVV +AP+I G+TH+GGD FKSIP  DAIFMKW+
Sbjct  74   GSAGDCLRMILQKHRFIYEGINFDVPEVVGEAPSILGVTHIGGDTFKSIPAADAIFMKWV  133

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+E K IM +CY ALP GGKL+AC+PVL   ++++QRTR LLEGDIFVMTIYRAK
Sbjct  134  LTTWTDDEYKLIMENCYKALPAGGKLIACKPVLLDDSNESQRTRALLEGDIFVMTIYRAK  193

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GKHRTE+E++QL  S GF   R + V
Sbjct  194  GKHRTEQEFKQLGFSAGFLHLRLYRV  219



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC R+I++KH  I +GINFDLPEVV KAP+IP +TH+GGDMFKSI   DAIFMKW+
Sbjct  74   GSAGDCLRIILQKHCFICEGINFDLPEVVAKAPSIPEVTHIGGDMFKSIHVVDAIFMKWV  133

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LTTW D+ECK IM + Y AL  G KL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAK
Sbjct  134  LTTWTDDECKLIMENYYKALLAGRKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  193

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVL  207
            GKH+TE+E++QL  S GF   RAF    F   L
Sbjct  194  GKHKTEQEFKQLGFSTGFPHLRAFISIIFTLFL  226



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MIM K+P+I +GINFDLP+++  AP  PGITHVGGD  +S+P GDAIF+KW 
Sbjct  202  GNSGVSLNMIMNKYPNILKGINFDLPDMISSAPQYPGITHVGGDALESVPAGDAIFIKWT  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            + TW DEE K+ + SCY ALP  GKL+ CEPVLP QTD+++RTR LL  DI++MT+YR K
Sbjct  262  VLTWTDEEFKKALQSCYKALPVAGKLILCEPVLPEQTDESKRTRALLAADIWIMTMYRTK  321

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GKHRTEE+++QL  S GF SFRAF++D +  VLEF K
Sbjct  322  GKHRTEEQFKQLGISAGFKSFRAFHIDPYLPVLEFHK  358



>gb|AAP03051.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=167

 Score =   202 bits (515),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI+ K+  I + INFDLPEVV KAP IPGITHVGG+ F+S+P+GDAIF+KW+
Sbjct  16   GSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNTFESVPSGDAIFVKWV  75

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL  DIF+MT YRAK
Sbjct  76   LTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAK  135

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTV  210
            GKHRTEEEYRQL    GF  FR  +VD+F+ V
Sbjct  136  GKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPV  167



>ref|XP_009787879.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Nicotiana 
sylvestris]
Length=121

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  554  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQT  375
            I H+GGDMFK +P G+AIFMKW+LTTW D+ECK+IM SCY ALP+ GKL+ACEPVLP  T
Sbjct  1    INHIGGDMFKYVPKGNAIFMKWVLTTWTDDECKQIMKSCYNALPKKGKLIACEPVLPHHT  60

Query  374  DDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            DD++RTR LLEGDIFVMTIYRAKGKHRTE+EYRQL RS GF+  R FY+D F+TVLEF K
Sbjct  61   DDSKRTRALLEGDIFVMTIYRAKGKHRTEDEYRQLGRSAGFADCRGFYIDHFFTVLEFHK  120



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G+C RMIM K+ SI +G+ FDLPEVV+KAP IPGI HVGGD+ KS+P GDAIFMKW+
Sbjct  203  GNSGECLRMIMSKYQSIKKGVKFDLPEVVEKAPKIPGIEHVGGDVLKSVPPGDAIFMKWI  262

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L    D+ECK+I  +C+ ALP GGKL+ C+P+LP + DD + +R +LE DI++MT+YR K
Sbjct  263  LVACTDDECKQIFKNCFDALPPGGKLIVCDPLLPDRADDNRSSRAILEADIYIMTMYRTK  322

Query  305  GKHRTEEEYRQLSRSVGFSSFR-AFYVDFFYTVLEFQK  195
            GKHRTE E R+L  + GF + +  F VD ++TVLEFQK
Sbjct  323  GKHRTETECRELGLAAGFHNLKPKFNVDHYFTVLEFQK  360



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  614  TQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCY  435
            + GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY
Sbjct  75   SAGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCY  134

Query  434  GALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVG  255
             A+P GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAKGKH TE+E++QL  S G
Sbjct  135  KAIPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHMTEQEFKQLGFSAG  194

Query  254  FSSFRAFYV  228
            F   R + V
Sbjct  195  FPHLRLYRV  203



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  614  TQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCY  435
            + GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY
Sbjct  170  SAGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCY  229

Query  434  GALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVG  255
             A+P GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAKGKH TE+E++QL  S G
Sbjct  230  KAIPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHMTEQEFKQLGFSAG  289

Query  254  FSSFRAFYV  228
            F   R + V
Sbjct  290  FPHLRLYRV  298



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMF SIP  +AIFMKW+
Sbjct  169  GSAGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVTHIGGDMFNSIPAANAIFMKWV  228

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L TW D+ECK IM +CY AL  GGKL+ACEPVL   ++++QRTR LLEGDIFVMTIYRAK
Sbjct  229  LATWTDDECKLIMENCYKALLAGGKLIACEPVLLDDSNESQRTRALLEGDIFVMTIYRAK  288

Query  305  GKHRTE  288
            GKHRTE
Sbjct  289  GKHRTE  294



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  569  PNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPV  390
            P+IP +TH+GG MFKSI   DAIFMKW+LTTW D+ECK IM +CY ALP GG+L+ACEPV
Sbjct  57   PSIPRVTHIGGGMFKSIHAVDAIFMKWVLTTWTDDECKLIMENCYKALPAGGELIACEPV  116

Query  389  LPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTV  210
            LP  ++++QRTR LLEGDIFVMTIYRAKGKHR E+E++QL  S  F   RAFY D+F+T+
Sbjct  117  LPDDSNESQRTRALLEGDIFVMTIYRAKGKHRIEQEFKQLGFSASFPHLRAFYFDYFHTL  176

Query  209  LEFQK  195
            LEFQK
Sbjct  177  LEFQK  181



>gb|EMT14045.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=197

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 118/197 (60%), Gaps = 48/197 (24%)
 Frame = -2

Query  641  MIMEKHPSITQGINFDLPEVVQKA------------------------------------  570
            MIM + P+I +G+NFDLP VV  A                                    
Sbjct  1    MIMRRVPTIREGVNFDLPNVVAAAHPIAEVFTCSEFRVSTSTVDEFDSEVSVQSTLVLLA  60

Query  569  ----PNIP--------GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGAL  426
                 N+P        G+ HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+  C+ AL
Sbjct  61   ILAKKNLPVQVQSDCAGVKHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILKKCHEAL  120

Query  425  PQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSS  246
            P+GGKL+ACEPV+P  TD + RTR LLE DIFVMT YR +G+ R+EEE+RQL  + GF+ 
Sbjct  121  PEGGKLIACEPVVPDTTDASTRTRALLENDIFVMTTYRTQGRERSEEEFRQLGLTAGFAG  180

Query  245  FRAFYVDFFYTVLEFQK  195
            FRA Y+D FY VLE+ K
Sbjct  181  FRALYLDPFYAVLEYVK  197



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMF SIP  +AIFMKW+
Sbjct  169  GSAGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVTHIGGDMFNSIPAANAIFMKWV  228

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L TW D+ECK IM +CY AL  GGKL+ACEPVL   ++++QRTR LLEGDIFVMTIYRAK
Sbjct  229  LATWTDDECKLIMENCYKALLAGGKLIACEPVLLDDSNESQRTRALLEGDIFVMTIYRAK  288



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 105/157 (67%), Gaps = 20/157 (13%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C  M+M +  +I  G+NFDLP+VV  AP IPG+ HVGGDMFKSIP+GDAIFMK  
Sbjct  209  GSSGACLEMMMRRVRTIRDGVNFDLPDVVAAAPPIPGVRHVGGDMFKSIPSGDAIFMK--  266

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
                              ALP GGK++ACEPV+P  TD + RTR LLE DIFVM  YR +
Sbjct  267  ------------------ALPGGGKVIACEPVVPDTTDGSTRTRALLENDIFVMATYRTQ  308

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R+EEE+R L  + GF+SFRA Y+D FY VLE+ K
Sbjct  309  GRERSEEEFRHLGLAAGFASFRAIYLDPFYAVLEYTK  345



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 95/128 (74%), Gaps = 11/128 (9%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ GDC RMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+
Sbjct  137  GSVGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVTHIGGDMFKSIPAADAIFMKWL  196

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
                       IM  CY ALP GGKL+ CEPVLP  ++++QRTR LLEGDIFVMTIYRAK
Sbjct  197  -----------IMEKCYKALPAGGKLIVCEPVLPDDSNESQRTRALLEGDIFVMTIYRAK  245

Query  305  GKHRTEEE  282
                T+  
Sbjct  246  AYQWTKNR  253



>ref|XP_006428523.1| hypothetical protein CICLE_v10013676mg [Citrus clementina]
 gb|ESR41763.1| hypothetical protein CICLE_v10013676mg [Citrus clementina]
Length=102

 Score =   159 bits (403),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = -2

Query  497  MKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTI  318
            ++W+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTI
Sbjct  2    LQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTI  61

Query  317  YRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            YRAKGKHRTE+E++QL  S GF   RAFYVD+F+T+LEFQK
Sbjct  62   YRAKGKHRTEQEFKQLGLSAGFPHLRAFYVDYFHTLLEFQK  102



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G C + I++KH  + +GINFDLP+VV+ AP   GI HVGGDM + +P GD IFMK +
Sbjct  197  GSSGFCLKKILDKHKGL-EGINFDLPKVVEAAPPYLGIEHVGGDMLEWVPQGDVIFMKGI  255

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L +W D+EC  ++ +CY ALP+ GK++A E VLP+ TD +  TR LL+ D+F+M IY   
Sbjct  256  LCSWDDDECVGLLKNCYKALPEKGKVIALEQVLPMHTDTSPSTRALLQADVFLMAIYSPG  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
             K RTE+ +R+LS + GF +        FYT LEFQK
Sbjct  316  SKRRTEDIFRRLSEAAGFRTLEIVLPGSFYTALEFQK  352



>gb|AGO50639.1| caffeic acid O-methyltransferase [Linum usitatissimum]
Length=367

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHPSI +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  210  GGTGAVLSMILSKHPSI-KGINFDLPHVIEDAPALPGVQHVGGDMFASVPTGDAIFMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C + + +C+ ALP  GK++ CE ++P+  D +  TR ++  D  +M  +   
Sbjct  269  CHDWSDQHCLKFLKNCFDALPANGKVIVCECIMPVAPDTSLATRNVVHIDC-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT+ E+  L++  GF  FR     F   V+EF K
Sbjct  328  GKERTQAEFESLAKGAGFQGFRVVCSAFNTYVMEFLK  364



>gb|AAA80579.1| 3' flavonoid O-methyltransferase [Chrysosplenium americanum]
Length=343

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+P+I +GINFDLP V+Q AP  PGI HVGGDMF S+P GDAIFMKW+
Sbjct  185  GGTGATLTKILSKYPTI-RGINFDLPHVIQDAPEYPGIEHVGGDMFVSVPKGDAIFMKWI  243

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W +E+C +++ +CY ALP  GK++  E +LP+  D +  ++L +  D+ ++T   + 
Sbjct  244  CHDWNEEQCLKLLKNCYDALPNNGKVIVAEYILPVVPDSSLASKLSVTADVMIVT-QNSG  302

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  303  GKERTEKEFEALAKAAGFQGFQVFCNAFTIYIIEFSK  339



>gb|KJB23958.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=318

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+
Sbjct  162  GGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWI  220

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + +  CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   
Sbjct  221  CHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPG  279

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+RS GF  F+     F   ++EF K
Sbjct  280  GKERTEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  316



>gb|AAZ32409.1| S-methyltransferase [Catharanthus roseus]
Length=362

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    +I  K+P++ +GIN+DLP V Q AP  PG+ HVGGDMF+S+P GDAIFMKW+
Sbjct  207  GGLGVTLDLITSKYPNL-KGINYDLPHVTQNAPTYPGVVHVGGDMFESVPKGDAIFMKWI  265

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +CY ALP+ GK++A + +LP+  D++  T+ + + D+F + +Y   
Sbjct  266  LHDWDDEHCLKLLKNCYKALPENGKVIAVDAILPMNPDNSSSTKHISQVDLFTLVLYHPG  325

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE E+  L    GF   R   V     V+EF K
Sbjct  326  GKERTENEFLALVAEAGFGGIRKVCVCCDLWVMEFYK  362



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHP+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGAVINMIVSKHPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFASVPKADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F   ++EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVVCCAFNTNIMEFLK  363



>gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium]
Length=366

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIF+KW+
Sbjct  210  GGIGATLNMIISKYPSI-KGINFDLPHVIQDAPAFPGVEHVGGDMFVSVPKGDAIFIKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  +++++  D  +M  +   
Sbjct  269  CHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+R L+++ GF  F+     F   ++EF K
Sbjct  328  GKERTEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  364



>gb|KJB23954.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=365

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+
Sbjct  209  GGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + +  CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   
Sbjct  268  CHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+RS GF  F+     F   ++EF K
Sbjct  327  GKERTEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  363



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+
Sbjct  209  GGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + +  CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   
Sbjct  268  CHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+RS GF  F+     F   ++EF K
Sbjct  327  GKERTEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  363



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    +I++K+P I +GINFDLP VV KAP IPG+ HVGGDMF S+P GDAIFMKW+
Sbjct  199  GGVGTSLAVILKKYPEI-KGINFDLPHVVAKAPQIPGVEHVGGDMFVSVPQGDAIFMKWI  257

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C  ++ +CY ++P+ GK++  + VLP   D     R+ L  D+  M +Y   
Sbjct  258  LHDWSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVLDTGAGARVALSIDLL-MLVYNPG  316

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT E++ +L+++ GFSS +      F +V+EF K
Sbjct  317  GKERTFEDFEKLAKASGFSSVKVPVTVDFISVVEFHK  353



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIF+KW+
Sbjct  210  GGIGATLNMIISKYPSI-KGINFDLPHVIQDAPAFPGVEHVGGDMFVSVPKGDAIFIKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  +++++  D  +M  +   
Sbjct  269  CHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+R L+++ GF  F+     F   ++EF K
Sbjct  328  GKERTEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  364



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    +I++K+P I +GINFDLP VV KAP IPG+ HVGGDMF S+P GDAIFMKW+
Sbjct  199  GGVGTSLTVILKKYPEI-KGINFDLPHVVAKAPQIPGVEHVGGDMFVSVPQGDAIFMKWI  257

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C  ++ +CY ++P+ GK++  + VLP   D     R+ L  D+  M +Y   
Sbjct  258  LHDWSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVLDTGAGARVALSIDLL-MLVYNPG  316

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT E++ +L+++ GFSS +      F +V+EF K
Sbjct  317  GKERTFEDFEKLAKASGFSSVKVPVTVDFISVVEFHK  353



>ref|XP_009392797.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI  KHP I   INFDLP V+ +AP  PG+ HVGGDMF S+P+GDAI MKW+
Sbjct  208  GGIGATLFMITSKHPHI-HAINFDLPHVISEAPPFPGVEHVGGDMFASVPSGDAILMKWI  266

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +I+ SC+ ALP+ GK++  E VLP+  + T R + +   D+ +M  +   
Sbjct  267  LHDWSDEHCAKILKSCWEALPEKGKVIVVECVLPVVPEPTPRAQGVFHVDL-IMLAHNPG  325

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTEEE+  L++  GFS F+A Y+     V+EF K
Sbjct  326  GKERTEEEFHGLAKQAGFSGFKATYIFANAWVIEFTK  362



>gb|ADN27527.1| caffeic acid O-methyltransferase [Camellia sinensis]
Length=363

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHP+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  207  GGTGATLNMIVSKHPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWI  265

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C + + +CY ALP  GK++  E +LP+  D    T+ ++  D+ +M  +   
Sbjct  266  CHDWSDDHCLKFLKNCYDALPHNGKVIIAECILPVAPDTKLATKNVVHIDV-IMLAHNPG  324

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF+ FR     F   V+EF K
Sbjct  325  GKERTQKEFEALAKGAGFAGFRVMCCAFNTYVMEFLK  361



>gb|KDO42947.1| hypothetical protein CISIN_1g030025mg [Citrus sinensis]
Length=184

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+  + I  K+P I +GINFDLP V+Q +P  PG+ HVGGDMF+S+PNGDAI +KW+
Sbjct  30   GSLGNTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVKHVGGDMFQSVPNGDAILIKWI  88

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +C+ ++P+GGK++  E VLP   ++   +++    D+ VMT Y   
Sbjct  89   LHDWSDEHCLKLLKNCHKSIPEGGKVIVVESVLPELPENGTHSKINSLADVLVMTQYPG-  147

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +V FF+   V+EF K
Sbjct  148  GKERTKHEFTTLATEAGFSGIR--FVCFFHNLWVMEFYK  184



>ref|XP_006478221.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=352

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+  R I  K+P I +GINFDLP V+Q +P  PG+ HVGGDMF+S+PNGDAI +KW+
Sbjct  198  GSLGNTLREITSKYPHI-KGINFDLPHVIQHSPEYPGVKHVGGDMFQSVPNGDAILIKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +CY ++P+GGK++  E VLP   + +  +++    D+ VMT Y   
Sbjct  257  LHDWSDEHCLKLLKNCYKSIPEGGKVIVVESVLPELPETSTHSKINSLADVLVMTQYPG-  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  316  GKERTKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI  K+P I +GINFDLP V+ +AP +PG+ HVGGDMF SIP+GDAI MKW+
Sbjct  213  GGIGATLHMITSKYPHI-KGINFDLPHVISEAPPLPGVEHVGGDMFASIPSGDAILMKWI  271

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            +  W DE C +I+ +CY ALP  G+++ CE +LP+  +     + +   D+ +M  +   
Sbjct  272  MHDWSDEHCAKILENCYKALPNNGRVILCECILPVAPEPVPSAQGVFHLDM-IMLAHNPG  330

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+EY+ L++  GF+ F+A Y      VLEF K
Sbjct  331  GKERTEKEYQDLAKGAGFTGFKAQYCFSTAWVLEFTK  367



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    M++ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+
Sbjct  209  GGTGATLNMLVTKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + +  CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   
Sbjct  268  CHDWSDEHCSKFLKKCYEALPDNGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+RS GF  F+     F   ++EF K
Sbjct  327  GKERTEKEFEALARSAGFQGFQVKCCAFGTYIMEFLK  363



>ref|XP_008343815.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=149

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 94/149 (63%), Gaps = 2/149 (1%)
 Frame = -2

Query  641  MIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEE  462
            MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W DE 
Sbjct  1    MIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEH  59

Query  461  CKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEE  282
            C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK RTE+E
Sbjct  60   CLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHID-EIMLAHNPGGKERTEKE  118

Query  281  YRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            +  L++  GF  FR     F    +EF K
Sbjct  119  FEALAKGSGFQGFRVVCSAFNTYAIEFLK  147



>ref|XP_007218166.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19365.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PGI HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGINHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E++ L++  GF  F      F   V+EF K
Sbjct  327  GKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>ref|XP_006441599.1| hypothetical protein CICLE_v10020870mg [Citrus clementina]
 ref|XP_006441601.1| hypothetical protein CICLE_v10020873mg [Citrus clementina]
 gb|ESR54839.1| hypothetical protein CICLE_v10020870mg [Citrus clementina]
 gb|ESR54841.1| hypothetical protein CICLE_v10020873mg [Citrus clementina]
Length=352

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+  + I  K+P I +GINFDLP V+Q +P  PG+ HVGGDMF+S+PNGDAI +KW+
Sbjct  198  GSLGNTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVKHVGGDMFQSVPNGDAILIKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +CY ++P+GGK++  E VLP   + +  +++    D+ VMT Y   
Sbjct  257  LHDWSDEHCLKLLKNCYKSIPEGGKVIVVESVLPELPETSTHSKINSLADVLVMTQYPG-  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  316  GKERTKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>gb|AID68566.1| caffeic O-methyltransferase [Punica granatum]
Length=370

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP++PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  214  GGTGAVLSMIVAKYPSI-KGINFDLPHVIEDAPSLPGVEHVGGDMFVSVPKGDAIFMKWI  272

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  273  CHDWSDEHCLKFLKNCYAALPDHGKVIVAECILPLSPDPSLATKGVIHIDC-IMLAHNPG  331

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F   V+EF K
Sbjct  332  GKERTEKEFEALAKGAGFEGFRVACCAFNTYVMEFLK  368



>ref|XP_004137204.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 gb|KGN53621.1| hypothetical protein Csa_4G091880 [Cucumis sativus]
Length=359

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  203  GGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVEHVGGDMFVSVPKGDAIFMKWI  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  262  CHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDASLATKGVIHIDL-IMLAHNPG  320

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E++ LS++ GF  F+     F   V+EF K
Sbjct  321  GKERTEKEFQALSKAAGFDGFKVHCCAFNTYVMEFLK  357



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+
Sbjct  209  GGTGATINMIVSKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + ++ CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   
Sbjct  268  CHDWSDEHCSKFLNKCYEALPDNGKVIVAECILPDYPDASLATKLVVHIDC-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF  FR     F   ++EF K
Sbjct  327  GKERTQKEFEALAKGAGFQGFRVKCCAFGTYIMEFLK  363



>ref|XP_008362842.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=253

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  97   GGTGAILNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  155

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  156  CHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHID-EIMLAHNPG  214

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  215  GKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  251



>ref|XP_004156527.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=359

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  203  GGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVEHVGGDMFVSVPKGDAIFMKWI  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  262  CHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDASLATKGVIHIDL-IMLAHNPG  320

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E++ LS++ GF  F+     F   V+EF K
Sbjct  321  GKERTEKEFQALSKAAGFDGFKVHCCAFNTYVMEFLK  357



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  203  GGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVEHVGGDMFVSVPKGDAIFMKWI  261

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  262  CHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPVAPDASLATKGVIHIDL-IMLAHNPG  320

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E++ LS++ GF  F+     F   V+EF K
Sbjct  321  GKERTEKEFQALSKAAGFLGFKVHCCAFNTYVMEFLK  357



>ref|XP_008380838.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWTDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|ABI54118.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWTDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLSMIVSKYPSI-RGINFDLPHVIEDAPSYPGVDHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYDALPNNGKVIVAECILPVAPDTSLATKGVIHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  327  GKERTEKEFEALAKGAGFQGFQVLGCAFNTYIMEFIK  363



>gb|KHN19569.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=232

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDL  V++ AP+ PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  76   GGTGAVINMIVSKYPTI-KGINFDLSHVIEDAPSYPGVEHVGGDMFVSVPKADAIFMKWI  134

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C + + +CY ALP  GK++  E +LP+  D +  T+ ++ GD+ +M  +   
Sbjct  135  CHDWSDDHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHGDV-IMLAHHPG  193

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTEEE+  L++  GF  F      F   V+EF K
Sbjct  194  GKERTEEEFEALAKGSGFQGFLVLCCAFNTYVMEFLK  230



>emb|CBI23095.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V+  AP+ PG+ HVGGDMF S+P GDAIFMKWM
Sbjct  80   GGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVEHVGGDMFVSVPKGDAIFMKWM  138

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP  GK++  E +LP+  D +  T+  +  D+ +M  Y   
Sbjct  139  CYEWDDAHCLKFLENCYQALPDNGKVIVAECILPVVPDTSLATKTAVHIDV-IMLAYNTG  197

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  198  GKARTEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  234



>ref|XP_006441596.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
 gb|ESR54836.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
Length=352

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 105/159 (66%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+  + I+ K+P I +GINFDLP V+Q AP  PG+ HVGGDMF+S+PNGDAI +KW+
Sbjct  198  GSLGNTLKAIISKYPHI-KGINFDLPHVIQHAPEYPGVKHVGGDMFRSVPNGDAILIKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +C+ ++P+GGK++  E VLP   + +  +++   GD+ VMT Y   
Sbjct  257  LHDWSDEHCLKLLKNCHKSIPEGGKVIVVESVLPELPETSTHSKINFLGDVLVMTQYPG-  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +  FF+   V+EF K
Sbjct  316  GKERTKHEFMTLATGAGFSGVR--FDCFFFNLWVMEFHK  352



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLSMIVSKYPSI-RGINFDLPHVIEDAPSYPGVDHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYDALPNNGKVIVAECILPVAPDTSLATKGVIHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  327  GKERTEKEFEALAKGAGFQGFQVLGCAFNTYIMEFIK  363



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI  KHP I +GINFDLP V+ +AP  PG+ H+GGDMF S+P GDAIFMKW+
Sbjct  208  GGIGATLYMITTKHPRI-RGINFDLPHVISEAPPFPGVEHIGGDMFASVPRGDAIFMKWI  266

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +I+ +C  ALP+ GK++  E VLP+  + T R + +   D+ +M  +   
Sbjct  267  LHDWSDEHCTKILKNCCEALPEKGKVIVVECVLPVVPEPTPRAQGVFNIDL-IMLAHNPG  325

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GFS F+A Y+     V+EF K
Sbjct  326  GKERTEKEFEGLAKEAGFSGFKASYIFANTWVMEFTK  362



>gb|AGS49204.1| O-methyltransferase [Zea mays]
Length=364

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + R +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKARGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010918594.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=362

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G   +MI+ K+P I QGINFDLP V+  AP IPG+ HVGGDMF SIP+ DAIFMKW+
Sbjct  208  GGLGATLQMIVSKYPHI-QGINFDLPHVISGAPLIPGVVHVGGDMFSSIPSADAIFMKWI  266

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +I+ +C+ ALP  GK++  E +LP        T++L  GD+ ++T Y   
Sbjct  267  LHDWSDEHCLKILKNCWKALPNNGKVIVAECLLPEAPKANAETQVLYYGDLAMLT-YNIG  325

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF+ F+A        V+EF K
Sbjct  326  GKERTKKEFESLAKEAGFAHFKAECCALNMWVMEFLK  362



>ref|XP_010934981.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=240

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI  K+P I +GINFDLP V+ +AP  PG+ HVGGDMF S+P+GDAI MKW+
Sbjct  86   GGIGATLHMITSKYPHI-KGINFDLPHVISEAPPFPGVEHVGGDMFTSVPSGDAILMKWI  144

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            +  W DE C +I+ +CY ALP  GK++ CE +LP+  +     + +   D+ +M  +   
Sbjct  145  MHDWSDEHCAKILENCYKALPNNGKVILCECILPVAPEPVPSAQSVFHLDM-IMLAHNPG  203

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE++Y+ L++  GF+ F+A Y      VL F K
Sbjct  204  GKERTEKQYQDLTKRAGFTGFKAQYCFSTAWVLVFTK  240



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E++ L++  GF  F      F   V+EF K
Sbjct  327  GKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>sp|Q43609.1|COMT1_PRUDU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Prunus dulcis]
 emb|CAA58218.1| caffeic O-methyltransferase [Prunus dulcis]
Length=365

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E++ L++  GF  F      F   V+EF K
Sbjct  327  GKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>ref|XP_007218167.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19366.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E++ L++  GF  F      F   V+EF K
Sbjct  327  GKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>gb|AGS49202.1| O-methyltransferase [Zea mays]
Length=364

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS FRA Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFRATYIYANAWAIEFIK  364



>ref|XP_008382714.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=229

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  73   GGTGIVLNMIVFKYPSI-KGINFDLPYVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  131

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  132  CHDWSDEHCLKFLKNCYSALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPG  190

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  191  GKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  227



>gb|ADR31597.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=167

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  12   GGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWI  70

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  71   CHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPG  129

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  130  GKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  166



>gb|EMT30204.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=339

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ ++PSI +G+NFDLP V+ +AP+  G+ H+GGDMFK +P+GDAI MKW+
Sbjct  185  GGVGATIHTILCRYPSI-EGVNFDLPHVISEAPSFAGVHHIGGDMFKKVPSGDAILMKWI  243

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C  ++S+CY ALP  GK+V  E +LP++ D+T   +   E D+ ++T +   
Sbjct  244  LHDWNDEHCTTLLSNCYDALPAHGKVVIVEYILPVKPDETATAQRSFEADMIMLT-HTPG  302

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R   EY +L+RS GF+S +A YV     V+E  K
Sbjct  303  GKERYLREYEELARSAGFASVKATYVYSNIWVIELNK  339



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  327  GKERTEKEFEALAKESGFQGFRVVCSAFNIYAIEFLK  363



>gb|ABI54117.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|AIY22648.1| caffeic acid 3-O-methyl transferase, partial [Saccharum arundinaceum]
Length=224

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I   HP I +G+NFDLP V+ +AP  PG+ HVGGDMFKS+P GDAI MKW+
Sbjct  70   GGIGATLHAITSHHPQI-RGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWI  128

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+   + + +   D+ +M  +   
Sbjct  129  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAVPKAQGVFHVDM-IMLAHNPG  187

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R E E+R L++  GFS F+A Y+      +EF K
Sbjct  188  GRERYEREFRDLAKGAGFSGFKATYIYANAWAIEFIK  224



>gb|AGS49209.1| O-methyltransferase [Zea mays]
Length=364

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPQFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+  +PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLSMIVSNYPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + SCY ALP  GK++  E +LP+  D +  T+ +   D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKSCYDALPNNGKVIVAECILPVAPDTSLATKGVAHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E+E++ L++  GF  FR     F   V+EF K
Sbjct  327  GKERAEKEFQALAKGAGFQGFRVVCSAFNTYVMEFLK  363



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  209  GGTGAIINMIVSKYPNI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYDALPENGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F   ++EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVLCSAFNSYIMEFLK  363



>ref|XP_008381500.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=433

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  277  GGTGAVLXMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  335

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  336  CHDWXDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPG  394

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  395  GKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  431



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHP+I +GINFDLP V++ AP+ PG+ +VGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGAVINMIVSKHPTI-KGINFDLPHVIEDAPSYPGVEYVGGDMFASVPKADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  + +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYQALPDNGKVIVAQCILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F   ++EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVVCCAFNTNIMEFLK  363



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +G NFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLSMIVSKYPSI-KGTNFDLPHVIEDAPSFPGVEHVGGDMFASVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C   + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWSDEHCLNFLKNCYDALPANGKVIVAECILPVAPDSSLATKGVIHIDC-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   V+EF K
Sbjct  327  GKERTEKEFEALAKGAGFQGFQVMCCAFNSYVMEFLK  363



>gb|EYU31472.1| hypothetical protein MIMGU_mgv1a019059mg, partial [Erythranthe 
guttata]
Length=242

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 98/142 (69%), Gaps = 2/142 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+Q AP+ PG+ H+GGDMF S+P GDAIFMKW+
Sbjct  88   GGTGAILNMIISKYPSI-KGINFDLPHVIQHAPSYPGVEHIGGDMFVSVPKGDAIFMKWI  146

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            +  W DE+C +++ +C+ +L + GK++  E ++P + D +  T+ +L  D+ ++T +   
Sbjct  147  VHDWSDEQCLKLLKNCHNSLQENGKVILAELIMPEEPDKSVATKTVLHSDVLMLT-HNPG  205

Query  305  GKHRTEEEYRQLSRSVGFSSFR  240
            G+ RTE+E+  L+++ GF  FR
Sbjct  206  GRERTEKEFHTLAKAAGFREFR  227



>gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala]
 gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala]
Length=365

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI  GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  209  GGTGAVISMIVSKYPSI-NGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP+ GK++  E +LP   D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCVKFLKNCYDALPENGKVIVAECILPASPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+++ GF  FR     F   ++EF K
Sbjct  327  GKERTEKEFEALAKAAGFQGFRVCCSAFNTYIMEFLK  363



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHP+I +GINFDLP V++ AP   G+ HVGGDMF+S+P GDAIFMKW+
Sbjct  206  GGTGATLNMIISKHPTI-KGINFDLPHVIEDAPAYNGVEHVGGDMFESVPKGDAIFMKWI  264

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY +LP  GK++ CE +LP+  +     R +   D  +M  +   
Sbjct  265  CHDWSDEHCLKFLKNCYASLPDHGKVIVCEYILPVAPETNHAARTVFHVDA-IMLAHNPG  323

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     +   V+EF K
Sbjct  324  GKERTEQEFEGLAKGAGFEGFRVACSAYDTKVIEFYK  360



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+PSI +GINFDLP V+++AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  209  GGTGAVINTIVSKYPSI-KGINFDLPHVIEEAPSFPGVEHVGGDMFVSVPKADAVFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCVKFLKNCYDALPENGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F   ++EF K
Sbjct  327  GKERTEKEFEALAKGAGFQGFRVCCSAFNSYIMEFLK  363



>gb|AGS49206.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAIASRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTETTPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49189.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49205.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI  K+P I +GINFDLP V+ +AP  PG+ H+GGDMF S+P+GDAI MKW+
Sbjct  213  GGIGATLHMITSKYPHI-KGINFDLPHVISEAPPFPGVEHIGGDMFASVPSGDAILMKWI  271

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            +  W DE C +I+ +C+ ALP  GK++ CE +LP+  +     + +   D+ +M  +   
Sbjct  272  MHDWSDEHCAKILENCHKALPNNGKVILCECILPVAPEPIPSAQGVFHVDM-IMLAHNPG  330

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+EY+ L++  GF+ F+A Y      VLEF K
Sbjct  331  GKERTEKEYQDLAKGAGFTGFKAQYCFSTAWVLEFTK  367



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ VM  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDV-VMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF   R     F   V+EF K
Sbjct  327  GKERTEQEFEALAKGSGFQGIRVACNAFNTYVIEFLK  363



>gb|ADR31603.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=203

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  48   GGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWI  106

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  107  CHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPG  165

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  166  GKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  202



>gb|AGS49187.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AEI54336.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Glycine 
max]
Length=365

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGAVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ ++T +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIMLT-HNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   V+EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFQVLCCAFNTYVMEFLK  363



>ref|NP_001106047.1| catechol O-methyltransferase [Zea mays]
 gb|AAQ24340.1| O-methyltransferase [Zea mays]
 gb|AAQ24341.1| O-methyltransferase [Zea mays]
 gb|ABQ58826.1| flavonoid O-methyltransferase [Zea mays]
 gb|AFW61191.1| brown midrib3 [Zea mays]
 gb|AGS49212.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49217.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEHEFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49213.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49191.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49190.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49215.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49207.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49195.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_006441468.1| hypothetical protein CICLE_v10020874mg [Citrus clementina]
 gb|ESR54708.1| hypothetical protein CICLE_v10020874mg [Citrus clementina]
Length=352

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 103/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+  + I  K+P I +GINFDLP V+Q +P  PG+ HVGGDMF+S+PNGDAI +KW+
Sbjct  198  GSLGNTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVKHVGGDMFQSVPNGDAILIKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +CY ++P+ GK++  E VLP   + +  +++    D+ VMT Y   
Sbjct  257  LHDWSDEHCLKLLKNCYKSIPEDGKVIVVESVLPELPETSTHSKINSLADVLVMTQYPG-  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  316  GKERTKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>gb|AAQ24337.1| O-methyltransferase [Zea mays]
 gb|AAQ24349.1| O-methyltransferase [Zea mays]
 gb|AAQ24352.1| O-methyltransferase [Zea mays]
 gb|AAQ24367.1| O-methyltransferase [Zea mays]
 gb|AAQ24369.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGF25396.1| caffeic acid 3-O-methyltransferase [Zea nicaraguensis]
Length=364

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|Q06509.1|COMT1_MAIZE RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Zea mays]
 gb|AAB03364.1| O-methyltransferase [Zea mays]
 gb|AAQ24346.1| O-methyltransferase [Zea mays]
 gb|AAQ24347.1| O-methyltransferase [Zea mays]
 gb|AGS49180.1| O-methyltransferase [Zea mays]
 gb|AGS49218.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AAQ24338.1| O-methyltransferase [Zea mays]
 gb|AAQ24360.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49185.1| O-methyltransferase [Zea mays]
Length=364

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_009395003.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI   HP I  GIN+DLP V+  AP +PG+ HV GDMF+S+P GDAI MKW+
Sbjct  254  GGIGATLHMITSTHPHI-HGINYDLPHVISDAPPLPGVDHVSGDMFESVPGGDAILMKWI  312

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +I+++C+ ALP+ GK++A E VLP+  + + RT+ +   D+ +M  +   
Sbjct  313  LHDWSDESCAKILNNCWKALPENGKVIAVECVLPVVPEPSLRTQSVCHVDL-IMLAHNPG  371

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE E+++L++  GFS F+  YV      LEF K
Sbjct  372  GKERTEMEFQELAKQAGFSGFKPTYVYANTWALEFTK  408



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI  K+P+I +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  214  GGTGATLHMIRSKYPTI-KGINFDLPHVIEDAPTYPGVEHVGGDMFVSVPKGDAIFMKWI  272

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E  LP+  D +  ++ ++  D+ +M  +   
Sbjct  273  CHDWSDEHCAKFLKNCYDALPNNGKVIVAECNLPVAPDTSLASKNVIHIDV-IMLAHNPG  331

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT+EE+  L++  GF  FR     F   V+EF K
Sbjct  332  GKERTKEEFEALAKGAGFEGFRVMCSAFNTYVMEFLK  368



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V+  AP+ PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGAVVNMIVSKYPTI-KGINFDLPHVIGDAPSYPGVEHVGGDMFVSVPEADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F   V+EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVLCCAFNTYVMEFLK  363



>gb|ADR31598.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=220

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  65   GGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVXHVGGDMFVSVPKADAVFMKWI  123

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  124  CHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPG  182

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  183  GKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  219



>ref|XP_009608171.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana tomentosiformis]
Length=363

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHPSI +GINFDLP V+  AP  PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGATVNMIVSKHPSI-KGINFDLPHVIGDAPAYPGVEHVGGDMFASVPKADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP   D +  T+  +  DI VM  +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPANGKVIIAECILPEAPDTSLATKNTVHVDI-VMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF+ FR     +   V+EF K
Sbjct  327  GKERTEKEFEALAKGAGFTGFRKACCAYNTWVMEFNK  363



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  209  GGTGAVINMIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   V+EF K
Sbjct  327  GKERTEKEFEALAKGAGFQGFQVLCCAFNSYVMEFLK  363



>gb|ADR31604.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=216

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  61   GGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWI  119

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  120  CHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPG  178

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  179  GKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  215



>gb|AGS49199.1| O-methyltransferase [Zea mays]
Length=364

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_006478222.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=352

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 103/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G+  + I  K+P I +GINFDLP V+Q AP  PG+ HVGGDMF+++P GDAIFMKW+
Sbjct  198  GCLGNTLKAITSKYPQI-KGINFDLPHVIQHAPKYPGVEHVGGDMFQNVPKGDAIFMKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +CY ++P+ GK++  E +LP   + +  +++  +GD+ +MT     
Sbjct  257  LHDWSDEHCLKLLKNCYKSIPEDGKVIVVEAILPELPETSTHSKINSQGDVLMMT-QNPG  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  316  GKERTKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>gb|AIY22649.1| caffeic acid 3-O-methyl transferase, partial [Saccharum arundinaceum]
 gb|AIY22650.1| caffeic acid 3-O-methyl transferase, partial [Miscanthus sp. 
LK-2014]
Length=224

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 94/157 (60%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I   HP I +GINFDLP V+ +AP  PG+ HVGGDMFKS+P GDAI MKW+
Sbjct  70   GGIGATLHAITSHHPQI-KGINFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWI  128

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+   + + +   D+ +M  +   
Sbjct  129  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAVPKAQGVFHVDM-IMLAHNPG  187

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ R E E+  L++  GFS F+A Y+      +EF K
Sbjct  188  GRERYEREFHDLAKGAGFSGFKATYIYANAWAIEFIK  224



>gb|ADR31595.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31596.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31601.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31605.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31606.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31608.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=220

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  65   GGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWI  123

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  124  CHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPG  182

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  183  GKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  219



>ref|XP_006441603.1| hypothetical protein CICLE_v10020875mg [Citrus clementina]
 gb|ESR54843.1| hypothetical protein CICLE_v10020875mg [Citrus clementina]
Length=352

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 103/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G+  + I  K+P I +GINFDLP V+Q AP  PG+ HVGGDMF+++P GDAIFMKW+
Sbjct  198  GCLGNTLKAITSKYPHI-KGINFDLPHVIQHAPKYPGVEHVGGDMFQNVPKGDAIFMKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +CY ++P+ GK++  E +LP   + +  +++  +GD+ +MT     
Sbjct  257  LHDWSDEHCLKLLKNCYKSIPEDGKVIVVEAILPELPETSTHSKINSQGDVLMMT-QNPG  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  316  GKERTKHEFTTLATEAGFSGIR--FVCFFYNYWVIEFYK  352



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PS+ +GINFDLP V+Q AP+ PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGAVINMIVSKYPSL-KGINFDLPHVIQDAPSYPGVEHVGGDMFVSVPKADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYNALPANGKVIVAECILPVAPDTSLATKSVIHIDC-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E+E+  L++  GF  F+     F   V+EF K
Sbjct  327  GKERNEKEFEALAKGAGFQGFQVLCSAFNTYVMEFLK  363



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGAVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   V+EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFQVLCCAFNTYVMEFLK  363



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  209  GGTGAVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPNNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F      F   ++EF K
Sbjct  327  GKERTEKEFEALAKGAGFQGFHVLCCAFNTYIMEFLK  363



>ref|XP_010696333.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G   + I+ ++PSI +G NFDLP +++K P  PGI HV GDMF SIP GDAIFMKW+
Sbjct  67   GGNGSILKAIISRYPSI-EGTNFDLPPIIEKQPIYPGIQHVAGDMFTSIPAGDAIFMKWV  125

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L    DE+C  ++ +CY ALP GGKL+  E V+P   D +  ++ + + D++ +T   A 
Sbjct  126  LKNLNDEQCLNVLKNCYMALPNGGKLMIVELVIPDIPDSSINSQSVFQFDVY-LTNMNAG  184

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT  E++ L+++ GFS  +A    +  T+LEF K
Sbjct  185  GKERTVVEFQTLAKTAGFSGIQAMVRAYNMTLLEFHK  221



>ref|XP_010662844.1| PREDICTED: caffeic acid O-methyltransferase isoform X1 [Vitis 
vinifera]
Length=372

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V+  AP+ PG+ HVGGDMF S+P GDAIFMKWM
Sbjct  216  GGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVEHVGGDMFVSVPKGDAIFMKWM  274

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP  GK++  E +LP+  D +  T+  +  D+ +M  Y   
Sbjct  275  CYEWDDAHCLKFLENCYQALPDNGKVIVAECILPVVPDTSLATKTAVHIDV-IMLAYNTG  333

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  334  GKARTEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  370



>gb|AGS49181.1| O-methyltransferase [Zea mays]
Length=364

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDLHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|EPS67212.1| hypothetical protein M569_07558 [Genlisea aurea]
Length=364

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 98/149 (66%), Gaps = 2/149 (1%)
 Frame = -2

Query  641  MIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEE  462
            MI+ K+P I +GINFDLP V++ AP  PG+ HVGGDMFKS+P GDAIFMKW+   W DE+
Sbjct  218  MIVSKYPHI-RGINFDLPHVIEDAPPYPGVEHVGGDMFKSVPRGDAIFMKWIFHDWSDED  276

Query  461  CKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEE  282
            CK+I+  CY ALP  GK++  E +LP   D++  T+ ++  DI +M  +   GK RTEEE
Sbjct  277  CKKILKHCYEALPGNGKVILVECILPNAPDNSSATQNVVHVDI-IMLGHNIGGKERTEEE  335

Query  281  YRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            +R L  + GF++F+         V+E  K
Sbjct  336  FRALGLASGFNNFKKASYAHNSCVMELTK  364



>ref|XP_006478347.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=352

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G+  + I  K+P I +GINFDLP V+Q AP  PG+ HVGGDMF+++P GDAIFMKW+
Sbjct  198  GCLGNTLKAITSKYPHI-KGINFDLPHVIQHAPKYPGVEHVGGDMFQNVPKGDAIFMKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +CY ++P+ GK++  E +LP   D +  +++  +GD+ +MT     
Sbjct  257  LHDWSDEHCLKLLKNCYKSIPEDGKVIVVEAILPELPDTSTHSKINSQGDVLMMT-QNPG  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT+ E   L+   GFS  R   + + Y V+EF K
Sbjct  316  GKERTKHELTTLATEAGFSGIRFVCLFYNYWVMEFYK  352



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PS+ +GINFDLP V+Q AP+ PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGAVINMIVSKYPSL-KGINFDLPHVIQDAPSYPGVEHVGGDMFVSVPKADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYSALPANGKVIVAECILPVAPDASLATKSVIHIDC-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E+E+  L++  GF  F+     F   V+EF K
Sbjct  327  GKERNEKEFEALAKGAGFQGFQVLCSAFNTYVMEFLK  363



>gb|ABI54120.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+  GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVSKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|AAQ24339.1| O-methyltransferase [Zea mays]
Length=364

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK +  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKAIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>dbj|BAK42963.1| caffeic acid O-methylltransferase [Chrysanthemum x morifolium]
Length=355

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHPSI +GINFDLP V+Q A   PGI HVGGDMF+S+P GDAIFMKW+
Sbjct  201  GGTGASLNMIVSKHPSI-KGINFDLPHVIQDATTYPGIEHVGGDMFESVPKGDAIFMKWI  259

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP  GK++  E +LP   D +  T+ ++  D+ +M  +   
Sbjct  260  CHDWSDAHCLKFLKNCYKALPDNGKVIVAECILPETPDTSPATQNVVHIDV-IMLAHNPG  318

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF+ FR         V+EF K
Sbjct  319  GKERTEKEFEALAKGAGFTGFRKACCALNTWVMEFTK  355



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +C+ ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCHAALPDNGKVIVAECILPVAPDTSLATKGVVHIDA-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  327  GKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|AGS49196.1| O-methyltransferase [Zea mays]
Length=364

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASAPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYVNAWAIEFIK  364



>gb|AGS49210.1| O-methyltransferase [Zea mays]
Length=364

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+  M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-TMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49211.1| O-methyltransferase [Zea mays]
Length=364

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y       +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYTYANAWAIEFIK  364



>ref|XP_003559686.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Brachypodium 
distachyon]
Length=364

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G   R I+ K+P I+ G+NFDLP V+  AP  PG+ H+GGDMFK +P+GDAI MKW+
Sbjct  210  GGVGATIRAIISKYPHIS-GVNFDLPHVISSAPTCPGVQHIGGDMFKKVPSGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D+ C  ++ +CY ALP GGKL+  E +LP+  + T R R+  E D+ ++T Y   
Sbjct  269  LHDWTDDHCMMLLRNCYDALPVGGKLIIIESILPVNPEATPRARMAFEDDMIMLT-YTPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R + E+  L++   F+S R  Y+      +E+ K
Sbjct  328  GKERYKREFEVLAKGARFASVRTTYIYANSWAIEYTK  364



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+P+I +GINFDLP V++ AP+  G+ HVGGDMF SIP  DA+FMKW+
Sbjct  209  GGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYQGVEHVGGDMFASIPKADAVFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++S GF  F+ F   F   ++EF K
Sbjct  327  GKERTEKEFEALAKSAGFQGFKVFCSAFNTYIMEFLK  363



>gb|AAQ24348.1| O-methyltransferase [Zea mays]
 gb|AAQ24350.1| O-methyltransferase [Zea mays]
 gb|AAQ24356.1| O-methyltransferase [Zea mays]
 gb|AAQ24363.1| O-methyltransferase [Zea mays]
 gb|AAQ24365.1| O-methyltransferase [Zea mays]
 gb|AAQ24366.1| O-methyltransferase [Zea mays]
 gb|AAQ24368.1| O-methyltransferase [Zea mays]
 gb|AAQ24370.1| O-methyltransferase [Zea mays]
Length=358

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GK R E E+R+L++  GFS F+A Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>dbj|BAG71895.1| 5-hydroxyconiferaldehyde O-methyltransferase [Carthamus tinctorius]
Length=356

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 93/142 (65%), Gaps = 2/142 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHPSI +GINFDLP V+Q A N PGI HVGGDMF+S+P GDAIFMKW+
Sbjct  202  GGTGASLSMILSKHPSI-KGINFDLPHVIQDATNYPGIEHVGGDMFESVPKGDAIFMKWI  260

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP   D +  T+ ++  D+ +M  +   
Sbjct  261  CHDWSDAHCLKFLKNCYKALPENGKVIVAECILPETPDSSLATKNVVHIDV-IMLAHNPG  319

Query  305  GKHRTEEEYRQLSRSVGFSSFR  240
            GK RTE+E++ L+++ GF  F 
Sbjct  320  GKERTEKEFQALAKAAGFKGFH  341



>gb|AAQ24342.1| O-methyltransferase [Zea mays]
Length=359

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GK R E E+R+L++  GFS F+A Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24344.1| O-methyltransferase [Zea mays]
 gb|AAQ24358.1| O-methyltransferase [Zea mays]
 gb|AAQ24362.1| O-methyltransferase [Zea mays]
Length=359

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GK R E E+R+L++  GFS F+A Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24361.1| O-methyltransferase [Zea mays]
Length=359

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GK R E E+R+L++  GFS F+A Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>ref|XP_006478241.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=432

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+  + I+ K+P I +GINFDLP V+Q AP  PG+ HVGGDMF+S+PNGDAI +KW+
Sbjct  278  GSLGNTLKAIISKYPHI-KGINFDLPHVIQHAPEYPGVKHVGGDMFQSVPNGDAILIKWI  336

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +C+ ++ +GGKL+  E VLP   + +  +++   GD+ VMT Y   
Sbjct  337  LHDWSDEHCLKLLKNCHKSIHEGGKLIVVESVLPELPETSTHSKINFLGDVLVMTQYPG-  395

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +  FF+   V+EF K
Sbjct  396  GKERTKHEFMTLATGAGFSGVR--FDCFFFNLWVMEFHK  432



>gb|AAQ24351.1| O-methyltransferase [Zea mays]
 gb|AAQ24357.1| O-methyltransferase [Zea mays]
 gb|AAQ24359.1| O-methyltransferase [Zea mays]
Length=358

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GK R E E+R+L++  GFS F+A Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24343.1| O-methyltransferase [Zea mays]
 gb|AAQ24353.1| O-methyltransferase [Zea mays]
 gb|AAQ24364.1| O-methyltransferase [Zea mays]
Length=359

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GK R E E+R+L++  GFS F+A Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24345.1| O-methyltransferase [Zea mays]
 gb|AAQ24354.1| O-methyltransferase [Zea mays]
Length=358

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GK R E E+R+L++  GFS F+A Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>ref|XP_006478226.1| PREDICTED: anthranilate N-methyltransferase-like [Citrus sinensis]
Length=393

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+  + I  K+P I +GINFDLP V+Q +P  PG+ HVGGDMF+S+PNGDAI +KW+
Sbjct  239  GSLGNTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVKHVGGDMFQSVPNGDAILIKWI  297

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +C+ ++P+GGK++  E VLP   ++   +++    D+ VMT Y   
Sbjct  298  LHDWSDEHCLKLLKNCHKSIPEGGKVIVVESVLPELPENGTHSKINSLADVLVMTQYPG-  356

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +V FF+   V+EF K
Sbjct  357  GKERTKHEFTTLATEAGFSGIR--FVCFFHNLWVMEFYK  393



>ref|XP_010048429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Eucalyptus grandis]
Length=366

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  210  GGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   
Sbjct  269  CHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF  F+     F   V+EF K
Sbjct  328  GKERTQKEFEALAKGAGFQGFQVMCCAFGTHVMEFLK  364



>gb|ADB82906.1| caffeic O-methyltransferase1 [Eucalyptus camaldulensis]
Length=366

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  210  GGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   
Sbjct  269  CHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF  F+     F   V+EF K
Sbjct  328  GKERTQKEFEALAKGAGFQGFQVMCCAFGTHVMEFLK  364



>gb|ACY66932.1| caffeic O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=366

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  210  GGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   
Sbjct  269  CHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF  F+     F   V+EF K
Sbjct  328  GKERTQKEFETLAKGAGFQGFQVMCCAFGTHVMEFLK  364



>gb|AEW26161.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26162.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26169.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26170.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26174.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26179.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26180.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26183.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26184.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26185.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26188.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26189.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26190.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26192.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26193.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26194.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26195.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26196.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26197.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26198.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26199.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26202.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26203.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26204.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26207.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26208.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26214.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26217.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26219.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26220.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26227.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26228.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26229.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26230.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26239.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26241.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26242.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26245.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26246.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
Length=224

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF SIP  DA+FMKW+
Sbjct  68   GGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWI  126

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  127  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  185

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF  F+     F   ++EF K
Sbjct  186  GKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|AGS49183.1| O-methyltransferase [Zea mays]
Length=364

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +    + +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFH-VVMIMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYADAWAIEFIK  364



>ref|XP_004307899.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVVNMIVAKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCIKFLKNCYAALPDDGKVILGECILPVAPDTSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF   R     F   V+EF K
Sbjct  327  GKERTEQEFEALAKGSGFQGIRVCCDAFNTYVIEFLK  363



>gb|AAD48913.1|AF139533_1 caffeate O-methyltransferase [Liquidambar styraciflua]
Length=367

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P I +GINFDLP V+++AP+ PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  211  GGTGAHLNMIIAKYPMI-KGINFDLPHVIEEAPSYPGVEHVGGDMFVSVPKGDAIFMKWI  269

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + +  CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  270  CHDWSDEHCLKFLKKCYEALPTNGKVILAECILPVAPDASLPTKAVVHIDV-IMLAHNPG  328

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     +   ++EF K
Sbjct  329  GKERTEKEFEALAKGAGFEGFRVALCAYNTWIIEFLK  365



>ref|NP_001268100.1| caffeic acid O-methyltransferase [Vitis vinifera]
 gb|AAF44672.1|AF239740_1 caffeic acid O-methyltransferase [Vitis vinifera]
Length=386

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V+  AP+ PG+ HVGGDMF S+P GDAIFMKWM
Sbjct  230  GGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVEHVGGDMFVSVPKGDAIFMKWM  288

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP  GK++  E +LP+  D +  T+  +  D+ +M  Y   
Sbjct  289  CYEWDDAHCLKFLENCYQALPDNGKVIVAECILPVVPDTSLATKSAVHIDV-IMLAYNTG  347

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  348  GKARTEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  384



>gb|AGS49184.1| O-methyltransferase [Zea mays]
Length=364

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP ++ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHVS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E  LP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECALPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+PN DA+FMKW+
Sbjct  209  GGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPNADAVFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+   GF  F      F   V+EF+K
Sbjct  327  GKERTEKEFEGLANGAGFQGFEVMCCAFNTHVIEFRK  363



>ref|XP_009361271.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=365

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+  AP   G+ HVGGDMF S+P GDAIFMK +
Sbjct  209  GGTGAAVNMIVSKYPSI-KGINFDLPHVIDDAPQFLGVEHVGGDMFASVPKGDAIFMKSI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C +I+ +CY ALP  GK++  E +LP+  D +  T++++  D+ +M  Y   
Sbjct  268  CHDWSDDHCLKILKNCYTALPDNGKVILAEGILPVAPDSSLATKVVVNLDV-IMLGYNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  327  GKERTEKEFEALAKGSGFKGFRVICSAFHIYAIEFLK  363



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P G+AIFMKW+
Sbjct  209  GGTGAVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGNAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCIKFLKNCYAALPDDGKVILAECILPVAPDTSLATKGVVHMDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF   R     F   V+EF K
Sbjct  327  GKERTEQEFEALAKGSGFQGIRVCCDAFNTYVIEFLK  363



>gb|AEW26209.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
Length=224

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF SIP  DA+FMKW+
Sbjct  68   GGTGAXINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWI  126

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  127  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  185

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF  F+     F   ++EF K
Sbjct  186  GKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>sp|O23760.1|COMT1_CLABR RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase; Flags: Precursor [Clarkia breweri]
 gb|AAB71141.1| caffeic acid O-methyltransferase [Clarkia breweri]
Length=370

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  214  GGTGAVLSMIVAKYPSI-KGINFDLPHVIEDAPIYPGVEHVGGDMFVSVPKGDAIFMKWI  272

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  273  CHDWSDEHCLKFLKNCYAALPEHGKVIVAECILPLSPDPSLATKGVIHIDA-IMLAHNPG  331

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+   GF  F+     F   V+EF K
Sbjct  332  GKERTEKEFEALAIGAGFKGFKVACCAFNTYVMEFLK  368



>ref|XP_010035325.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW46638.1| hypothetical protein EUGRSUZ_K00449 [Eucalyptus grandis]
Length=365

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+  AP+ PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  211  GGTGAVLNMIVSKYPSI-KGINFDLPHVIANAPSYPGVEHVGGDMFVSVPTGDAIFMKWI  269

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP+ GK++  + +LP   D +  T++    D+ +M  +   
Sbjct  270  CHDWSDEHCLKFLKNCYNALPEHGKVIVADCILPELPDTSFATKVAFHADLIMMA-HNPG  328

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+++ GF  F    V F + V+EF K
Sbjct  329  GKERTEKEFEALAKAAGFKRFHIACVAFDH-VMEFLK  364



>gb|KDO41090.1| hypothetical protein CISIN_1g018681mg [Citrus sinensis]
Length=352

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G+ G+  + I+ K+P I +GINFDLP V+Q AP  PG+ HVGGDMF+++PNGDAI +KW+
Sbjct  198  GSLGNTLKAIISKYPHI-EGINFDLPHVIQHAPEYPGVKHVGGDMFRNVPNGDAILIKWI  256

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W DE C +++ +C+ ++ +GGK++  E VLP   + +  +++   GD+ VMT Y   
Sbjct  257  LHDWSDEHCLKLLKNCHKSIHEGGKVIVVESVLPELPETSTHSKINFLGDVLVMTQYPG-  315

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  195
            GK RT+ E+  L+   GFS  R  +  FF+   V+EF K
Sbjct  316  GKERTKHEFMTLATGAGFSGVR--FDCFFFNLWVMEFHK  352



>ref|XP_009757562.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=363

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+  AP  PG+ HVGGDMF S+P  DAIFMKW+
Sbjct  209  GGTGATVNMIVSKYPSI-KGINFDLPHVIGDAPTYPGVEHVGGDMFASVPKADAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP   D +  T+  +  DI VM  +   
Sbjct  268  CHDWSDEHCLKFLKNCYEALPANGKVIIAECILPEAPDTSLATKNTVHVDI-VMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF+ FR     +   V+EF K
Sbjct  327  GKERTEKEFEALAKGAGFTGFRKACCAYNTWVMEFNK  363



>gb|AAQ24355.1| O-methyltransferase [Zea mays]
Length=358

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 2/146 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK +  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKAIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYV  228
            GK R E E+R+L++  GFS F+A Y+
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYI  353



>gb|ADX98508.1| caffeic acid 3-O-methyltransferase [Panicum virgatum]
Length=361

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  ++P I +G+NFDLP V+ +AP  PG+ HVGGDMFK++P GDAI MKW+
Sbjct  207  GGVGATLHAITSRYPGI-RGVNFDLPHVISEAPPFPGVEHVGGDMFKAVPAGDAILMKWI  265

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  I+ +CY ALP GGK++A E +LP+  + T + + +   D+ +M  +   
Sbjct  266  LHDWSDAHCAAILKNCYDALPAGGKVIAVECILPVNPEATPKAQGVFHVDM-IMLAHNPG  324

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+ +L++  GF+ F+A Y+      +EF K
Sbjct  325  GKERYEREFEELAKGAGFTGFKATYIYANAWAIEFTK  361



>gb|KDP36008.1| hypothetical protein JCGZ_10407 [Jatropha curcas]
Length=365

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PS+ +GINFDLP V++ AP+ PG+ HVGGDMF + P GDAIFMKW+
Sbjct  209  GGIGAVLNMIVTKYPSM-KGINFDLPHVIEDAPSFPGVEHVGGDMFVTAPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C +++ +CY A+P  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  268  CHDWSDEYCLKLLKNCYNAIPANGKVIVAEYILPVAPDTSLATKAVIHMDC-LMLAHLPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTEEE+  L++  GF  F+     F   V+EF K
Sbjct  327  GKERTEEEFETLAKGAGFQGFQVICSAFNTYVMEFLK  363



>ref|XP_009361274.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=367

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAI MK +
Sbjct  209  GGIGSVSHMIVSKYPSI-KGINFDLPHVIKDAPQYPGVEHVGGDMFVSVPKGDAIVMKHI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C +++ +CY ALP  GK++  E ++P+  D +  T+L    D+ +M      
Sbjct  268  CHDWSDEHCLKLLKNCYAALPDNGKVILVEIIIPVSPDSSLATKLANHVDV-IMLANNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F   V+EF K
Sbjct  327  GKERTEDEFEALAKGSGFQGFRVMSSAFDGNVIEFLK  363



>gb|AEW26163.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
Length=224

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF SIP  DA+FMKW+
Sbjct  68   GGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWI  126

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  127  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPG  185

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L +  GF  F+     F   ++EF K
Sbjct  186  GKERTQKEFEDLXKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|AGS49219.1| O-methyltransferase [Zea mays]
Length=364

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R   E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERHGREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49188.1| O-methyltransferase [Zea mays]
Length=364

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W    C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSGAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010527383.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=364

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ KHP+I +GINFDLP V+  AP+ PGI HVGGDMF S+P GDAIF+K +
Sbjct  209  GGTGATLNMIVSKHPNI-KGINFDLPHVIDGAPSYPGIEHVGGDMFASVPTGDAIFLKGI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE+C +++ +CY +LP  GK++  E +LP+  + +   RL+++ D +++ +    
Sbjct  268  THDWNDEQCVKLLKNCYESLPDSGKVILAEWILPVVPNPSASNRLVVDIDCYMLAL--DP  325

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+R L+   GF  F+     F + ++EF K
Sbjct  326  GKERTEDEFRALAEGAGFQGFQVVCKAFTHHIIEFLK  362



>gb|AGS49200.1| O-methyltransferase [Zea mays]
Length=364

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSRHPHIS-GVNFDLPHVIFEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEF  201
            GK R E E+R+L++  GFS F+A Y+      +EF
Sbjct  328  GKERYEREFRELAKGAGFSGFKATYIYANAWAIEF  362



>gb|AGS49197.1| O-methyltransferase [Zea mays]
Length=364

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I   HP I+ G+NF+LP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+
Sbjct  210  GGVGATLHAITSHHPHIS-GVNFNLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   
Sbjct  269  LHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  328  GKERYEREFRKLAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|P59049.1|OMT1_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 1; AltName: Full=Flavonol 
3-O-methyltransferase 1 [Chrysosplenium americanum]
Length=343

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I + INFDLP V++ AP  PGI HVGGDMF S+P GDAIFMKW+
Sbjct  185  GGTGATLTMILSKYPTI-RCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWI  243

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C +++ +CY ALP  GK++  E +LP   D +  T+ ++  D+  +  +   
Sbjct  244  CHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVA-HNPG  302

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  303  GKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK  339



>sp|Q42653.1|OMT2_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 2; AltName: Full=Flavonol 
3-O-methyltransferase 2 [Chrysosplenium americanum]
 gb|AAA86982.1| caffeic acid O-methyl transferase [Chrysosplenium americanum]
Length=343

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I + INFDLP V++ AP  PGI HVGGDMF S+P GDAIFMKW+
Sbjct  185  GGTGATLTMILSKYPTI-RCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWI  243

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C +++ +CY ALP  GK++  E +LP   D +  T+ ++  D+  +  +   
Sbjct  244  CHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVA-HNPG  302

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  303  GKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK  339



>ref|XP_010034911.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW46118.1| hypothetical protein EUGRSUZ_K00041 [Eucalyptus grandis]
Length=365

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V+  AP+ PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  211  GGTGAVLNMIVSKYPSI-KGINFDLPHVIANAPSYPGVEHVGGDMFVSVPTGDAIFMKWI  269

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP+ GK++  + +LP   D +  T++    D+ +M  +   
Sbjct  270  CHDWSDEHCLKFLKNCYNALPEHGKVIVADCILPELPDTSFATKVAFHADLIMMA-HNPG  328

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L+++ GF  F    V F + V+EF K
Sbjct  329  GKERTEKEFGALAKAAGFKRFHIACVAFDH-VMEFLK  364



>ref|XP_009361272.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=365

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMK++
Sbjct  209  GGIGAVINMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKFI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C +I+ +CY ALP  GK++  E +LP+    +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDDHCLKILKNCYTALPDNGKVILAECILPVAPASSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  FR     F   V+EF K
Sbjct  327  GKERTEKEFEALAKGSGFKGFRVICSAFNTYVIEFLK  363



>ref|XP_002518944.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF43477.1| o-methyltransferase, putative [Ricinus communis]
Length=273

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GIN+DLP++++K+P+ PGI HV GDMF SIP G+AIFMKW+
Sbjct  117  GGDGSILNMILSKYPSI-KGINYDLPQIIEKSPSYPGIEHVAGDMFMSIPKGEAIFMKWI  175

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D +C +++ +CY  LP  GK++A + V+P     +   R LL+  ++ MT    K
Sbjct  176  LHGWDDLDCLKLLKNCYETLPSNGKVIAVDLVVPAAPGTSAAARSLLQSYLY-MTSMNPK  234

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ RTE +++ L++  GFS  +     + ++V+EF K
Sbjct  235  GQERTEMQFQSLAKQAGFSHVQVACYAYTFSVVEFHK  271



>sp|P46484.1|COMT1_EUCGU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Eucalyptus gunnii]
 emb|CAA52814.1| 0-Methyltransferase [Eucalyptus gunnii]
Length=366

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  210  GGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   
Sbjct  269  CHDWSDDHCAKFLKNCYDALPNIGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF  F+     F   V+EF K
Sbjct  328  GKERTQKEFETLAKGAGFQGFQVMCCAFGTHVMEFLK  364



>ref|XP_010478733.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=352

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 1/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ KHP I + INFDLP V+  +    GI +V GDMF SIP G+AIFMKWM
Sbjct  195  GGDGSILSRIISKHPHIIKAINFDLPSVINTSSASSGIEYVSGDMFTSIPKGEAIFMKWM  254

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L +W DE C +I+S+CY +LP  GK++  + V+P    DT   R L + ++F+M +    
Sbjct  255  LHSWDDEHCVKILSNCYQSLPSNGKVIVVDMVIPDLPGDTLLDRSLFQFELFMMNM-NPS  313

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L+R  GFSS +  +    ++V+EF K
Sbjct  314  GKERTKKEFETLARLAGFSSVQVPFTSLCFSVVEFHK  350



>ref|XP_010537046.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=366

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +GINFDLP V++ AP+ PGI HVGGDMF S+P GDAIFMKW+
Sbjct  210  GGIGATLSMIVSKYPAI-KGINFDLPHVIEDAPSYPGIEHVGGDMFVSVPKGDAIFMKWI  268

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   
Sbjct  269  CHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDPSLLTKQVVHIDC-IMLAHNPG  327

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  328  GKERTEKEFEALAKGSGFHGFQVVCNAFGTYIMEFLK  364



>dbj|BAD14923.1| caffeic acid o-methyl transferase [Oryza sativa Japonica Group]
Length=268

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 95/146 (65%), Gaps = 3/146 (2%)
 Frame = -2

Query  629  KHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIP-NGDAIFMKWMLTTWMDEECKE  453
            +HP I +GIN+DLP V+ +AP  PG+ HVGGDMF S+P  GDAI MKW+L  W DE C  
Sbjct  125  RHPHI-RGINYDLPHVISEAPPFPGVEHVGGDMFASVPRGGDAILMKWILHDWSDEHCAR  183

Query  452  IMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQ  273
            ++ +CY ALP+ GK+V  E VLP  +D T R + +   D+ +M  +   GK R E E+R+
Sbjct  184  LLKNCYDALPEHGKVVVVECVLPESSDATAREQGVFHVDM-IMLAHNPGGKERYEREFRE  242

Query  272  LSRSVGFSSFRAFYVDFFYTVLEFQK  195
            L+R+ GF+ F+A Y+      +EF K
Sbjct  243  LARAAGFTGFKATYIYANAWAIEFTK  268



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  209  GGTGAVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT +E+  L++  GF   R     F   V+EF K
Sbjct  327  GKERTGQEFEALAKGSGFQGIRVACNAFNTYVIEFLK  363



>ref|XP_004972800.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=360

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I   HP I +G+NFDLP V+ +AP  PG+ HVGGDMFKS+P GDAI MKW+
Sbjct  206  GGIGATLHAITSCHPQI-KGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWI  264

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
            L  W D  C  I+ +CY ALP  GK++  E VLP+  + T + + +   D+ +M  +   
Sbjct  265  LHDWSDAHCATILKNCYDALPANGKVIIVECVLPVNPEATPKAQGVFHVDM-IMLAHNPG  323

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK R E E+R+L++  GF+ F+A Y+      +EF K
Sbjct  324  GKERYEREFRELAKGAGFTGFKATYIYANAWAIEFTK  360



>gb|AFK34973.1| unknown [Lotus japonicus]
Length=186

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+P+I +G+NFDLP V+++AP+ PG+ H+GGDMF S+P  DAIFMKW+
Sbjct  30   GGTGAVINMIVSKYPTI-KGVNFDLPHVIKEAPSYPGVEHIGGDMFVSVPKADAIFMKWI  88

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE+C +++ +CY +LP  GK++  E  +P   D    +R + E D+ +M  + + 
Sbjct  89   CHDWNDEQCLKLLKNCYESLPDTGKVILTECNIPQVPDFKLASRCVFEMDV-IMLCHSSG  147

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            G+ RT +EY  L++  GF  FR     F   V+EF K
Sbjct  148  GRERTAKEYEALAKGAGFQGFRVACCAFNMYVMEFLK  184



>gb|KCW89068.1| hypothetical protein EUGRSUZ_A01397 [Eucalyptus grandis]
Length=429

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  273  GGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWI  331

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   
Sbjct  332  CHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPG  390

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RT++E+  L++  GF  F+     F   V+EF K
Sbjct  391  GKERTQKEFEALAKGAGFQGFQVMCCAFGTHVMEFLK  427



>ref|XP_008357058.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=367

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 94/157 (60%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAI MK +
Sbjct  209  GGIGSVIHMIVSKYPSI-KGINFDLPHVIKDAPQYPGVEHVGGDMFVSVPKGDAIVMKHI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C +++ +C+ ALP  GK++  E ++P+  D +  T+L    D+  M      
Sbjct  268  CHDWSDEHCLKLLKNCHAALPDNGKVILVEIIIPVSPDSSLATKLANHIDVL-MLANNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTEEE+  L++  GF  FR     F   V+EF K
Sbjct  327  GKERTEEEFEALAKESGFQGFRVMCSAFHSNVIEFLK  363



>dbj|BAO79382.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 94/157 (60%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G    MI  K+PSI +GINFDLP VV+ AP  PG+ HVGGDMF S+P GDAIFMKW+
Sbjct  211  GGTGATLHMITSKYPSI-KGINFDLPHVVEDAPAYPGVEHVGGDMFVSVPEGDAIFMKWI  269

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W DE C   + +CY ALPQ GK++  E +LP   D    T+ ++  D+ +M  +   
Sbjct  270  CHDWSDEHCLSFLKNCYKALPQNGKVILAECILPEAPDSKLTTKNVIHIDV-IMLAHNPG  328

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L +  GF SF      +   V+E+ K
Sbjct  329  GKERTEKEFEALGKEAGFKSFNKACCAYNTWVIEYLK  365



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -2

Query  665  GAPGDCXRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  486
            G  G     I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+
Sbjct  209  GGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSFPGVEHVGGDMFVSVPKADAVFMKWI  267

Query  485  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  306
               W D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   
Sbjct  268  CHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPG  326

Query  305  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  195
            GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  327  GKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  363



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520