BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001M17

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAB41026.1|  NADP-malic enzyme                                       323   2e-106   Flaveria linearis
ref|XP_009591013.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    332   9e-106   Nicotiana tomentosiformis
emb|CBI36068.3|  unnamed protein product                                331   1e-105   Vitis vinifera
ref|NP_001268030.1|  malate dehydrogenase                               331   1e-105   Vitis vinifera
gb|AAB19243.1|  NADP-malic enzyme                                       315   2e-105   Flaveria trinervia
emb|CAN69517.1|  hypothetical protein VITISV_024155                     331   2e-105   Vitis vinifera
gb|AAL11455.1|  NADP-dependent malic enzyme                             319   1e-104   Flaveria brownii
ref|XP_006359476.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    328   2e-104   Solanum tuberosum [potatoes]
gb|ABK94110.1|  unknown                                                 313   5e-104   Populus trichocarpa [western balsam poplar]
ref|NP_001234458.1|  NADP-dependent malic enzyme, chloroplastic         325   2e-103   
gb|KDO66547.1|  hypothetical protein CISIN_1g007703mg                   317   4e-103   Citrus sinensis [apfelsine]
gb|ABV72704.1|  non-C4 NADP-dependent malic enzyme                      323   7e-103   Flaveria trinervia
gb|ACF74358.1|  NADP-dependent malic protein                            309   8e-103   Arachis hypogaea [goober]
ref|XP_009626739.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    324   9e-103   Nicotiana tomentosiformis
ref|XP_004167694.1|  PREDICTED: NADP-dependent malic enzyme-like        310   1e-102   
sp|P36444.1|MAOC_FLAPR  RecName: Full=NADP-dependent malic enzyme...    323   1e-102   Flaveria pringlei
gb|ABS32241.1|  NADP-malic enzyme                                       321   2e-102   Flaveria palmeri
gb|EYU45830.1|  hypothetical protein MIMGU_mgv1a002611mg                323   2e-102   Erythranthe guttata [common monkey flower]
ref|NP_001268142.1|  NADP-dependent malic enzyme                        320   4e-102   Vitis vinifera
ref|XP_009772764.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    321   7e-102   Nicotiana sylvestris
gb|KDO66546.1|  hypothetical protein CISIN_1g007703mg                   317   8e-102   Citrus sinensis [apfelsine]
ref|XP_007204215.1|  hypothetical protein PRUPE_ppa003142mg             317   9e-102   
ref|XP_010665912.1|  PREDICTED: NADP-dependent malic enzyme             321   9e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006853670.1|  hypothetical protein AMTR_s00056p00119870          321   1e-101   
ref|XP_006343041.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    321   1e-101   Solanum tuberosum [potatoes]
gb|ABI98682.2|  chloroplast NADP-malic enzyme precursor                 320   2e-101   Nicotiana tabacum [American tobacco]
emb|CDO97978.1|  unnamed protein product                                320   2e-101   Coffea canephora [robusta coffee]
ref|XP_002516526.1|  malic enzyme, putative                             318   2e-101   
gb|KDO66535.1|  hypothetical protein CISIN_1g007703mg                   317   4e-101   Citrus sinensis [apfelsine]
emb|CBI28009.3|  unnamed protein product                                318   4e-101   Vitis vinifera
gb|KDP33810.1|  hypothetical protein JCGZ_07381                         318   5e-101   Jatropha curcas
ref|XP_011072428.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    319   5e-101   Sesamum indicum [beniseed]
gb|KDO66537.1|  hypothetical protein CISIN_1g007703mg                   317   6e-101   Citrus sinensis [apfelsine]
ref|XP_004235645.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    319   7e-101   Solanum lycopersicum
gb|KCW69675.1|  hypothetical protein EUGRSUZ_F03074                     314   7e-101   Eucalyptus grandis [rose gum]
gb|KDO66536.1|  hypothetical protein CISIN_1g007703mg                   317   7e-101   Citrus sinensis [apfelsine]
ref|XP_002514230.1|  malic enzyme, putative                             317   8e-101   Ricinus communis
ref|XP_006451273.1|  hypothetical protein CICLE_v10007810mg             317   8e-101   Citrus clementina [clementine]
gb|ABS32242.1|  NADP-malic enzyme                                       317   9e-101   Flaveria floridana
ref|XP_009380466.1|  PREDICTED: NADP-dependent malic enzyme             317   1e-100   
ref|XP_004173538.1|  PREDICTED: NADP-dependent malic enzyme-like        310   1e-100   
ref|XP_010915369.1|  PREDICTED: NADP-dependent malic enzyme isofo...    314   1e-100   
ref|XP_007204217.1|  hypothetical protein PRUPE_ppa003142mg             317   1e-100   
ref|XP_007204218.1|  hypothetical protein PRUPE_ppa003142mg             317   2e-100   
ref|XP_011080458.1|  PREDICTED: NADP-dependent malic enzyme-like        318   2e-100   Sesamum indicum [beniseed]
gb|ABS32243.1|  NADP-malic enzyme                                       317   3e-100   Flaveria trinervia
ref|XP_008791442.1|  PREDICTED: NADP-dependent malic enzyme-like        317   3e-100   Phoenix dactylifera
ref|XP_011016530.1|  PREDICTED: NADP-dependent malic enzyme-like        313   3e-100   Populus euphratica
ref|XP_008794109.1|  PREDICTED: NADP-dependent malic enzyme-like ...    315   4e-100   Phoenix dactylifera
gb|KCW53676.1|  hypothetical protein EUGRSUZ_J02940                     317   4e-100   Eucalyptus grandis [rose gum]
ref|XP_008794110.1|  PREDICTED: NADP-dependent malic enzyme-like ...    315   4e-100   Phoenix dactylifera
gb|AIR93779.1|  chloroplast NADP-malic enzyme                           317   5e-100   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_010098139.1|  NADP-dependent malic enzyme                        316   5e-100   
ref|XP_010033838.1|  PREDICTED: NADP-dependent malic enzyme             317   5e-100   Eucalyptus grandis [rose gum]
emb|CBI20568.3|  unnamed protein product                                315   6e-100   Vitis vinifera
gb|ABR25947.1|  NADP-dependent malic enzyme                             301   7e-100   Oryza sativa Indica Group [Indian rice]
gb|EPS64484.1|  malic enzyme                                            308   7e-100   Genlisea aurea
ref|XP_003631773.1|  PREDICTED: NADP-dependent malic enzyme isofo...    315   7e-100   Vitis vinifera
sp|P22178.1|MAOC_FLATR  RecName: Full=NADP-dependent malic enzyme...    316   8e-100   Flaveria trinervia
prf||1701292A  NADP dependent malic enzyme                              316   8e-100   Flaveria trinervia
ref|XP_002515967.1|  malic enzyme, putative                             316   8e-100   
gb|AAF73006.1|AF262997_1  NADP-dependent malic protein                  316   9e-100   Ricinus communis
ref|XP_008794107.1|  PREDICTED: NADP-dependent malic enzyme-like ...    315   9e-100   Phoenix dactylifera
gb|AAT02535.1|  NADP-dependent malic enzyme 3                           314   1e-99    Hydrilla verticillata
ref|XP_009387625.1|  PREDICTED: NADP-dependent malic enzyme             314   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010648278.1|  PREDICTED: NADP-dependent malic enzyme isofo...    315   1e-99    Vitis vinifera
ref|XP_010915394.1|  PREDICTED: NADP-dependent malic enzyme-like        315   1e-99    Elaeis guineensis
ref|XP_010688309.1|  PREDICTED: NADP-dependent malic enzyme             314   1e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010915364.1|  PREDICTED: NADP-dependent malic enzyme isofo...    314   1e-99    Elaeis guineensis
gb|KDP34170.1|  hypothetical protein JCGZ_07741                         313   2e-99    Jatropha curcas
sp|P37222.1|MAOC_SOLLC  RecName: Full=NADP-dependent malic enzyme...    312   3e-99    Solanum lycopersicum
ref|XP_008462428.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    312   4e-99    Cucumis melo [Oriental melon]
gb|AAW56450.1|  chloroplast NADP-dependent malic enzyme precursor       314   4e-99    Flaveria bidentis
ref|XP_010915357.1|  PREDICTED: NADP-dependent malic enzyme isofo...    314   4e-99    Elaeis guineensis
gb|ABK94851.1|  unknown                                                 314   5e-99    Populus trichocarpa [western balsam poplar]
gb|KDO66532.1|  hypothetical protein CISIN_1g007703mg                   312   6e-99    Citrus sinensis [apfelsine]
gb|KDO51779.1|  hypothetical protein CISIN_1g006454mg                   310   6e-99    Citrus sinensis [apfelsine]
ref|XP_010062529.1|  PREDICTED: NADP-dependent malic enzyme isofo...    314   6e-99    Eucalyptus grandis [rose gum]
ref|XP_010062530.1|  PREDICTED: NADP-dependent malic enzyme isofo...    314   6e-99    Eucalyptus grandis [rose gum]
ref|XP_002298241.2|  malate oxidoreductase family protein               314   7e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010062528.1|  PREDICTED: NADP-dependent malic enzyme isofo...    314   7e-99    Eucalyptus grandis [rose gum]
ref|XP_011002817.1|  PREDICTED: NADP-dependent malic enzyme-like        311   7e-99    Populus euphratica
ref|XP_009348545.1|  PREDICTED: NADP-dependent malic enzyme-like        313   7e-99    Pyrus x bretschneideri [bai li]
ref|XP_003546557.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    313   8e-99    Glycine max [soybeans]
gb|ADU20198.1|  NADP-dependent malic enzyme                             313   8e-99    Pyrus pyrifolia [sha li]
ref|XP_008242501.1|  PREDICTED: NADP-dependent malic enzyme             314   8e-99    Prunus mume [ume]
ref|XP_007018504.1|  NADP-dependent malic enzyme                        312   8e-99    
gb|KHM98720.1|  NADP-dependent malic enzyme, chloroplastic              313   8e-99    Glycine soja [wild soybean]
ref|XP_010925546.1|  PREDICTED: NADP-dependent malic enzyme-like ...    313   9e-99    Elaeis guineensis
gb|KJB07476.1|  hypothetical protein B456_001G026200                    310   9e-99    Gossypium raimondii
ref|XP_003547744.1|  PREDICTED: NADP-dependent malic enzyme-like        312   1e-98    Glycine max [soybeans]
ref|XP_002324789.2|  hypothetical protein POPTR_0018s08250g             312   1e-98    
gb|KDP40863.1|  hypothetical protein JCGZ_24862                         313   1e-98    Jatropha curcas
ref|XP_007216983.1|  hypothetical protein PRUPE_ppa002714mg             311   1e-98    
ref|XP_010925545.1|  PREDICTED: NADP-dependent malic enzyme-like ...    313   2e-98    Elaeis guineensis
ref|XP_011010431.1|  PREDICTED: NADP-dependent malic enzyme-like        313   2e-98    Populus euphratica
ref|XP_009771112.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    313   2e-98    Nicotiana sylvestris
ref|XP_007012167.1|  NADP-malic enzyme 4                                315   2e-98    
ref|XP_009409372.1|  PREDICTED: NADP-dependent malic enzyme-like        312   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB07475.1|  hypothetical protein B456_001G026200                    311   2e-98    Gossypium raimondii
ref|XP_009353550.1|  PREDICTED: NADP-dependent malic enzyme             312   2e-98    Pyrus x bretschneideri [bai li]
gb|KJB07473.1|  hypothetical protein B456_001G026200                    310   3e-98    Gossypium raimondii
gb|KJB70391.1|  hypothetical protein B456_011G071400                    312   3e-98    Gossypium raimondii
gb|KJB06731.1|  hypothetical protein B456_001G008900                    310   3e-98    Gossypium raimondii
ref|XP_008450776.1|  PREDICTED: NADP-dependent malic enzyme             310   4e-98    Cucumis melo [Oriental melon]
gb|KJB70393.1|  hypothetical protein B456_011G071400                    312   4e-98    Gossypium raimondii
ref|XP_009394174.1|  PREDICTED: NADP-dependent malic enzyme-like ...    311   4e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG23103.1|  NADP-dependent malic enzyme                             311   4e-98    Gossypium arboreum [tree cotton]
gb|ABB86962.1|  cytosolic NADP-malic enzyme                             311   4e-98    Malus domestica [apple tree]
ref|XP_004141663.1|  PREDICTED: NADP-dependent malic enzyme-like        310   4e-98    Cucumis sativus [cucumbers]
ref|XP_007216984.1|  hypothetical protein PRUPE_ppa002714mg             311   4e-98    Prunus persica
ref|XP_007015739.1|  NADP-malic enzyme 4 isoform 1                      311   4e-98    Theobroma cacao [chocolate]
gb|AFR54473.1|  cytosolic NADP-malic protein                            311   5e-98    Prunus armeniaca
ref|XP_008228427.1|  PREDICTED: NADP-dependent malic enzyme             311   5e-98    Prunus mume [ume]
ref|XP_004135668.1|  PREDICTED: NADP-dependent malic enzyme-like        310   6e-98    Cucumis sativus [cucumbers]
gb|KHN16969.1|  NADP-dependent malic enzyme                             310   6e-98    Glycine soja [wild soybean]
gb|KDO51776.1|  hypothetical protein CISIN_1g006454mg                   310   7e-98    Citrus sinensis [apfelsine]
ref|XP_011019577.1|  PREDICTED: NADP-dependent malic enzyme isofo...    309   8e-98    Populus euphratica
gb|EYU21512.1|  hypothetical protein MIMGU_mgv1a002703mg                311   9e-98    Erythranthe guttata [common monkey flower]
ref|XP_008353539.1|  PREDICTED: NADP-dependent malic enzyme-like        311   9e-98    
gb|AHA11552.1|  NADP-malic enzyme                                       310   1e-97    Malus domestica [apple tree]
gb|AFK37823.1|  unknown                                                 298   1e-97    Lotus japonicus
ref|XP_008362959.1|  PREDICTED: NADP-dependent malic enzyme             309   1e-97    
ref|XP_007150609.1|  hypothetical protein PHAVU_005G166400g             310   1e-97    Phaseolus vulgaris [French bean]
dbj|BAD87057.1|  putative NADP-dependent malic protein                  303   1e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011019576.1|  PREDICTED: NADP-dependent malic enzyme isofo...    309   1e-97    Populus euphratica
ref|XP_009352546.1|  PREDICTED: NADP-dependent malic enzyme             310   1e-97    
ref|XP_011019575.1|  PREDICTED: NADP-dependent malic enzyme isofo...    309   1e-97    Populus euphratica
ref|XP_006426882.1|  hypothetical protein CICLE_v10025125mg             310   1e-97    Citrus clementina [clementine]
gb|AAT02534.1|  NADP-dependent malic enzyme 2                           310   1e-97    Hydrilla verticillata
ref|XP_009342530.1|  PREDICTED: NADP-dependent malic enzyme-like        310   1e-97    Pyrus x bretschneideri [bai li]
gb|KDO51774.1|  hypothetical protein CISIN_1g006454mg                   310   1e-97    Citrus sinensis [apfelsine]
ref|XP_011093633.1|  PREDICTED: NADP-dependent malic enzyme             309   2e-97    Sesamum indicum [beniseed]
ref|XP_003543623.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    310   2e-97    Glycine max [soybeans]
gb|KHN32646.1|  NADP-dependent malic enzyme, chloroplastic              310   2e-97    Glycine soja [wild soybean]
ref|XP_010102421.1|  NADP-dependent malic enzyme                        312   2e-97    
ref|XP_008447551.1|  PREDICTED: NADP-dependent malic enzyme             310   3e-97    Cucumis melo [Oriental melon]
ref|XP_008356453.1|  PREDICTED: LOW QUALITY PROTEIN: NADP-depende...    302   3e-97    
gb|KHN18149.1|  NADP-dependent malic enzyme                             308   3e-97    Glycine soja [wild soybean]
gb|KHN40389.1|  NADP-dependent malic enzyme                             307   3e-97    Glycine soja [wild soybean]
ref|XP_010267163.1|  PREDICTED: NADP-dependent malic enzyme-like ...    308   4e-97    Nelumbo nucifera [Indian lotus]
ref|XP_004150784.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    309   4e-97    Cucumis sativus [cucumbers]
ref|XP_002309534.1|  hypothetical protein POPTR_0006s25280g             307   4e-97    Populus trichocarpa [western balsam poplar]
gb|KJB65652.1|  hypothetical protein B456_010G105100                    307   4e-97    Gossypium raimondii
ref|XP_003526504.2|  PREDICTED: NADP-dependent malic enzyme-like ...    308   4e-97    Glycine max [soybeans]
ref|XP_003516804.1|  PREDICTED: NADP-dependent malic enzyme-like        307   4e-97    Glycine max [soybeans]
ref|XP_010267160.1|  PREDICTED: NADP-dependent malic enzyme-like ...    309   5e-97    Nelumbo nucifera [Indian lotus]
ref|XP_010267161.1|  PREDICTED: NADP-dependent malic enzyme-like ...    309   5e-97    Nelumbo nucifera [Indian lotus]
ref|XP_006581459.1|  PREDICTED: NADP-dependent malic enzyme-like ...    308   5e-97    Glycine max [soybeans]
ref|XP_003522719.1|  PREDICTED: NADP-dependent malic enzyme-like ...    307   6e-97    Glycine max [soybeans]
ref|XP_006581458.1|  PREDICTED: NADP-dependent malic enzyme-like ...    308   1e-96    Glycine max [soybeans]
ref|XP_006581457.1|  PREDICTED: NADP-dependent malic enzyme-like ...    308   1e-96    Glycine max [soybeans]
ref|XP_008337596.1|  PREDICTED: NADP-dependent malic enzyme             306   1e-96    Malus domestica [apple tree]
ref|XP_007152912.1|  hypothetical protein PHAVU_004G170800g             306   1e-96    Phaseolus vulgaris [French bean]
ref|XP_006578239.1|  PREDICTED: NADP-dependent malic enzyme-like ...    307   1e-96    
ref|XP_006578240.1|  PREDICTED: NADP-dependent malic enzyme-like ...    307   1e-96    Glycine max [soybeans]
ref|XP_010521509.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    307   1e-96    Tarenaya hassleriana [spider flower]
ref|XP_006450720.1|  hypothetical protein CICLE_v10007668mg             306   2e-96    Citrus clementina [clementine]
gb|AEK25136.1|  NADP-dependent malic enzyme                             307   2e-96    Hylocereus undatus [dragon fruit]
ref|XP_006476016.1|  PREDICTED: NADP-dependent malic enzyme-like ...    306   2e-96    
ref|XP_004501098.1|  PREDICTED: NADP-dependent malic enzyme-like        305   2e-96    Cicer arietinum [garbanzo]
ref|XP_010249514.1|  PREDICTED: NADP-dependent malic enzyme             305   3e-96    Nelumbo nucifera [Indian lotus]
ref|XP_004302862.1|  PREDICTED: LOW QUALITY PROTEIN: NADP-depende...    306   3e-96    Fragaria vesca subsp. vesca
dbj|BAD87056.1|  putative NADP-dependent malic protein                  303   3e-96    Oryza sativa Japonica Group [Japonica rice]
gb|KDO79867.1|  hypothetical protein CISIN_1g007112mg                   306   3e-96    Citrus sinensis [apfelsine]
emb|CDP08185.1|  unnamed protein product                                306   4e-96    Coffea canephora [robusta coffee]
ref|XP_006476015.1|  PREDICTED: NADP-dependent malic enzyme-like ...    306   4e-96    
gb|AGH32501.1|  malic enzyme                                            305   4e-96    Stylosanthes guianensis [stylo]
ref|XP_008810493.1|  PREDICTED: NADP-dependent malic enzyme             306   5e-96    Phoenix dactylifera
gb|KGN62800.1|  hypothetical protein Csa_2G373430                       305   5e-96    
gb|AET01514.2|  NADP-dependent malic enzyme-like protein                305   6e-96    Medicago truncatula
gb|AFM08812.1|  NADP-dependent malic protein                            306   6e-96    Dimocarpus longan [longan]
ref|XP_004486781.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    306   6e-96    Cicer arietinum [garbanzo]
gb|KJB18587.1|  hypothetical protein B456_003G061800                    304   7e-96    Gossypium raimondii
ref|XP_006450719.1|  hypothetical protein CICLE_v10007668mg             306   8e-96    
gb|AAD11429.1|  malate dehydrogenase                                    292   8e-96    Mesembryanthemum crystallinum
gb|KHN41665.1|  NADP-dependent malic enzyme                             304   1e-95    Glycine soja [wild soybean]
ref|XP_004164764.1|  PREDICTED: NADP-dependent malic enzyme-like        305   1e-95    
ref|XP_003568785.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    303   1e-95    Brachypodium distachyon [annual false brome]
ref|XP_010231631.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    303   1e-95    Brachypodium distachyon [annual false brome]
ref|XP_008445000.1|  PREDICTED: NADP-dependent malic enzyme             303   1e-95    
tpg|DAA57813.1|  TPA: malic enzyme                                      303   2e-95    
ref|XP_008220115.1|  PREDICTED: NADP-dependent malic enzyme isofo...    303   2e-95    Prunus mume [ume]
ref|XP_008220114.1|  PREDICTED: NADP-dependent malic enzyme isofo...    304   2e-95    Prunus mume [ume]
ref|XP_003630727.1|  Malic enzyme                                       303   2e-95    Medicago truncatula
gb|KJB18586.1|  hypothetical protein B456_003G061800                    305   2e-95    Gossypium raimondii
ref|XP_004148395.1|  PREDICTED: NADP-dependent malic enzyme-like        304   2e-95    
gb|AAT02533.1|  NADP-dependent malic enzyme 1                           305   3e-95    Hydrilla verticillata
ref|XP_009616524.1|  PREDICTED: NADP-dependent malic enzyme-like ...    303   3e-95    Nicotiana tomentosiformis
ref|XP_007160295.1|  hypothetical protein PHAVU_002G309600g             305   3e-95    Phaseolus vulgaris [French bean]
ref|NP_001152396.1|  LOC100286036                                       303   3e-95    
tpg|DAA57814.1|  TPA: malic enzyme                                      303   3e-95    
gb|ACI46151.1|  NADP-dependent malic enzyme                             302   3e-95    Hordeum vulgare [barley]
emb|CDM84157.1|  unnamed protein product                                303   3e-95    Triticum aestivum [Canadian hard winter wheat]
gb|ACL54508.1|  unknown                                                 303   3e-95    Zea mays [maize]
gb|EYU20414.1|  hypothetical protein MIMGU_mgv1a003353mg                303   3e-95    Erythranthe guttata [common monkey flower]
ref|XP_004503480.1|  PREDICTED: NADP-dependent malic enzyme-like        303   4e-95    Cicer arietinum [garbanzo]
ref|XP_008369782.1|  PREDICTED: NADP-dependent malic enzyme-like        297   4e-95    
gb|AAK83074.1|AF288921_1  putative cytosolic NADP-malic enzyme          302   4e-95    Flaveria pringlei
gb|ACX50497.1|  NADP-dependent malic enzyme                             303   5e-95    Zea mays [maize]
gb|ABR26108.1|  NADP-dependent malic enzyme                             289   5e-95    Oryza sativa Indica Group [Indian rice]
gb|AFK40116.1|  unknown                                                 302   6e-95    Medicago truncatula
gb|EEC71406.1|  hypothetical protein OsI_03572                          302   6e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_009616523.1|  PREDICTED: NADP-dependent malic enzyme-like ...    303   6e-95    Nicotiana tomentosiformis
gb|AEM44701.1|  NADP-malic protein                                      290   7e-95    Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_010325075.1|  PREDICTED: NADP-dependent malic enzyme-like ...    302   7e-95    Solanum lycopersicum
ref|XP_006644644.1|  PREDICTED: NADP-dependent malic enzyme-like        302   7e-95    Oryza brachyantha
dbj|BAB20887.2|  NADP dependent malic enzyme                            301   8e-95    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044107.1|  Os01g0723400                                       301   9e-95    
ref|XP_003525285.1|  PREDICTED: NADP-dependent malic enzyme-like ...    303   9e-95    Glycine max [soybeans]
ref|XP_004969797.1|  PREDICTED: NADP-dependent malic enzyme-like ...    301   9e-95    Setaria italica
ref|XP_007137244.1|  hypothetical protein PHAVU_009G111500g             301   1e-94    Phaseolus vulgaris [French bean]
gb|EYU29291.1|  hypothetical protein MIMGU_mgv1a002717mg                303   1e-94    Erythranthe guttata [common monkey flower]
emb|CAA56354.1|  NADP dependent malic enzyme                            301   1e-94    Phaseolus vulgaris [French bean]
gb|KHN05334.1|  NADP-dependent malic enzyme, chloroplastic              301   1e-94    Glycine soja [wild soybean]
ref|XP_004510309.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    302   1e-94    Cicer arietinum [garbanzo]
ref|XP_007222062.1|  hypothetical protein PRUPE_ppa003210mg             301   1e-94    
dbj|BAJ95153.1|  predicted protein                                      290   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010325074.1|  PREDICTED: NADP-dependent malic enzyme-like ...    301   2e-94    Solanum lycopersicum
ref|XP_003569705.1|  PREDICTED: NADP-dependent malic enzyme-like        302   2e-94    Brachypodium distachyon [annual false brome]
ref|XP_007137243.1|  hypothetical protein PHAVU_009G111500g             301   2e-94    Phaseolus vulgaris [French bean]
dbj|BAC54101.1|  cytosolic NADP-malic enzyme                            300   2e-94    Lithospermum erythrorhizon
gb|KEH36085.1|  NADP-dependent malic enzyme-like protein                300   2e-94    Medicago truncatula
ref|XP_006364722.1|  PREDICTED: NADP-dependent malic enzyme-like        300   2e-94    Solanum tuberosum [potatoes]
ref|XP_011078255.1|  PREDICTED: NADP-dependent malic enzyme-like        300   3e-94    Sesamum indicum [beniseed]
gb|KEH39546.1|  NADP-dependent malic enzyme-like protein                302   3e-94    Medicago truncatula
dbj|BAA24950.1|  NADP-malic enzyme                                      300   3e-94    Aloe arborescens
sp|P37223.1|MAOX_MESCR  RecName: Full=NADP-dependent malic enzyme...    300   4e-94    Mesembryanthemum crystallinum
tpg|DAA57815.1|  TPA: malic enzyme                                      301   5e-94    
ref|XP_003533042.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    301   6e-94    Glycine max [soybeans]
ref|XP_004969796.1|  PREDICTED: NADP-dependent malic enzyme-like ...    301   6e-94    Setaria italica
gb|ABW77317.1|  NADP-dependent malic enzyme                             298   7e-94    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009614468.1|  PREDICTED: NADP-dependent malic enzyme-like        299   8e-94    Nicotiana tomentosiformis
ref|XP_009779848.1|  PREDICTED: NADP-dependent malic enzyme             299   1e-93    Nicotiana sylvestris
ref|XP_011092589.1|  PREDICTED: NADP-dependent malic enzyme-like ...    299   1e-93    Sesamum indicum [beniseed]
gb|ABI98681.2|  cytosolic NADP-malic enzyme                             299   1e-93    Nicotiana tabacum [American tobacco]
ref|XP_011081758.1|  PREDICTED: NADP-dependent malic enzyme-like        298   1e-93    
ref|XP_009801543.1|  PREDICTED: NADP-dependent malic enzyme-like ...    298   1e-93    Nicotiana sylvestris
sp|P12628.1|MAOX_PHAVU  RecName: Full=NADP-dependent malic enzyme...    298   1e-93    Phaseolus vulgaris [French bean]
gb|AAK83073.1|AF288920_1  putative cytosolic NADP-malic enzyme          298   2e-93    Flaveria pringlei
ref|XP_006580482.1|  PREDICTED: NADP-dependent malic enzyme-like ...    298   2e-93    Glycine max [soybeans]
ref|XP_011092518.1|  PREDICTED: NADP-dependent malic enzyme-like ...    299   2e-93    Sesamum indicum [beniseed]
ref|XP_010095359.1|  NADP-dependent malic enzyme                        307   2e-93    
gb|ABK95522.1|  unknown                                                 295   3e-93    Populus trichocarpa [western balsam poplar]
ref|XP_009801542.1|  PREDICTED: NADP-dependent malic enzyme-like ...    298   4e-93    Nicotiana sylvestris
ref|XP_009801541.1|  PREDICTED: NADP-dependent malic enzyme-like ...    299   4e-93    Nicotiana sylvestris
dbj|BAA74735.1|  NADP-malic enzyme                                      297   4e-93    Aloe arborescens
ref|XP_010047290.1|  PREDICTED: NADP-dependent malic enzyme             297   5e-93    Eucalyptus grandis [rose gum]
gb|AHA11551.1|  NADP-malic enzyme                                       297   6e-93    Malus domestica [apple tree]
ref|XP_008462427.1|  PREDICTED: NADP-dependent malic enzyme-like ...    297   7e-93    Cucumis melo [Oriental melon]
dbj|BAG16517.1|  putative NADP-dependent malic enzyme                   296   8e-93    Capsicum chinense [bonnet pepper]
ref|XP_009367432.1|  PREDICTED: NADP-dependent malic enzyme isofo...    297   9e-93    Pyrus x bretschneideri [bai li]
gb|AHA11550.1|  NADP-malic enzyme                                       293   1e-92    Malus domestica [apple tree]
ref|XP_006345575.1|  PREDICTED: NADP-dependent malic enzyme-like        296   1e-92    Solanum tuberosum [potatoes]
ref|XP_010417798.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    298   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010430068.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    298   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010473033.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    297   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_007135635.1|  hypothetical protein PHAVU_010G145500g             297   2e-92    Phaseolus vulgaris [French bean]
ref|XP_002324450.1|  hypothetical protein POPTR_0018s09380g             295   2e-92    Populus trichocarpa [western balsam poplar]
ref|NP_001233951.1|  cytosolic NADP-malic enzyme                        295   2e-92    
ref|XP_011007124.1|  PREDICTED: NADP-dependent malic enzyme             295   2e-92    Populus euphratica
ref|XP_006301745.1|  hypothetical protein CARUB_v10022207mg             296   2e-92    Capsella rubella
ref|XP_006389736.1|  hypothetical protein EUTSA_v10018247mg             296   3e-92    Eutrema salsugineum [saltwater cress]
ref|XP_011458980.1|  PREDICTED: NADP-dependent malic enzyme             295   3e-92    Fragaria vesca subsp. vesca
ref|XP_006389737.1|  hypothetical protein EUTSA_v10018247mg             296   3e-92    Eutrema salsugineum [saltwater cress]
ref|XP_006643858.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    294   4e-92    Oryza brachyantha
ref|XP_008361018.1|  PREDICTED: NADP-dependent malic enzyme-like        295   5e-92    
ref|XP_006654124.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    294   5e-92    Oryza brachyantha
gb|AEJ33773.1|  putative NADP-dependent malic enzyme                    294   6e-92    Solanum habrochaites
ref|XP_010047689.1|  PREDICTED: NADP-dependent malic enzyme             294   6e-92    Eucalyptus grandis [rose gum]
emb|CAB66003.1|  NADP-dependent malate dehydrogenase (decarboxyla...    293   7e-92    Apium graveolens
gb|EYU27276.1|  hypothetical protein MIMGU_mgv1a003339mg                294   8e-92    Erythranthe guttata [common monkey flower]
gb|AGJ76631.1|  NADP-malic enzyme 1                                     294   1e-91    Echinochloa crus-galli var. crus-galli
ref|XP_011081064.1|  PREDICTED: NADP-dependent malic enzyme-like        293   1e-91    Sesamum indicum [beniseed]
gb|AGT42314.1|  NADP-dependent malic enzyme                             295   1e-91    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042257.1|  Os01g0188400                                       295   1e-91    
gb|EAY72841.1|  hypothetical protein OsI_00711                          295   1e-91    Oryza sativa Indica Group [Indian rice]
gb|ABR18338.1|  unknown                                                 293   2e-91    Picea sitchensis
ref|NP_001054832.1|  Os05g0186300                                       291   3e-91    
ref|XP_009394173.1|  PREDICTED: NADP-dependent malic enzyme-like ...    294   3e-91    
ref|XP_003627038.1|  Malic enzyme                                       293   4e-91    
ref|XP_004960887.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    291   4e-91    
ref|XP_008357405.1|  PREDICTED: NADP-dependent malic enzyme isofo...    290   4e-91    
dbj|BAA03949.1|  NADP-dependent malic enzyme                            293   5e-91    
sp|P34105.3|MAOX_POPTR  RecName: Full=NADP-dependent malic enzyme...    292   5e-91    
gb|EPS58449.1|  malic enzyme                                            291   8e-91    
ref|NP_178093.1|  NADP-malic enzyme 4                                   293   1e-90    
gb|AAA66051.1|  malic enzyme                                            285   1e-90    
ref|XP_004287468.2|  PREDICTED: NADP-dependent malic enzyme             292   1e-90    
gb|AAF68116.1|AC010793_11  F20B17.18                                    292   2e-90    
gb|KHG14917.1|  NADP-dependent malic enzyme                             290   2e-90    
gb|KFK42380.1|  hypothetical protein AALP_AA2G248700                    291   2e-90    
gb|EMT09696.1|  hypothetical protein F775_52101                         292   2e-90    
ref|XP_010668641.1|  PREDICTED: NADP-dependent malic enzyme             290   3e-90    
emb|CDP03266.1|  unnamed protein product                                290   3e-90    
ref|XP_002887860.1|  NADP-malic enzyme 4                                291   4e-90    
emb|CDM81737.1|  unnamed protein product                                290   1e-89    
ref|XP_009104694.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    290   1e-89    
gb|ABY25986.1|  NADP-dependent malic enzyme 1                           290   1e-89    
emb|CDX68115.1|  BnaA07g21550D                                          290   1e-89    
ref|XP_009151107.1|  PREDICTED: NADP-dependent malic enzyme 3           288   1e-89    
ref|XP_010539482.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    289   1e-89    
ref|NP_001105313.1|  NADP-dependent malic enzyme, chloroplastic p...    289   2e-89    
gb|AAK91502.1|  NADP-dependent malic enzyme                             289   2e-89    
gb|KJB54772.1|  hypothetical protein B456_009G048600                    288   2e-89    
gb|KJB54774.1|  hypothetical protein B456_009G048600                    288   2e-89    
ref|XP_006394837.1|  hypothetical protein EUTSA_v10003882mg             287   2e-89    
ref|XP_002883966.1|  NADP-malic enzyme 1                                287   3e-89    
gb|KJB54775.1|  hypothetical protein B456_009G048600                    287   3e-89    
emb|CDX85926.1|  BnaC06g22080D                                          288   4e-89    
ref|XP_006299698.1|  hypothetical protein CARUB_v10015889mg             286   4e-89    
dbj|BAJ90221.1|  predicted protein                                      289   5e-89    
emb|CDX80544.1|  BnaC07g29000D                                          286   6e-89    
ref|NP_179580.1|  NADP-dependent malic enzyme 1                         286   7e-89    
ref|XP_008656303.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    285   8e-89    
ref|XP_004251632.1|  PREDICTED: NADP-dependent malic enzyme             286   9e-89    
gb|KEH39547.1|  NADP-dependent malic enzyme-like protein                288   1e-88    
ref|XP_010493842.1|  PREDICTED: NADP-dependent malic enzyme 3-like      284   1e-88    
gb|KFK40358.1|  hypothetical protein AALP_AA3G363600                    285   2e-88    
gb|EMS59690.1|  NADP-dependent malic enzyme, chloroplastic              288   2e-88    
gb|AFW82003.1|  hypothetical protein ZEAMMB73_408175                    285   3e-88    
ref|XP_010536224.1|  PREDICTED: NADP-dependent malic enzyme 2           285   3e-88    
ref|XP_006287343.1|  hypothetical protein CARUB_v10000542mg             285   3e-88    
ref|XP_002440734.1|  hypothetical protein SORBIDRAFT_09g005810          284   3e-88    
gb|KFK26368.1|  hypothetical protein AALP_AA8G239500                    284   3e-88    
prf||1803524A  malic enzyme                                             285   3e-88    
ref|XP_002872183.1|  hypothetical protein ARALYDRAFT_489440             279   4e-88    
ref|XP_006353488.1|  PREDICTED: NADP-dependent malic enzyme-like        284   5e-88    
ref|XP_006408906.1|  hypothetical protein EUTSA_v10001940mg             283   7e-88    
dbj|BAK08307.1|  predicted protein                                      284   1e-87    
ref|XP_009102128.1|  PREDICTED: NADP-dependent malic enzyme 1           282   2e-87    
ref|XP_010489119.1|  PREDICTED: NADP-dependent malic enzyme 1-like      282   2e-87    
ref|XP_010454927.1|  PREDICTED: NADP-dependent malic enzyme 3           281   5e-87    
gb|AES67931.2|  NADP-dependent malic enzyme-like protein                283   7e-87    
ref|NP_001150965.1|  NADP-dependent malic enzyme                        280   7e-87    
gb|EAZ13499.1|  hypothetical protein OsJ_03416                          280   1e-86    
ref|XP_010416557.1|  PREDICTED: NADP-dependent malic enzyme 1 iso...    280   2e-86    
ref|XP_006399678.1|  hypothetical protein EUTSA_v10013057mg             280   2e-86    
ref|NP_001044219.1|  Os01g0743500                                       280   2e-86    
ref|XP_010230567.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    282   2e-86    
ref|XP_010467915.1|  PREDICTED: NADP-dependent malic enzyme 1-like      280   2e-86    
ref|NP_197960.1|  NADP-dependent malic enzyme 3                         280   2e-86    
gb|EAY75782.1|  hypothetical protein OsI_03698                          279   2e-86    
ref|XP_009367431.1|  PREDICTED: NADP-dependent malic enzyme isofo...    281   2e-86    
ref|XP_004969917.1|  PREDICTED: NADP-dependent malic enzyme-like        281   3e-86    
emb|CDM84042.1|  unnamed protein product                                279   4e-86    
dbj|BAH20241.1|  AT5G11670                                              267   4e-86    
gb|AFL65183.1|  plastid NADP-malic enzyme                               280   5e-86    
emb|CDX78432.1|  BnaA03g03440D                                          278   6e-86    
emb|CDX70409.1|  BnaC03g04930D                                          278   7e-86    
emb|CDX91199.1|  BnaC02g03980D                                          278   8e-86    
ref|XP_009125825.1|  PREDICTED: NADP-dependent malic enzyme 2-like      278   9e-86    
ref|NP_001105383.1|  NADP-dependent malic enzyme                        280   1e-85    
ref|XP_002456340.1|  hypothetical protein SORBIDRAFT_03g034280          278   1e-85    
ref|XP_003569785.2|  PREDICTED: NADP-dependent malic enzyme-like        278   3e-85    
ref|XP_009131215.1|  PREDICTED: NADP-dependent malic enzyme 2           276   3e-85    
gb|KFK25427.1|  hypothetical protein AALP_AA8G113600                    276   4e-85    
gb|KCW82358.1|  hypothetical protein EUGRSUZ_C03762                     276   5e-85    
gb|AAQ88396.1|  non-photosynthetic NADP-malic enzyme                    276   1e-84    
gb|AFW85113.1|  malic enzyme Precursor                                  277   1e-84    
emb|CAA12157.1|  oxidoreductase                                         276   1e-84    
ref|XP_002303310.2|  malate oxidoreductase family protein               275   2e-84    
gb|EPS69147.1|  malic enzyme                                            273   3e-84    
ref|XP_002871486.1|  NADP-malic enzyme 2                                274   3e-84    
ref|XP_008648302.1|  PREDICTED: NADP-dependent malic enzyme isofo...    275   4e-84    
ref|XP_008648301.1|  PREDICTED: NADP-dependent malic enzyme isofo...    275   4e-84    
ref|XP_010491906.1|  PREDICTED: NADP-dependent malic enzyme 2           273   6e-84    
emb|CDY35901.1|  BnaA07g00860D                                          273   6e-84    
gb|AFW77688.1|  malic enzyme                                            275   6e-84    
ref|NP_001105292.1|  NADP malic enzyme4                                 275   6e-84    
ref|XP_010419746.1|  PREDICTED: NADP-dependent malic enzyme 2-lik...    273   7e-84    
ref|XP_006290164.1|  hypothetical protein CARUB_v10003832mg             273   9e-84    
dbj|BAH20329.1|  AT5G11670                                              268   1e-83    
ref|XP_010453214.1|  PREDICTED: NADP-dependent malic enzyme 2-like      272   2e-83    
gb|ABR26037.1|  NADP-dependent malic enzyme                             258   3e-83    
gb|EMT16777.1|  NADP-dependent malic enzyme                             271   4e-83    
tpg|DAA53058.1|  TPA: NADP malic enzyme3                                271   9e-83    
gb|ACF78489.1|  unknown                                                 271   1e-82    
gb|AAP33011.1|  NADP-malic enzyme                                       271   2e-82    
ref|XP_010419745.1|  PREDICTED: NADP-dependent malic enzyme 2-lik...    269   4e-82    
gb|ADW27478.1|  NADP-dependent malic enzyme                             270   5e-82    
ref|XP_002455029.1|  hypothetical protein SORBIDRAFT_03g003220          270   5e-82    
ref|NP_196728.1|  NADP-dependent malic enzyme 2                         268   7e-82    
ref|XP_010526436.1|  PREDICTED: NADP-dependent malic enzyme 1 iso...    266   3e-81    
ref|XP_002963488.1|  hypothetical protein SELMODRAFT_142026             266   3e-81    
ref|XP_002988197.1|  hypothetical protein SELMODRAFT_183698             266   3e-81    
ref|XP_002455030.1|  hypothetical protein SORBIDRAFT_03g003230          267   3e-81    
dbj|BAC23042.1|  NADP-dependent malic enzyme                            251   9e-81    
ref|XP_004968467.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    266   1e-80    
ref|XP_011014577.1|  PREDICTED: NADP-dependent malic enzyme-like        254   1e-79    
gb|KHG27198.1|  NADP-dependent malic enzyme                             261   4e-79    
gb|EMS62941.1|  NADP-dependent malic enzyme                             259   1e-78    
dbj|BAD94826.1|  malate oxidoreductase like protein                     244   9e-78    
ref|XP_010539479.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    243   2e-77    
ref|XP_001751342.1|  predicted protein                                  256   2e-77    
ref|XP_008367681.1|  PREDICTED: NADP-dependent malic enzyme-like        241   1e-76    
ref|XP_001759552.1|  predicted protein                                  254   2e-76    
gb|ACF82280.1|  unknown                                                 240   2e-76    
gb|EMT25327.1|  NADP-dependent malic enzyme                             256   6e-76    
gb|KEH39548.1|  NADP-dependent malic enzyme-like protein                251   5e-75    
gb|KHG27199.1|  NADP-dependent malic enzyme, chloroplastic              247   3e-74    
ref|XP_010318529.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    245   1e-72    
gb|KDO51773.1|  hypothetical protein CISIN_1g006454mg                   243   3e-72    
gb|EPS61465.1|  malic enzyme                                            229   6e-72    
ref|XP_001751852.1|  predicted protein                                  241   1e-71    
ref|XP_002989806.1|  hypothetical protein SELMODRAFT_130484             233   2e-68    
ref|XP_002990115.1|  hypothetical protein SELMODRAFT_185015             231   1e-67    
gb|EMT10266.1|  NADP-dependent malic enzyme, chloroplastic              232   2e-67    
ref|XP_008648299.1|  PREDICTED: NADP-dependent malic enzyme isofo...    229   1e-66    
ref|XP_008648298.1|  PREDICTED: NADP-dependent malic enzyme isofo...    229   1e-66    
gb|KHN16636.1|  NADP-dependent malic enzyme                             223   7e-66    
gb|KHG05054.1|  NADP-dependent malic enzyme                             224   8e-66    
gb|EMS56730.1|  NADP-dependent malic enzyme                             223   2e-64    
gb|KHN13597.1|  NADP-dependent malic enzyme                             207   9e-64    
ref|XP_003551741.1|  PREDICTED: NADP-dependent malic enzyme-like        205   7e-63    
gb|ACM45704.1|  NADP-malic enzyme                                       211   8e-61    
emb|CDY02046.1|  BnaC04g14550D                                          209   1e-59    
gb|KDO66538.1|  hypothetical protein CISIN_1g007703mg                   208   1e-59    
gb|KDO66539.1|  hypothetical protein CISIN_1g007703mg                   208   1e-59    
emb|CDX82748.1|  BnaC07g01180D                                          207   5e-59    
gb|EKD39207.1|  hypothetical protein ACD_75C00475G0001                  196   4e-58    
ref|XP_007204216.1|  hypothetical protein PRUPE_ppa003142mg             202   2e-57    
dbj|BAJ51944.1|  NADP-dependent malic enzyme                            201   7e-57    
ref|XP_780686.3|  PREDICTED: NADP-dependent malic enzyme-like           196   1e-54    
ref|WP_035934675.1|  malate dehydrogenase                               195   1e-54    
ref|WP_040415469.1|  malate dehydrogenase                               194   2e-54    
ref|XP_010539478.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...    185   3e-54    
gb|EPR39287.1|  malic protein NAD-binding protein                       194   3e-54    
gb|ABX46186.1|  malate dehydrogenase                                    182   4e-54    
gb|ABX46175.1|  malate dehydrogenase                                    182   4e-54    
ref|WP_044043028.1|  malate dehydrogenase                               193   9e-54    
dbj|BAN26303.1|  malic protein NAD-binding protein                      193   1e-53    
gb|ABX46187.1|  malate dehydrogenase                                    181   1e-53    
gb|EYU30716.1|  hypothetical protein MIMGU_mgv1a0033651mg               192   1e-53    
gb|ABX46215.1|  malate dehydrogenase                                    181   2e-53    
ref|XP_004355233.1|  NADP-dependent malate dehydrogenase                193   2e-53    
gb|KCW79169.1|  hypothetical protein EUGRSUZ_C00609                     191   3e-53    
gb|ABX46199.1|  malate dehydrogenase                                    180   3e-53    
gb|ABX46196.1|  malate dehydrogenase                                    180   4e-53    
ref|XP_001658020.1|  AAEL001073-PA                                      192   5e-53    
ref|XP_008943919.1|  PREDICTED: NADP-dependent malic enzyme             186   5e-53    
gb|ABX46171.1|  malate dehydrogenase                                    179   6e-53    
gb|KFQ22807.1|  NADP-dependent malic enzyme                             186   7e-53    
gb|ABX46191.1|  malate dehydrogenase                                    179   8e-53    
ref|XP_313043.5|  AGAP004159-PA                                         191   8e-53    
ref|XP_003436731.1|  AGAP004159-PB                                      191   1e-52    
ref|WP_031361098.1|  malate dehydrogenase                               189   1e-52    
ref|WP_043740796.1|  malate dehydrogenase                               189   2e-52    
gb|ABX46173.1|  malate dehydrogenase                                    178   2e-52    
gb|ABX46207.1|  malate dehydrogenase                                    178   2e-52    
ref|WP_035721745.1|  malate dehydrogenase                               189   2e-52    
gb|ABX46184.1|  malate dehydrogenase                                    177   2e-52    
gb|AIT70137.1|  malic enzyme                                            189   2e-52    
ref|WP_029916854.1|  malate dehydrogenase                               189   3e-52    
gb|AAN86690.1|  malic enzyme                                            189   3e-52    
ref|XP_010215943.1|  PREDICTED: NADP-dependent malic enzyme             183   3e-52    
gb|AIT70119.1|  malic enzyme                                            189   3e-52    
ref|XP_009509921.1|  PREDICTED: NADP-dependent malic enzyme             181   3e-52    
gb|AIT70133.1|  malic enzyme                                            189   4e-52    
emb|CBJ25596.1|  malate dehydrogenase                                   188   5e-52    
gb|ABX46172.1|  malate dehydrogenase                                    176   6e-52    
ref|XP_001850913.1|  malic enzyme                                       189   7e-52    
gb|ETL47724.1|  hypothetical protein L916_02558                         184   8e-52    
ref|XP_010085022.1|  PREDICTED: NADP-dependent malic enzyme             182   9e-52    
gb|KFU97241.1|  NADP-dependent malic enzyme                             182   1e-51    
gb|AGA34905.1|  NAD-dependent malic enzyme                              188   1e-51    
ref|WP_035496365.1|  malate dehydrogenase                               187   1e-51    
gb|ACL02315.1|  Malic enzyme                                            188   1e-51    
gb|EDZ99138.1|  Malate dehydrogenase (oxaloacetate-decarboxylatin...    187   2e-51    
ref|WP_035501286.1|  malate dehydrogenase                               187   2e-51    
ref|WP_026849561.1|  malate dehydrogenase                               186   2e-51    
gb|KFO04180.1|  NADP-dependent malic enzyme                             181   2e-51    
ref|NP_001003627.2|  NAD-dependent malic enzyme, mitochondrial          187   2e-51    
gb|AAH78317.1|  Malic enzyme 2, NAD(+)-dependent, mitochondrial         187   2e-51    
gb|AIT70128.1|  malic enzyme                                            187   2e-51    
ref|WP_007748738.1|  malic enzyme                                       186   3e-51    
ref|WP_007584174.1|  malate dehydrogenase                               186   3e-51    
ref|WP_037466000.1|  malate dehydrogenase                               186   3e-51    
ref|XP_010296549.1|  PREDICTED: NADP-dependent malic enzyme             181   3e-51    
gb|ABX46174.1|  malate dehydrogenase                                    175   3e-51    
ref|WP_043808480.1|  malate dehydrogenase                               185   6e-51    
gb|AIT70142.1|  malic enzyme                                            186   6e-51    
ref|XP_010150353.1|  PREDICTED: NADP-dependent malic enzyme             176   7e-51    
ref|XP_009923964.1|  PREDICTED: NADP-dependent malic enzyme             177   7e-51    
ref|XP_010194848.1|  PREDICTED: NADP-dependent malic enzyme             177   8e-51    
gb|KFW12199.1|  NADP-dependent malic enzyme                             180   9e-51    
ref|XP_010187226.1|  PREDICTED: NADP-dependent malic enzyme             177   1e-50    
ref|XP_006789841.1|  PREDICTED: NAD-dependent malic enzyme, mitoc...    185   1e-50    
gb|ETN64604.1|  malic enzyme                                            186   1e-50    
gb|ABX46208.1|  malate dehydrogenase                                    173   1e-50    
ref|XP_009490518.1|  PREDICTED: NADP-dependent malic enzyme             176   1e-50    
gb|EFA83632.1|  NADP-dependent malate dehydrogenase                     184   1e-50    
gb|AIT70129.1|  malic enzyme                                            184   1e-50    
ref|NP_989634.1|  NADP-dependent malic enzyme                           184   1e-50    
ref|XP_001658019.1|  AAEL001091-PA                                      186   1e-50    
ref|WP_020173661.1|  NAD-dependent malic enzyme, mitochondrial          184   2e-50    
gb|AIT70122.1|  malic enzyme                                            184   2e-50    
ref|WP_022842718.1|  NAD-dependent malic enzyme, mitochondrial          184   2e-50    
ref|XP_009584169.1|  PREDICTED: NADP-dependent malic enzyme             180   2e-50    
ref|NP_001290135.1|  malic enzyme 1, NADP(+)-dependent, cytosolic       184   2e-50    



>gb|AAB41026.1| NADP-malic enzyme, partial [Flaveria linearis]
Length=347

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DAVKAIKPTVLIGSSGAG+TFTK+V+ AM SFNEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  159  FLDAVKAIKPTVLIGSSGAGQTFTKEVVEAMRSFNEKPIILALSNPTSQSECTAEQAYTW  218

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGR IFASGSPF P EY G+  +SGQ+NNAYIFPGFGLGLIISGAIRVHD+MLLAASEA
Sbjct  219  SEGRTIFASGSPFAPVEYNGKVYVSGQSNNAYIFPGFGLGLIISGAIRVHDEMLLAASEA  278

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FD GLIYPPF+NIRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  279  LAEQVTQEHFDNGLIYPPFTNIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  338

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  339  YSPKYRNYR  347



>ref|XP_009591013.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=643

 Score =   332 bits (850),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIGSSGAG+TFTK+V+ AMA+FNEKPI+ ALSNPTSQSECTAEEAYTW
Sbjct  455  LVNAVKSIKPTVLIGSSGAGKTFTKEVVQAMATFNEKPIIFALSNPTSQSECTAEEAYTW  514

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+  +SGQANNAYIFPG GLGLIISGAIRVHDDMLLAASEA
Sbjct  515  SEGRAIFASGSPFAPVEYKGKVFVSGQANNAYIFPGLGLGLIISGAIRVHDDMLLAASEA  574

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAAEV+QENF+KGLIYPPFSNIRKISAHIAA+VAAKAYELGLATRLPQPENLVAYAESCM
Sbjct  575  LAAEVSQENFEKGLIYPPFSNIRKISAHIAAKVAAKAYELGLATRLPQPENLVAYAESCM  634

Query  216  YSPTYRSYR  190
            YSP+YRSYR
Sbjct  635  YSPSYRSYR  643



>emb|CBI36068.3| unnamed protein product [Vitis vinifera]
Length=640

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIGSSG GRTFTK+V+ AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  452  LVDAVKAIKPTVLIGSSGVGRTFTKEVVEAMASFNEKPIILALSNPTSQSECTAEEAYTW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  512  SEGRAIFASGSPFDPVEYNGKVFVPGQSNNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  571

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA + TQENFDKG+IYPPFSNIRKISAHIAA VAAKAYELGLATRLPQPENLV YAE+CM
Sbjct  572  LAKQATQENFDKGMIYPPFSNIRKISAHIAANVAAKAYELGLATRLPQPENLVEYAENCM  631

Query  216  YSPTYRSYR  190
            YSP YRS+R
Sbjct  632  YSPVYRSFR  640



>ref|NP_001268030.1| malate dehydrogenase [Vitis vinifera]
 gb|AAB08874.1| malate dehydrogenase [Vitis vinifera]
Length=640

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIGSSG GRTFTK+V+ AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  452  LVDAVKAIKPTVLIGSSGVGRTFTKEVVEAMASFNEKPIILALSNPTSQSECTAEEAYTW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  512  SEGRAIFASGSPFDPVEYNGKVFVPGQSNNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  571

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA + TQENFDKG+IYPPFSNIRKISAHIAA VAAKAYELGLATRLPQPENLV YAE+CM
Sbjct  572  LAKQATQENFDKGMIYPPFSNIRKISAHIAANVAAKAYELGLATRLPQPENLVEYAENCM  631

Query  216  YSPTYRSYR  190
            YSP YRS+R
Sbjct  632  YSPAYRSFR  640



>gb|AAB19243.1| NADP-malic enzyme, partial [Flaveria trinervia]
Length=188

 Score =   315 bits (808),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  753  VDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTWS  574
            +DA+K I+PTVLIGSSG G+TFTK+V+  M+S NEKPI+LALSNPTSQSECTAE+AYTWS
Sbjct  1    LDAIKTIRPTVLIGSSGTGQTFTKEVVETMSSLNEKPIILALSNPTSQSECTAEQAYTWS  60

Query  573  EGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaaseal  394
            EGRAIFASGSPF P EY G+  +SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEAL
Sbjct  61   EGRAIFASGSPFKPVEYNGKLYVSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEAL  120

Query  393  aaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCMY  214
            A +VTQE+FDKGLI+PPF++IRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCMY
Sbjct  121  AEQVTQEHFDKGLIFPPFTSIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCMY  180

Query  213  SPTYRSYR  190
            SP YR YR
Sbjct  181  SPKYRIYR  188



>emb|CAN69517.1| hypothetical protein VITISV_024155 [Vitis vinifera]
Length=657

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIGSSG GRTFTK+V+ AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  469  LVDAVKAIKPTVLIGSSGVGRTFTKEVVEAMASFNEKPIILALSNPTSQSECTAEEAYTW  528

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  529  SEGRAIFASGSPFDPVEYNGKVFVPGQSNNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  588

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA + TQENFDKG+IYPPFSNIRKISAHIAA VAAKAYELGLATRLPQPENLV YAE+CM
Sbjct  589  LAKQATQENFDKGMIYPPFSNIRKISAHIAANVAAKAYELGLATRLPQPENLVEYAENCM  648

Query  216  YSPTYRSYR  190
            YSP YRS+R
Sbjct  649  YSPVYRSFR  657



>gb|AAL11455.1| NADP-dependent malic enzyme [Flaveria brownii]
Length=349

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DA+K I+PTVLIGSSG G+TFTK+V+  M+S NEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  161  FLDAIKTIRPTVLIGSSGTGQTFTKEVVETMSSLNEKPIILALSNPTSQSECTAEQAYTW  220

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  +SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  221  SEGRAIFASGSPFGPVEYNGKLYMSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  280

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+E+FD GLIYPPF+NIRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  281  LAEQVTEEHFDNGLIYPPFTNIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  340

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  341  YSPKYRSYR  349



>ref|XP_006359476.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Solanum 
tuberosum]
Length=640

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIGSSGAGRTFTK+V+ AMA+FNEKPI+ ALSNPTSQSECTAEEAY+W
Sbjct  452  LVNAVKSIKPTVLIGSSGAGRTFTKEVVQAMATFNEKPIIFALSNPTSQSECTAEEAYSW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVHDDMLL ASEA
Sbjct  512  SEGRAIFASGSPFAPVEYNGKVYASGQANNAYIFPGFGLGLIISGAIRVHDDMLLVASEA  571

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QENF+KGLIYPPFSNIRKISAHIAA+VAAKAYELGLATRLPQP++LVAYAESCM
Sbjct  572  LAEQVSQENFEKGLIYPPFSNIRKISAHIAAKVAAKAYELGLATRLPQPKDLVAYAESCM  631

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  632  YSPAYRSYR  640



>gb|ABK94110.1| unknown [Populus trichocarpa]
Length=232

 Score =   313 bits (803),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG G+TFTK+VI AMASFNEKPI+L+LSNPTSQSECTAEEAYTW
Sbjct  44   LLDAVNDIKPTVLIGTSGVGKTFTKEVIEAMASFNEKPIILSLSNPTSQSECTAEEAYTW  103

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY+G+T + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASEA
Sbjct  104  SQGRAIFASGSPFAPFEYEGKTFMPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASEA  163

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF NIRKISA IAA+VAAKAYELGLATR+P P +LV +AESCM
Sbjct  164  LAAQVTQENFDKGLIYPPFKNIRKISAEIAAKVAAKAYELGLATRVPPPRDLVKHAESCM  223

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  224  YSPAYRSYR  232



>ref|NP_001234458.1| NADP-dependent malic enzyme, chloroplastic [Solanum lycopersicum]
 gb|AAB58727.1| NADP-malic enzyme [Solanum lycopersicum]
Length=640

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIGSSGAGRTFTK+V+ AMA+FNEKPI+ ALSNPTSQSECTAEEAY+W
Sbjct  452  LVNAVKSIKPTVLIGSSGAGRTFTKEVVQAMATFNEKPIIFALSNPTSQSECTAEEAYSW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVHDDMLL ASEA
Sbjct  512  SEGRAIFASGSPFAPVEYNGKVYASGQANNAYIFPGFGLGLIISGAIRVHDDMLLVASEA  571

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA EV+QENF+KGLIYPPFSNIRKISAHI A+VAAKAYELGLATRLPQP++LVAYAESCM
Sbjct  572  LADEVSQENFEKGLIYPPFSNIRKISAHIRAKVAAKAYELGLATRLPQPKDLVAYAESCM  631

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  632  YSPAYRSYR  640



>gb|KDO66547.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=388

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPT+LIGSSG GRTFTK+VI AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  200  LLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEKPLILALSNPTSQSECTAEEAYTW  259

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  260  SKGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  319

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P+NLV  AESCM
Sbjct  320  LAKQVTEENFEKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPQNLVKCAESCM  379

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  380  YTPVYRNYR  388



>gb|ABV72704.1| non-C4 NADP-dependent malic enzyme, partial [Flaveria trinervia]
Length=605

 Score =   323 bits (828),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DAVKAIKPTVLIGSSGAG+TFTK+V+ AM+SFNEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  417  FLDAVKAIKPTVLIGSSGAGQTFTKEVVEAMSSFNEKPIILALSNPTSQSECTAEQAYTW  476

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGR IFASGSPF P EY G+  +SGQ+NNAYIFPGFGLGLIISGAIRVHD+MLLAASEA
Sbjct  477  SEGRTIFASGSPFAPVEYNGKVYVSGQSNNAYIFPGFGLGLIISGAIRVHDEMLLAASEA  536

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FD GLIYPPF+NIRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  537  LAEQVTQEHFDNGLIYPPFTNIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  596

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  597  YSPKYRNYR  605



>gb|ACF74358.1| NADP-dependent malic protein [Arachis hypogaea]
Length=197

 Score =   309 bits (791),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV  IKPTVLIG+SG GRTFTK+VI AMAS NEKPI+L+LSNPTSQSECTAEEAY W
Sbjct  6    LVDAVNKIKPTVLIGTSGQGRTFTKEVIEAMASINEKPIILSLSNPTSQSECTAEEAYKW  65

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY+G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  66   SQGRAIFASGSPFPPVEYEGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  125

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V++ENF+KGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV +AESCM
Sbjct  126  LAAQVSEENFEKGLIYPPFTNIRKISAHIAASVAAKAYELGLATRLPQPKDLVKFAESCM  185

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  186  YTPAYRSYR  194



>ref|XP_009626739.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic [Nicotiana 
tomentosiformis]
Length=642

 Score =   324 bits (830),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIGSSGAGRTFTK+V+ AMA+FNEKPI+ ALSNPTSQSECTAEEAYTW
Sbjct  454  LVNAVKSIKPTVLIGSSGAGRTFTKEVVQAMATFNEKPIIFALSNPTSQSECTAEEAYTW  513

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  514  SEGRAIFASGSPFAPVEYNGKIYASGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  573

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QENF+KGLIYPPF+NIRKISA+IAA+VAAKAYELGLATRLP+P NLVAYAESCM
Sbjct  574  LAEQVSQENFEKGLIYPPFTNIRKISANIAAKVAAKAYELGLATRLPEPANLVAYAESCM  633

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  634  YSPAYRSYR  642



>ref|XP_004167694.1| PREDICTED: NADP-dependent malic enzyme-like, partial [Cucumis 
sativus]
Length=234

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GRTFTK+V+  MAS NE+PI+L+LSNPTSQSECTAEEAY W
Sbjct  46   LIDAVKEIKPTVLIGTSGVGRTFTKEVVETMASINEQPIILSLSNPTSQSECTAEEAYKW  105

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P ++KG+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  106  SQGRAIFASGSPFDPVKFKGKMFVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  165

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QE+FDKGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  166  LASQVSQEDFDKGLIYPPFTNIRKISAHIAASVAAKAYELGLATRLPQPKDLVKYAESCM  225

Query  216  YSPTYRSYR  190
            YSP+Y++YR
Sbjct  226  YSPSYQNYR  234



>sp|P36444.1|MAOC_FLAPR RecName: Full=NADP-dependent malic enzyme, chloroplastic; Short=NADP-ME; 
Flags: Precursor [Flaveria pringlei]
 emb|CAA54986.1| malate dehydrogenase (oxaloacetate decarboxylating) (NADP+) [Flaveria 
pringlei]
Length=647

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DAVKAIKPTVLIGSSGAG+TFTK+V+ AM+SFNEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  459  FLDAVKAIKPTVLIGSSGAGQTFTKEVVEAMSSFNEKPIILALSNPTSQSECTAEQAYTW  518

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGR IFASGSPF P EY G+  +SGQ+NNAYIFPGFGLGLIISGAIRVHD+MLLAASEA
Sbjct  519  SEGRTIFASGSPFAPVEYNGKVYVSGQSNNAYIFPGFGLGLIISGAIRVHDEMLLAASEA  578

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FD GLIYPPF+NIRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  579  LAEQVTQEHFDNGLIYPPFTNIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  638

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  639  YSPKYRNYR  647



>gb|ABS32241.1| NADP-malic enzyme [Flaveria palmeri]
Length=580

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DAVK+IKPTVLIGSSGAG+TFTK+++ AM+SFNEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  392  FLDAVKSIKPTVLIGSSGAGQTFTKEIVEAMSSFNEKPIILALSNPTSQSECTAEQAYTW  451

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGR IFASGSPF P EY G+  +SGQ+NNAYIFPGFGLGLIISGAIRVHD+MLLAASEA
Sbjct  452  SEGRTIFASGSPFAPVEYNGKVYVSGQSNNAYIFPGFGLGLIISGAIRVHDEMLLAASEA  511

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FD GLIYPPF+NIRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  512  LAEQVTQEHFDNGLIYPPFTNIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  571

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  572  YSPKYRNYR  580



>gb|EYU45830.1| hypothetical protein MIMGU_mgv1a002611mg [Erythranthe guttata]
Length=654

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVLIGSSGAGRTFTK+V+ AM+SFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  466  LLEAVKTIKPTVLIGSSGAGRTFTKEVVEAMSSFNEKPVILALSNPTSQSECTAEEAYTW  525

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVH+DMLLAASEA
Sbjct  526  SEGRAIFASGSPFSPAEYNGKFYASGQANNAYIFPGFGLGLIISGAIRVHEDMLLAASEA  585

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QEN DKGLIYPPFSNIR ISA IAARVAAKAYELGLATRLPQPENLVAYAESCM
Sbjct  586  LAEQVSQENLDKGLIYPPFSNIRYISAQIAARVAAKAYELGLATRLPQPENLVAYAESCM  645

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  646  YSPNYRNYR  654



>ref|NP_001268142.1| NADP-dependent malic enzyme [Vitis vinifera]
 sp|P51615.1|MAOX_VITVI RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME [Vitis 
vinifera]
 gb|AAA67087.1| malate dehydrogenase (NADP+) [Vitis vinifera]
Length=591

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIGSSG G+ FTK+VI AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  403  LLDAVKVIKPTVLIGSSGVGKAFTKEVIEAMASCNEKPLILALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY G+T + GQANNAYIFPG G+GL+ISGAIRVHD+MLLAASEA
Sbjct  463  TQGRAIFASGSPFDPVEYNGKTFVPGQANNAYIFPGLGMGLVISGAIRVHDEMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLPQPENLV YAESCM
Sbjct  523  LARQVTQENFDKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPQPENLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  583  YSPVYRSYR  591



>ref|XP_009772764.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic [Nicotiana 
sylvestris]
Length=642

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIGSSGAGRTFTK+V+ A+A+FNEKPI+ ALSNPTSQSECTAEEAY+W
Sbjct  454  LVNAVKSIKPTVLIGSSGAGRTFTKEVVQALATFNEKPIIFALSNPTSQSECTAEEAYSW  513

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  514  SEGRAIFASGSPFAPVEYNGKVYASGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  573

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QENF+KGLIYPPF+NIRKISA+IAA+VAAKAYELGLATRLP+P NLVAYAESCM
Sbjct  574  LAEQVSQENFEKGLIYPPFTNIRKISANIAAKVAAKAYELGLATRLPEPANLVAYAESCM  633

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  634  YSPAYRSYR  642



>gb|KDO66546.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=496

 Score =   317 bits (812),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPT+LIGSSG GRTFTK+VI AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  308  LLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEKPLILALSNPTSQSECTAEEAYTW  367

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  368  SKGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  427

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P+NLV  AESCM
Sbjct  428  LAKQVTEENFEKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPQNLVKCAESCM  487

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  488  YTPVYRNYR  496



>ref|XP_007204215.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
 gb|EMJ05414.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
Length=496

 Score =   317 bits (812),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  308  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTW  367

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLAASE+
Sbjct  368  SKGRAIFASGSPFDPVEYNGKVYVPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLAASES  427

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA EVT+E F+KGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLP+PENLV YAESCM
Sbjct  428  LAGEVTEEYFEKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPENLVKYAESCM  487

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  488  YSPVYRNYR  496



>ref|XP_010665912.1| PREDICTED: NADP-dependent malic enzyme [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   321 bits (823),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVKA+KPTVLIGSSG GRTFTKDVI AMA+FNE+P++L+LSNPTSQSECTAEEAYTW
Sbjct  453  LLNAVKALKPTVLIGSSGVGRTFTKDVIEAMATFNERPVILSLSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+T  SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  513  SKGRAIFASGSPFDPIEYEGKTFTSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E+F KGL+YPPF NIRKISAHIAA VAAKAYELGLATR+PQPENL+ YAESCM
Sbjct  573  LAAQVTEEHFAKGLLYPPFKNIRKISAHIAASVAAKAYELGLATRMPQPENLMKYAESCM  632

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  633  YSPAYRSYR  641



>ref|XP_006853670.1| hypothetical protein AMTR_s00056p00119870 [Amborella trichopoda]
 gb|ERN15137.1| hypothetical protein AMTR_s00056p00119870 [Amborella trichopoda]
Length=652

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK+IKPT+LIGSSGAG+TFTK+VI AMASFNEKP++LALSNPTSQSECTAEEAY W
Sbjct  464  LLEAVKSIKPTILIGSSGAGKTFTKEVIEAMASFNEKPVILALSNPTSQSECTAEEAYKW  523

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+T  SGQANNAYIFPG GLGLIISGAIRVHDDMLLAASEA
Sbjct  524  SQGRAIFASGSPFDPIEYNGKTYYSGQANNAYIFPGLGLGLIISGAIRVHDDMLLAASEA  583

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQEN+D GL+YPPFSNIRKISAHIAA VA KAYELGLATRLP+PENLVAYAESCM
Sbjct  584  LAKQVTQENYDMGLLYPPFSNIRKISAHIAANVATKAYELGLATRLPRPENLVAYAESCM  643

Query  216  YSPTYRSYR  190
            YSP YRS+R
Sbjct  644  YSPVYRSFR  652



>ref|XP_006343041.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Solanum 
tuberosum]
Length=642

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK IKPTVLIGSSG G+TFTK+V+ AMA+FN+KP++ ALSNPTSQSECTAEEAYTW
Sbjct  454  LVNAVKLIKPTVLIGSSGTGKTFTKEVVQAMATFNKKPVIFALSNPTSQSECTAEEAYTW  513

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+  +SGQ NNAYIFPG GLGLIISGAIRVHDDMLLAASEA
Sbjct  514  SEGRAIFASGSPFAPVEYKGKVFVSGQGNNAYIFPGLGLGLIISGAIRVHDDMLLAASEA  573

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAAEV+QEN +KGLIYPPF+NIRKISAHIAA+VAAKAYELGLATRLPQPENLV YAESCM
Sbjct  574  LAAEVSQENLEKGLIYPPFANIRKISAHIAAKVAAKAYELGLATRLPQPENLVTYAESCM  633

Query  216  YSPTYRSYR  190
            YSP+YRSYR
Sbjct  634  YSPSYRSYR  642



>gb|ABI98682.2| chloroplast NADP-malic enzyme precursor [Nicotiana tabacum]
Length=642

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIGSSGAGRTFTK+V+ AMA+FNEKPI+ ALSNPTSQSECTAEEAY+W
Sbjct  454  LVNAVKSIKPTVLIGSSGAGRTFTKEVVQAMATFNEKPIIFALSNPTSQSECTAEEAYSW  513

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  514  SEGRAIFASGSPFAPVEYNGKIYASGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  573

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QENF+KGLIYPPF+NIRKISA+IAA+VAAKAYELGLATRLP+P NLVAYAESCM
Sbjct  574  LAEQVSQENFEKGLIYPPFTNIRKISANIAAKVAAKAYELGLATRLPEPANLVAYAESCM  633

Query  216  YSPTYRSYR  190
            Y P YRSYR
Sbjct  634  YRPAYRSYR  642



>emb|CDO97978.1| unnamed protein product [Coffea canephora]
Length=651

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIGSSGAGRTFTK+V+ AMA+FNEKP+VLALSNPTSQSECTAEEAY W
Sbjct  463  LVDAVKAIKPTVLIGSSGAGRTFTKEVVEAMATFNEKPVVLALSNPTSQSECTAEEAYMW  522

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPG GLGLIISGAIRVHDDMLLAASEA
Sbjct  523  SEGRAIFASGSPFDPVEYDGKVYASGQANNAYIFPGLGLGLIISGAIRVHDDMLLAASEA  582

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+EN + GLIYPPFSNIRKISA IAA VAAKAYELGLATRLPQPENLVAYAESCM
Sbjct  583  LAAQVTEENLESGLIYPPFSNIRKISAKIAADVAAKAYELGLATRLPQPENLVAYAESCM  642

Query  216  YSPTYRSYR  190
            YSP YR YR
Sbjct  643  YSPAYRCYR  651



>ref|XP_002516526.1| malic enzyme, putative [Ricinus communis]
 gb|EEF45867.1| malic enzyme, putative [Ricinus communis]
Length=588

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKA+KPTVLIGSSG G+TFTK+V+ AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  400  LLDAVKALKPTVLIGSSGVGKTFTKEVVQAMASFNEKPLILALSNPTSQSECTAEEAYTW  459

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAI+ASGSPF P EY G+  +SGQANNAYIFPGFGLGLI+SGAIRVH+DMLLAASEA
Sbjct  460  SEGRAIYASGSPFDPVEYNGKVFVSGQANNAYIFPGFGLGLIMSGAIRVHEDMLLAASEA  519

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V QE+FDKGLIYPPFSNIRKISAHIAA+VAAKAYELGLA+RLP+P++LV +AESCM
Sbjct  520  LAEQVKQEHFDKGLIYPPFSNIRKISAHIAAKVAAKAYELGLASRLPRPKDLVQHAESCM  579

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  580  YSPIYRSYR  588



>gb|KDO66535.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=559

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPT+LIGSSG GRTFTK+VI AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  371  LLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEKPLILALSNPTSQSECTAEEAYTW  430

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  431  SKGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  490

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P+NLV  AESCM
Sbjct  491  LAKQVTEENFEKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPQNLVKCAESCM  550

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  551  YTPVYRNYR  559



>emb|CBI28009.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   318 bits (815),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVK IKPTVLIGSSG G+ FTK+VI AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  403  LLHAVKVIKPTVLIGSSGVGKAFTKEVIEAMASCNEKPLILALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY G+T + GQANNAYIFPG G+GL+ISGAIRVHD+MLLAASEA
Sbjct  463  TQGRAIFASGSPFDPVEYNGKTFVPGQANNAYIFPGLGMGLVISGAIRVHDEMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLPQPENLV YAESCM
Sbjct  523  LARQVTQENFDKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPQPENLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  583  YSPVYRSYR  591



>gb|KDP33810.1| hypothetical protein JCGZ_07381 [Jatropha curcas]
Length=589

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+V+ AMAS NEKP+++ALSNPTSQSECTAEEAYTW
Sbjct  401  LLDAVKAIKPTVLIGSSGVGRTFTKEVVEAMASLNEKPVIMALSNPTSQSECTAEEAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+    GQANNAYIFPGFGLGL+ISGAIRVHD+MLLAASEA
Sbjct  461  SKGKAIFASGSPFDPVEYEGKIFAPGQANNAYIFPGFGLGLVISGAIRVHDEMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+EN+ KGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLP+PENLV YAESCM
Sbjct  521  LAGQVTEENYSKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPENLVKYAESCM  580

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  581  YSPVYRSYR  589



>ref|XP_011072428.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Sesamum 
indicum]
Length=648

 Score =   319 bits (818),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAI+PTVLIGSSGAGRTFTK+V+ AMAS+NEKP++LALSNPTSQSECTAEEAY W
Sbjct  460  LLDAVKAIRPTVLIGSSGAGRTFTKEVVEAMASYNEKPVILALSNPTSQSECTAEEAYKW  519

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  520  SQGRAIFASGSPFAPVEYNGKLYASGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  579

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QEN + GLIYPPF+NIRKISAHIAARVAAKAYELGLATRLPQP NLV YAESCM
Sbjct  580  LATQVSQENLNNGLIYPPFANIRKISAHIAARVAAKAYELGLATRLPQPRNLVEYAESCM  639

Query  216  YSPTYRSYR  190
            YSP Y +YR
Sbjct  640  YSPNYHNYR  648



>gb|KDO66537.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=585

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPT+LIGSSG GRTFTK+VI AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  397  LLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEKPLILALSNPTSQSECTAEEAYTW  456

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  457  SKGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  516

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P+NLV  AESCM
Sbjct  517  LAKQVTEENFEKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPQNLVKCAESCM  576

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  577  YTPVYRNYR  585



>ref|XP_004235645.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=642

 Score =   319 bits (817),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK IKPTVLIGSSG G+TFTK+V+ AM++FN+KPI+ ALSNPTSQSECTAEEAYTW
Sbjct  454  LVNAVKLIKPTVLIGSSGTGKTFTKEVVQAMSTFNKKPIIFALSNPTSQSECTAEEAYTW  513

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+  +SGQ NNAYIFPG GLGLIISGAIRVHDDMLLAASEA
Sbjct  514  SEGRAIFASGSPFTPVEYKGKVFVSGQGNNAYIFPGLGLGLIISGAIRVHDDMLLAASEA  573

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAAEV++EN +KGLIYPPF+NIRKISAHIAA+VAAKAYELGLATRLPQP+NLVAYAESCM
Sbjct  574  LAAEVSRENLEKGLIYPPFANIRKISAHIAAKVAAKAYELGLATRLPQPDNLVAYAESCM  633

Query  216  YSPTYRSYR  190
            YSP+YRSYR
Sbjct  634  YSPSYRSYR  642



>gb|KCW69675.1| hypothetical protein EUGRSUZ_F03074 [Eucalyptus grandis]
Length=496

 Score =   314 bits (805),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK IKPTVLIG+SG G TFT+DV+ AMA+ NEKPI+LALSNPTSQSECTAEEAY W
Sbjct  308  LVDAVKVIKPTVLIGTSGVGSTFTEDVVEAMAALNEKPIILALSNPTSQSECTAEEAYKW  367

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EYKG+TL+ GQANNAYIFPG GLGLI+SGAIRVH+DMLLAASEA
Sbjct  368  SQGRAIFASGSPFAPVEYKGKTLVPGQANNAYIFPGLGLGLIMSGAIRVHNDMLLAASEA  427

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+ENFDKGLIYPPF++IRKISA IAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  428  LAAQVTRENFDKGLIYPPFTDIRKISAQIAADVAAKAYELGLATRLPQPKDLVKYAESCM  487

Query  216  YSPTYRSYR  190
            YSPTYRSYR
Sbjct  488  YSPTYRSYR  496



>gb|KDO66536.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=590

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPT+LIGSSG GRTFTK+VI AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  402  LLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEKPLILALSNPTSQSECTAEEAYTW  461

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  462  SKGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  521

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P+NLV  AESCM
Sbjct  522  LAKQVTEENFEKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPQNLVKCAESCM  581

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  582  YTPVYRNYR  590



>ref|XP_002514230.1| malic enzyme, putative [Ricinus communis]
 gb|EEF48184.1| malic enzyme, putative [Ricinus communis]
Length=591

 Score =   317 bits (813),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI AMAS NEKP++L+LSNPTSQSECTAEEAYTW
Sbjct  403  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAMASLNEKPLILSLSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++G+A FASGSPF P EY+G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  463  TKGKATFASGSPFDPVEYEGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++VT+ENF KGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLP+PENL+ YAESCM
Sbjct  523  LASQVTEENFSKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPENLMKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  583  YSPVYRNYR  591



>ref|XP_006451273.1| hypothetical protein CICLE_v10007810mg [Citrus clementina]
 ref|XP_006475558.1| PREDICTED: NADP-dependent malic enzyme-like [Citrus sinensis]
 gb|ESR64513.1| hypothetical protein CICLE_v10007810mg [Citrus clementina]
 gb|KDO66533.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
 gb|KDO66534.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=591

 Score =   317 bits (812),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPT+LIGSSG GRTFTK+VI AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  403  LLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEKPLILALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  463  SKGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P+NLV  AESCM
Sbjct  523  LAKQVTEENFEKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPQNLVKCAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  583  YTPVYRNYR  591



>gb|ABS32242.1| NADP-malic enzyme [Flaveria floridana]
Length=604

 Score =   317 bits (813),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DA+K IKPTVLIGSSG G+TFTK+V+  M+S NEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  416  FLDAIKTIKPTVLIGSSGTGQTFTKEVVETMSSLNEKPIILALSNPTSQSECTAEQAYTW  475

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  +SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  476  SEGRAIFASGSPFKPVEYNGKLYVSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  535

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FDKGLI+PPF++IRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  536  LAEQVTQEHFDKGLIFPPFTSIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  595

Query  216  YSPTYRSYR  190
            YSP YR YR
Sbjct  596  YSPKYRIYR  604



>ref|XP_009380466.1| PREDICTED: NADP-dependent malic enzyme [Musa acuminata subsp. 
malaccensis]
Length=585

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTKDV+ AMASFNEKP++LALSNPT+QSECTAEEAYTW
Sbjct  397  LLDAVKAIKPTVLIGTSGVGKTFTKDVVEAMASFNEKPVILALSNPTTQSECTAEEAYTW  456

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGL+ISGAIRVHD+MLLAASEA
Sbjct  457  SKGCAIFASGSPFDPVEYEGKIFVPGQANNAYIFPGFGLGLVISGAIRVHDEMLLAASEA  516

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPF NIRKISAHIAA VAAK YELGLATRLP+P+NLV YAESCM
Sbjct  517  LAQQVTQENFDKGLIYPPFKNIRKISAHIAANVAAKVYELGLATRLPRPDNLVKYAESCM  576

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  577  YTPAYRNYR  585



>ref|XP_004173538.1| PREDICTED: NADP-dependent malic enzyme-like, partial [Cucumis 
sativus]
Length=376

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIGSSG GRTFTK+V+ A++S NEKP+++ALSNPTSQSECTAEEAYTW
Sbjct  188  LLSAVKAIKPTVLIGSSGVGRTFTKEVVEAVSSINEKPLIMALSNPTSQSECTAEEAYTW  247

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEY G+T + GQ+NNAYIFPGFGLG++ISGAIRVHDDMLLAASEA
Sbjct  248  SEGRAIFASGSPFDPFEYNGKTFVPGQSNNAYIFPGFGLGVVISGAIRVHDDMLLAASEA  307

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V++EN+DKGLIYPPF+NIRKISA+IAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  308  LAAQVSEENYDKGLIYPPFTNIRKISANIAANVAAKAYELGLATRLPRPADLVKYAESCM  367

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  368  YSPVYRTYR  376



>ref|XP_010915369.1| PREDICTED: NADP-dependent malic enzyme isoform X3 [Elaeis guineensis]
Length=496

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AM SFNEKP++LALSNPTSQSECTAEEAY W
Sbjct  308  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMTSFNEKPLILALSNPTSQSECTAEEAYRW  367

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P E+ G+  + GQANNAYIFPG GLGL+ISGAIRVHDDMLLAASEA
Sbjct  368  SKGRAIFASGSPFDPVEFNGKVFVPGQANNAYIFPGLGLGLVISGAIRVHDDMLLAASEA  427

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQEN DKGLIYPPFSNIRKISAHIAA VAA AYELGLATRLP+P+NLV YAESCM
Sbjct  428  LAQQVTQENLDKGLIYPPFSNIRKISAHIAANVAATAYELGLATRLPRPQNLVKYAESCM  487

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  488  YSPIYRNYR  496



>ref|XP_007204217.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
 gb|EMJ05416.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
Length=592

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  404  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTW  463

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLAASE+
Sbjct  464  SKGRAIFASGSPFDPVEYNGKVYVPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLAASES  523

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA EVT+E F+KGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLP+PENLV YAESCM
Sbjct  524  LAGEVTEEYFEKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPENLVKYAESCM  583

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  584  YSPVYRNYR  592



>ref|XP_007204218.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
 gb|EMJ05417.1| hypothetical protein PRUPE_ppa003142mg [Prunus persica]
Length=599

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  411  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTW  470

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLAASE+
Sbjct  471  SKGRAIFASGSPFDPVEYNGKVYVPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLAASES  530

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA EVT+E F+KGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLP+PENLV YAESCM
Sbjct  531  LAGEVTEEYFEKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPENLVKYAESCM  590

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  591  YSPVYRNYR  599



>ref|XP_011080458.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
Length=650

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAGRTFTK+V+ AM  FN+KP++LALSNPTSQSECTAEEAYTW
Sbjct  462  LLDAVKAIKPTVLIGSSGAGRTFTKEVVQAMTYFNKKPVILALSNPTSQSECTAEEAYTW  521

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G    SGQANNAYIFPG GLGLIISGAIRVHDDMLLAASEA
Sbjct  522  SEGRAIFASGSPFSPVEYNGTFYASGQANNAYIFPGLGLGLIISGAIRVHDDMLLAASEA  581

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN DKGLIYPPF+NIRKISA IAA+VAAKAYELGLATRLPQPENLVA+AESCM
Sbjct  582  LAAQVSQENLDKGLIYPPFANIRKISAQIAAKVAAKAYELGLATRLPQPENLVAHAESCM  641

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  642  YSPNYRNYR  650



>gb|ABS32243.1| NADP-malic enzyme [Flaveria trinervia]
Length=612

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DA+K I+PTVLIGSSG G+TFTK+V+  M+S NEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  424  FLDAIKTIRPTVLIGSSGTGQTFTKEVVETMSSLNEKPIILALSNPTSQSECTAEQAYTW  483

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  +SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  484  SEGRAIFASGSPFKPVEYNGKLYVSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  543

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FDKGLI+PPF++IRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  544  LAEQVTQEHFDKGLIFPPFTSIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  603

Query  216  YSPTYRSYR  190
            YSP YR YR
Sbjct  604  YSPKYRIYR  612



>ref|XP_008791442.1| PREDICTED: NADP-dependent malic enzyme-like [Phoenix dactylifera]
Length=637

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AV+AIKPTVLIG+SG GRTFTKDV+ AMASFN++PI+L+LSNPTSQSECTAEEAYTW
Sbjct  449  LLGAVQAIKPTVLIGTSGVGRTFTKDVVEAMASFNKRPIILSLSNPTSQSECTAEEAYTW  508

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  509  SKGRAIFASGSPFDPVEYEGKIFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  568

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPF+NIRKISA IAA VAAKAYELGLA+RLP+PENLV YAESCM
Sbjct  569  LAQQVTQENFDKGLIYPPFTNIRKISAKIAANVAAKAYELGLASRLPRPENLVKYAESCM  628

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  629  YSPHYRSYR  637



>ref|XP_011016530.1| PREDICTED: NADP-dependent malic enzyme-like [Populus euphratica]
Length=496

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG G+TFTK+VI AMASFNEKPI+L+LSNPTSQSECTAEEAYTW
Sbjct  308  LLDAVNDIKPTVLIGTSGVGKTFTKEVIEAMASFNEKPIILSLSNPTSQSECTAEEAYTW  367

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY+G+T + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASEA
Sbjct  368  SQGRAIFASGSPFAPFEYEGKTFMPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASEA  427

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFD+GLIYPPF NIRKISA IAA+VAAKAYELGLATR+P P +LV +AESCM
Sbjct  428  LAAQVTQENFDQGLIYPPFKNIRKISAEIAAKVAAKAYELGLATRVPPPRDLVKHAESCM  487

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  488  YSPAYRSYR  496



>ref|XP_008794109.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Phoenix 
dactylifera]
Length=595

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AV+ IKPT+LIG+SG GRTFTKDV+ AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  407  LLGAVQVIKPTILIGTSGVGRTFTKDVVEAMASFNEKPIILALSNPTSQSECTAEEAYTW  466

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+T + GQANNAYIFPGFGLGL+ISGAIRVHDD+LLAASEA
Sbjct  467  SKGRAIFASGSPFDPVEYEGKTFVPGQANNAYIFPGFGLGLVISGAIRVHDDLLLAASEA  526

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPF+NIRKISA IA+ VAAKAYELGLA+RLP+PENLV YAESCM
Sbjct  527  LAQQVTQENFDKGLIYPPFTNIRKISAKIASNVAAKAYELGLASRLPRPENLVKYAESCM  586

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  587  YTPLYRSYR  595



>gb|KCW53676.1| hypothetical protein EUGRSUZ_J02940 [Eucalyptus grandis]
Length=644

 Score =   317 bits (812),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK+IKPTVLIG+SG GRTFTK+V+ AMA+ N+KPI+L+LSNPTSQSECTAEEAY W
Sbjct  456  LVDAVKSIKPTVLIGTSGVGRTFTKEVVEAMAAINQKPIILSLSNPTSQSECTAEEAYAW  515

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY G+  + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASE 
Sbjct  516  SQGRAIFASGSPFPPVEYGGKVYVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASET  575

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAAEVTQEN+DKGLIYPPF+NIR ISAHIAA VAAKAYELGLATRLPQPE+LV YAESCM
Sbjct  576  LAAEVTQENYDKGLIYPPFANIRNISAHIAANVAAKAYELGLATRLPQPEDLVKYAESCM  635

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  636  YSPAYRNYR  644



>ref|XP_008794110.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Phoenix 
dactylifera]
Length=586

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AV+ IKPT+LIG+SG GRTFTKDV+ AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  398  LLGAVQVIKPTILIGTSGVGRTFTKDVVEAMASFNEKPIILALSNPTSQSECTAEEAYTW  457

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+T + GQANNAYIFPGFGLGL+ISGAIRVHDD+LLAASEA
Sbjct  458  SKGRAIFASGSPFDPVEYEGKTFVPGQANNAYIFPGFGLGLVISGAIRVHDDLLLAASEA  517

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPF+NIRKISA IA+ VAAKAYELGLA+RLP+PENLV YAESCM
Sbjct  518  LAQQVTQENFDKGLIYPPFTNIRKISAKIASNVAAKAYELGLASRLPRPENLVKYAESCM  577

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  578  YTPLYRSYR  586



>gb|AIR93779.1| chloroplast NADP-malic enzyme [Kalanchoe fedtschenkoi]
Length=658

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV+ IKPTVLIGSSGAGRTFT+DV+ AMAS NE+P++LALSNPTSQSECTAE+AYTW
Sbjct  470  LIDAVQDIKPTVLIGSSGAGRTFTQDVVEAMASINERPVILALSNPTSQSECTAEQAYTW  529

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P +Y+G+T + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAAS A
Sbjct  530  SQGRAIFASGSPFDPVKYEGKTFIPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASSA  589

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENF++GLIYPPF+NIRKISA+IAARVAAKAYELGLA+RLPQP++LV YAESCM
Sbjct  590  LAEQVTQENFERGLIYPPFTNIRKISANIAARVAAKAYELGLASRLPQPQDLVKYAESCM  649

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  650  YSPVYRNYR  658



>ref|XP_010098139.1| NADP-dependent malic enzyme [Morus notabilis]
 gb|EXB74576.1| NADP-dependent malic enzyme [Morus notabilis]
Length=621

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDA+ AIKPTVLIG+SG GR F K+VI AM++ NEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  433  LVDAINAIKPTVLIGTSGVGRQFNKEVIEAMSTINEKPIILALSNPTSQSECTAEEAYTW  492

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY+G+  + GQANNAYIFPGFGLGL++SG IRVHD+MLLAASEA
Sbjct  493  SQGRAIFASGSPFPPVEYEGKVFVPGQANNAYIFPGFGLGLLMSGTIRVHDEMLLAASEA  552

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QENFDKGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  553  LAAQVSQENFDKGLIYPPFANIRKISAHIAANVAAKAYELGLATRLPQPKDLVKYAESCM  612

Query  216  YSPTYRSYR  190
            YSP+YRSYR
Sbjct  613  YSPSYRSYR  621



>ref|XP_010033838.1| PREDICTED: NADP-dependent malic enzyme [Eucalyptus grandis]
 gb|KCW53677.1| hypothetical protein EUGRSUZ_J02940 [Eucalyptus grandis]
Length=649

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK+IKPTVLIG+SG GRTFTK+V+ AMA+ N+KPI+L+LSNPTSQSECTAEEAY W
Sbjct  461  LVDAVKSIKPTVLIGTSGVGRTFTKEVVEAMAAINQKPIILSLSNPTSQSECTAEEAYAW  520

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY G+  + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASE 
Sbjct  521  SQGRAIFASGSPFPPVEYGGKVYVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASET  580

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAAEVTQEN+DKGLIYPPF+NIR ISAHIAA VAAKAYELGLATRLPQPE+LV YAESCM
Sbjct  581  LAAEVTQENYDKGLIYPPFANIRNISAHIAANVAAKAYELGLATRLPQPEDLVKYAESCM  640

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  641  YSPAYRNYR  649



>emb|CBI20568.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK+IKPTVLIGSSG G+TFTK+V+ AM SFN+KP++LALSNPTSQSECTAEEAYTW
Sbjct  387  LLDAVKSIKPTVLIGSSGVGKTFTKEVVEAMTSFNKKPLILALSNPTSQSECTAEEAYTW  446

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  447  SKGRAIFASGSPFDPVEYNGKLFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  506

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQEN+DKGLIYPPF NIRKISAHIAA VAAKAY+LGLA+RLP+PE+LV YAESCM
Sbjct  507  LAAQVTQENYDKGLIYPPFCNIRKISAHIAANVAAKAYQLGLASRLPRPEHLVKYAESCM  566

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  567  YSPVYRSYR  575



>gb|ABR25947.1| NADP-dependent malic enzyme [Oryza sativa Indica Group]
Length=194

 Score =   301 bits (772),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG G+TFT++V+ A++SFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  6    LLDAVKTIKPTVLIGTSGKGQTFTQEVVEAISSFNERPVIFALSNPTSQSECTAEQAYTW  65

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FASGSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  66   SKGRAVFASGSPFDPVEYDGKIYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  125

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL YPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  126  LAQQVTQENFDKGLTYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  185

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  186  YSPLYRNYR  194



>gb|EPS64484.1| malic enzyme, partial [Genlisea aurea]
Length=390

 Score =   308 bits (790),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAI+PTVLIGSSGAGRTF+K+V+ AM SFNE P++LALSNPTSQSECTAEEAY W
Sbjct  202  LLDAVKAIRPTVLIGSSGAGRTFSKEVVEAMTSFNETPVILALSNPTSQSECTAEEAYKW  261

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVHDDMLL+ASEA
Sbjct  262  SEGRAIFASGSPFSPVEYNGKLYTSGQANNAYIFPGFGLGLIISGAIRVHDDMLLSASEA  321

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+ EN +KGLIYPPFSNIRKISA IAARVAAKAYELGLA  LPQP NLVAYAE  M
Sbjct  322  LADQVSHENLEKGLIYPPFSNIRKISAEIAARVAAKAYELGLAMNLPQPSNLVAYAEKYM  381

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  382  YSPNYRSYR  390



>ref|XP_003631773.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Vitis vinifera]
 ref|XP_010648279.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Vitis vinifera]
Length=585

 Score =   315 bits (806),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK+IKPTVLIGSSG G+TFTK+V+ AM SFN+KP++LALSNPTSQSECTAEEAYTW
Sbjct  397  LLDAVKSIKPTVLIGSSGVGKTFTKEVVEAMTSFNKKPLILALSNPTSQSECTAEEAYTW  456

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  457  SKGRAIFASGSPFDPVEYNGKLFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  516

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQEN+DKGLIYPPF NIRKISAHIAA VAAKAY+LGLA+RLP+PE+LV YAESCM
Sbjct  517  LAAQVTQENYDKGLIYPPFCNIRKISAHIAANVAAKAYQLGLASRLPRPEHLVKYAESCM  576

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  577  YSPVYRSYR  585



>sp|P22178.1|MAOC_FLATR RecName: Full=NADP-dependent malic enzyme, chloroplastic; Short=NADP-ME; 
Flags: Precursor [Flaveria trinervia]
 emb|CAA40421.1| NADP-dependent malic enzyme [Flaveria trinervia]
Length=648

 Score =   316 bits (810),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DA+K I+PTVLIGSSG G+TFTK+V+  M+S NEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  460  FLDAIKTIRPTVLIGSSGTGQTFTKEVVETMSSLNEKPIILALSNPTSQSECTAEQAYTW  519

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  +SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  520  SEGRAIFASGSPFKPVEYNGKLYVSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  579

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
             A +VTQE+FDKGLI+PPF++IRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  580  PAEQVTQEHFDKGLIFPPFTSIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  639

Query  216  YSPTYRSYR  190
            YSP YR YR
Sbjct  640  YSPKYRIYR  648



>prf||1701292A NADP dependent malic enzyme
Length=648

 Score =   316 bits (810),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DA+K I+PTVLIGSSG G+TFTK+V+  M+S NEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  460  FLDAIKTIRPTVLIGSSGTGQTFTKEVVETMSSLNEKPIILALSNPTSQSECTAEQAYTW  519

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  +SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  520  SEGRAIFASGSPFKPVEYNGKLYVSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  579

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
             A +VTQE+FDKGLI+PPF++IRKISAHIAA+VAAKAYELGLA+RLPQPENLVAYAESCM
Sbjct  580  PAEQVTQEHFDKGLIFPPFTSIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCM  639

Query  216  YSPTYRSYR  190
            YSP YR YR
Sbjct  640  YSPKYRIYR  648



>ref|XP_002515967.1| malic enzyme, putative [Ricinus communis]
 gb|EEF46387.1| malic enzyme, putative [Ricinus communis]
Length=641

 Score =   316 bits (809),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG GRTFTK+V+ AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LLDAVNDIKPTVLIGTSGVGRTFTKEVVEAMASFNEKPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  SQGRAIFASGSPFAPVEYEGKVYVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF+NIRKISA+IAA VAAKAYELGLA+RLPQP++LV YAESCM
Sbjct  573  LAAQVTQENFDKGLIYPPFTNIRKISANIAANVAAKAYELGLASRLPQPKDLVKYAESCM  632

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  633  YSPAYRSYR  641



>gb|AAF73006.1|AF262997_1 NADP-dependent malic protein [Ricinus communis]
Length=641

 Score =   316 bits (809),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG GRTFTK+V+ AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LLDAVNDIKPTVLIGTSGVGRTFTKEVVEAMASFNEKPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  SQGRAIFASGSPFAPVEYEGKVYVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF+NIRKISA+IAA VAAKAYELGLA+RLPQP++LV YAESCM
Sbjct  573  LAAQVTQENFDKGLIYPPFTNIRKISANIAANVAAKAYELGLASRLPQPKDLVKYAESCM  632

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  633  YSPAYRSYR  641



>ref|XP_008794107.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794108.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Phoenix 
dactylifera]
Length=623

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AV+ IKPT+LIG+SG GRTFTKDV+ AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  435  LLGAVQVIKPTILIGTSGVGRTFTKDVVEAMASFNEKPIILALSNPTSQSECTAEEAYTW  494

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+T + GQANNAYIFPGFGLGL+ISGAIRVHDD+LLAASEA
Sbjct  495  SKGRAIFASGSPFDPVEYEGKTFVPGQANNAYIFPGFGLGLVISGAIRVHDDLLLAASEA  554

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPF+NIRKISA IA+ VAAKAYELGLA+RLP+PENLV YAESCM
Sbjct  555  LAQQVTQENFDKGLIYPPFTNIRKISAKIASNVAAKAYELGLASRLPRPENLVKYAESCM  614

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  615  YTPLYRSYR  623



>gb|AAT02535.1| NADP-dependent malic enzyme 3 [Hydrilla verticillata]
Length=575

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK IKPTVL+GSSG GR FTK+VI AMASFNEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  387  LVDAVKTIKPTVLVGSSGVGRAFTKEVIEAMASFNEKPIILALSNPTSQSECTAEEAYTW  446

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY+G+T + GQANNAYIFPGFGLGLII+GAIRVHDDML+AASEA
Sbjct  447  TQGRAIFASGSPFDPVEYEGKTFVPGQANNAYIFPGFGLGLIIAGAIRVHDDMLIAASEA  506

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++ENF+KGLIYPPFSNIRKISA+IAA VAAKAYELGLA+ LP+P NLV YAESCM
Sbjct  507  LANQVSEENFEKGLIYPPFSNIRKISANIAANVAAKAYELGLASHLPRPANLVKYAESCM  566

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  567  YSPVYRTYR  575



>ref|XP_009387625.1| PREDICTED: NADP-dependent malic enzyme [Musa acuminata subsp. 
malaccensis]
Length=590

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPT LIGSSG G+TFTK+V+ AMASFNEKPI+LALSNPTSQSECTA EAY W
Sbjct  402  LLDAVKAIKPTALIGSSGVGKTFTKEVVEAMASFNEKPIILALSNPTSQSECTAAEAYNW  461

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY G+T + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  462  SKGQAIFASGSPFDPVEYNGKTFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  521

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT ENFDKGLIYPPFSNIR ISAHIAA VAAKAY+LGLATRLP+P+NLV YAESCM
Sbjct  522  LANQVTPENFDKGLIYPPFSNIRTISAHIAANVAAKAYDLGLATRLPRPQNLVKYAESCM  581

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  582  YTPVYRSYR  590



>ref|XP_010648278.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Vitis vinifera]
Length=619

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK+IKPTVLIGSSG G+TFTK+V+ AM SFN+KP++LALSNPTSQSECTAEEAYTW
Sbjct  431  LLDAVKSIKPTVLIGSSGVGKTFTKEVVEAMTSFNKKPLILALSNPTSQSECTAEEAYTW  490

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  491  SKGRAIFASGSPFDPVEYNGKLFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  550

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQEN+DKGLIYPPF NIRKISAHIAA VAAKAY+LGLA+RLP+PE+LV YAESCM
Sbjct  551  LAAQVTQENYDKGLIYPPFCNIRKISAHIAANVAAKAYQLGLASRLPRPEHLVKYAESCM  610

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  611  YSPVYRSYR  619



>ref|XP_010915394.1| PREDICTED: NADP-dependent malic enzyme-like [Elaeis guineensis]
Length=637

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AV+AIKPTVLIG+SG GRTFTKDV+ AM+SFNE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  449  LLGAVQAIKPTVLIGTSGVGRTFTKDVVEAMSSFNERPIILALSNPTSQSECTAEEAYTW  508

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  509  SKGRAIFASGSPFDPVEYAGKIFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  568

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPF+NIRKISA IAA VAAKAYELGLA+ LP+PENLV YAESCM
Sbjct  569  LAQQVTQENFDKGLIYPPFTNIRKISAKIAANVAAKAYELGLASHLPRPENLVKYAESCM  628

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  629  YSPNYRSYR  637



>ref|XP_010688309.1| PREDICTED: NADP-dependent malic enzyme [Beta vulgaris subsp. 
vulgaris]
Length=584

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPT+LIGSSG G+TFTK+VI AMASFNEKP+++ALSNPT+Q+ECTAEEAYTW
Sbjct  396  LISAVKAIKPTILIGSSGVGKTFTKEVIEAMASFNEKPLIMALSNPTTQAECTAEEAYTW  455

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+T + GQANNAYIFPGFGLGL+I+GAIRVH+DMLL ASEA
Sbjct  456  SKGRAIFASGSPFDPVEYEGKTFVPGQANNAYIFPGFGLGLVIAGAIRVHEDMLLTASEA  515

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQEN++KG+IYPPFSNIRKISAHIAA VAAKAY+LGLA+ LP+PENLV YAESCM
Sbjct  516  LAGQVTQENYEKGMIYPPFSNIRKISAHIAANVAAKAYDLGLASHLPRPENLVKYAESCM  575

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  576  YSPAYRSYR  584



>ref|XP_010915364.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Elaeis guineensis]
Length=592

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AM SFNEKP++LALSNPTSQSECTAEEAY W
Sbjct  404  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMTSFNEKPLILALSNPTSQSECTAEEAYRW  463

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P E+ G+  + GQANNAYIFPG GLGL+ISGAIRVHDDMLLAASEA
Sbjct  464  SKGRAIFASGSPFDPVEFNGKVFVPGQANNAYIFPGLGLGLVISGAIRVHDDMLLAASEA  523

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQEN DKGLIYPPFSNIRKISAHIAA VAA AYELGLATRLP+P+NLV YAESCM
Sbjct  524  LAQQVTQENLDKGLIYPPFSNIRKISAHIAANVAATAYELGLATRLPRPQNLVKYAESCM  583

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  584  YSPIYRNYR  592



>gb|KDP34170.1| hypothetical protein JCGZ_07741 [Jatropha curcas]
Length=576

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIG+SG G+TFTK+V+ AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  388  LLGAVKAIKPTVLIGTSGVGKTFTKEVVEAMASFNEKPVILALSNPTSQSECTAEEAYTW  447

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAI+ASGSPF P EY G+  + GQ+NNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  448  SEGRAIYASGSPFDPVEYNGKVFVPGQSNNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  507

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF+NIRKISAHIAA+VAAKAYELGLA+ LP+P++LV +AESCM
Sbjct  508  LAAQVTQENFDKGLIYPPFANIRKISAHIAAKVAAKAYELGLASHLPRPKDLVQHAESCM  567

Query  216  YSPTYRSYR  190
            YSP YR YR
Sbjct  568  YSPVYRCYR  576



>sp|P37222.1|MAOC_SOLLC RecName: Full=NADP-dependent malic enzyme, chloroplastic; Short=NADP-ME, 
partial [Solanum lycopersicum]
 gb|AAA34174.1| malate dehydrogenase, partial [Solanum lycopersicum]
Length=573

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIGSSGAGRTFTK+V+ AMA+FNEKPI+ ALSNPTSQSECTAEEAY+W
Sbjct  386  LVNAVKSIKPTVLIGSSGAGRTFTKEVVQAMATFNEKPIIFALSNPTSQSECTAEEAYSW  445

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGLIISGAIRVHDDMLL ASEA
Sbjct  446  SEGRAIFASGSPFAPVEYNGKVYASGQANNAYIFPGFGLGLIISGAIRVHDDMLLVASEA  505

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA EV+QENF+KG   PPFSNIRKISAHI A+VAAKAYELGLATRLPQP++LVAYAESCM
Sbjct  506  LADEVSQENFEKGTHIPPFSNIRKISAHI-AKVAAKAYELGLATRLPQPKDLVAYAESCM  564

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  565  YSPAYRSYR  573



>ref|XP_008462428.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
isoform X2 [Cucumis melo]
Length=568

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GRTFTKDV+ AMA+ NEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  380  LIDAVKDIKPTVLIGTSGVGRTFTKDVVEAMAAINEKPIILALSNPTSQSECTAEEAYTW  439

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRAIFASGSPF P EY+G   + GQANNAYIFPGFGLGLI+SG IRV DDMLLAASEA
Sbjct  440  TEGRAIFASGSPFDPVEYEGNVFVPGQANNAYIFPGFGLGLIMSGTIRVRDDMLLAASEA  499

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF+NIRKISA+IAA+VAAKAYELGLATRLPQPE+LV +AESCM
Sbjct  500  LAAQVTQENFDKGLIYPPFTNIRKISANIAAKVAAKAYELGLATRLPQPEDLVNHAESCM  559

Query  216  YSPTYRSYR  190
            Y+P+Y++YR
Sbjct  560  YNPSYQNYR  568



>gb|AAW56450.1| chloroplast NADP-dependent malic enzyme precursor [Flaveria bidentis]
Length=647

 Score =   314 bits (805),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             +DA+K IKPTVLIGSSG G+TFTK+V+  M+S NEKPI+LALSNPTSQSECTAE+AYTW
Sbjct  459  FLDAIKTIKPTVLIGSSGTGQTFTKEVVETMSSLNEKPIILALSNPTSQSECTAEQAYTW  518

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SE RAIFASGSPF P EY G+  +SGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA
Sbjct  519  SESRAIFASGSPFKPVEYNGKLYVSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEA  578

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FDKGLI+PPF++IRKISAHIAA+VAAKAYELGLA+RLPQPENLVAY ESCM
Sbjct  579  LAEQVTQEHFDKGLIFPPFTSIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYTESCM  638

Query  216  YSPTYRSYR  190
            YSP YR YR
Sbjct  639  YSPKYRIYR  647



>ref|XP_010915357.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Elaeis guineensis]
Length=640

 Score =   314 bits (805),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AM SFNEKP++LALSNPTSQSECTAEEAY W
Sbjct  452  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMTSFNEKPLILALSNPTSQSECTAEEAYRW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P E+ G+  + GQANNAYIFPG GLGL+ISGAIRVHDDMLLAASEA
Sbjct  512  SKGRAIFASGSPFDPVEFNGKVFVPGQANNAYIFPGLGLGLVISGAIRVHDDMLLAASEA  571

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQEN DKGLIYPPFSNIRKISAHIAA VAA AYELGLATRLP+P+NLV YAESCM
Sbjct  572  LAQQVTQENLDKGLIYPPFSNIRKISAHIAANVAATAYELGLATRLPRPQNLVKYAESCM  631

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  632  YSPIYRNYR  640



>gb|ABK94851.1| unknown [Populus trichocarpa]
Length=649

 Score =   314 bits (805),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG G+TFTK+VI AMASFNEKPI+L+LSNPTSQSECTAEEAYTW
Sbjct  461  LLDAVNDIKPTVLIGTSGVGKTFTKEVIEAMASFNEKPIILSLSNPTSQSECTAEEAYTW  520

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY+G+T + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASEA
Sbjct  521  SQGRAIFASGSPFAPFEYEGKTFMPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASEA  580

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF NIRKISA IAA+VAAKAYELGLATR+P P +LV +AESCM
Sbjct  581  LAAQVTQENFDKGLIYPPFKNIRKISAEIAAKVAAKAYELGLATRVPPPRDLVKHAESCM  640

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  641  YSPAYRSYR  649



>gb|KDO66532.1| hypothetical protein CISIN_1g007703mg [Citrus sinensis]
Length=592

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 176/190 (93%), Gaps = 1/190 (1%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNE-KPIVLALSNPTSQSECTAEEAYT  580
            L+DAVK IKPT+LIGSSG GRTFTK+VI AMASFNE KP++LALSNPTSQSECTAEEAYT
Sbjct  403  LLDAVKVIKPTILIGSSGVGRTFTKEVIEAMASFNEVKPLILALSNPTSQSECTAEEAYT  462

Query  579  WSEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaase  400
            WS+GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASE
Sbjct  463  WSKGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASE  522

Query  399  alaaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESC  220
            ALA +VT+ENF+KGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P+NLV  AESC
Sbjct  523  ALAKQVTEENFEKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPQNLVKCAESC  582

Query  219  MYSPTYRSYR  190
            MY+P YR+YR
Sbjct  583  MYTPVYRNYR  592



>gb|KDO51779.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=497

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPT+LIG+SG GRTFTK+V+ AMAS NEKPI+ +LSNPTSQSECTAEEAYTW
Sbjct  309  LVDAVNAIKPTILIGTSGQGRTFTKEVVEAMASLNEKPIIFSLSNPTSQSECTAEEAYTW  368

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY     + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAA+EA
Sbjct  369  SQGRAIFASGSPFDPFEYGDNVFVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAAAEA  428

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL+YPPF NIRKISAHIAA VAAKAYELGLATRLP P++LV YAESCM
Sbjct  429  LAGQVTQENFDKGLLYPPFKNIRKISAHIAAEVAAKAYELGLATRLPPPKDLVKYAESCM  488

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  489  YSPAYRTYR  497



>ref|XP_010062529.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Eucalyptus 
grandis]
 gb|KCW69673.1| hypothetical protein EUGRSUZ_F03074 [Eucalyptus grandis]
Length=650

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK IKPTVLIG+SG G TFT+DV+ AMA+ NEKPI+LALSNPTSQSECTAEEAY W
Sbjct  462  LVDAVKVIKPTVLIGTSGVGSTFTEDVVEAMAALNEKPIILALSNPTSQSECTAEEAYKW  521

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EYKG+TL+ GQANNAYIFPG GLGLI+SGAIRVH+DMLLAASEA
Sbjct  522  SQGRAIFASGSPFAPVEYKGKTLVPGQANNAYIFPGLGLGLIMSGAIRVHNDMLLAASEA  581

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+ENFDKGLIYPPF++IRKISA IAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  582  LAAQVTRENFDKGLIYPPFTDIRKISAQIAADVAAKAYELGLATRLPQPKDLVKYAESCM  641

Query  216  YSPTYRSYR  190
            YSPTYRSYR
Sbjct  642  YSPTYRSYR  650



>ref|XP_010062530.1| PREDICTED: NADP-dependent malic enzyme isoform X3 [Eucalyptus 
grandis]
 gb|KCW69674.1| hypothetical protein EUGRSUZ_F03074 [Eucalyptus grandis]
Length=649

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK IKPTVLIG+SG G TFT+DV+ AMA+ NEKPI+LALSNPTSQSECTAEEAY W
Sbjct  461  LVDAVKVIKPTVLIGTSGVGSTFTEDVVEAMAALNEKPIILALSNPTSQSECTAEEAYKW  520

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EYKG+TL+ GQANNAYIFPG GLGLI+SGAIRVH+DMLLAASEA
Sbjct  521  SQGRAIFASGSPFAPVEYKGKTLVPGQANNAYIFPGLGLGLIMSGAIRVHNDMLLAASEA  580

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+ENFDKGLIYPPF++IRKISA IAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  581  LAAQVTRENFDKGLIYPPFTDIRKISAQIAADVAAKAYELGLATRLPQPKDLVKYAESCM  640

Query  216  YSPTYRSYR  190
            YSPTYRSYR
Sbjct  641  YSPTYRSYR  649



>ref|XP_002298241.2| malate oxidoreductase family protein [Populus trichocarpa]
 gb|EEE83046.2| malate oxidoreductase family protein [Populus trichocarpa]
Length=649

 Score =   314 bits (804),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG G+TFTK+VI AMASFNEKPI+L+LSNPTSQSECTAEEAYTW
Sbjct  461  LLDAVNDIKPTVLIGTSGVGKTFTKEVIEAMASFNEKPIILSLSNPTSQSECTAEEAYTW  520

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY+G+T + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASEA
Sbjct  521  SQGRAIFASGSPFAPFEYEGKTFMPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASEA  580

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF NIRKISA IAA+VAAKAYELGLATR+P P +LV +AESCM
Sbjct  581  LAAQVTQENFDKGLIYPPFKNIRKISAEIAAKVAAKAYELGLATRVPPPRDLVKHAESCM  640

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  641  YSPAYRSYR  649



>ref|XP_010062528.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Eucalyptus 
grandis]
Length=652

 Score =   314 bits (804),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK IKPTVLIG+SG G TFT+DV+ AMA+ NEKPI+LALSNPTSQSECTAEEAY W
Sbjct  464  LVDAVKVIKPTVLIGTSGVGSTFTEDVVEAMAALNEKPIILALSNPTSQSECTAEEAYKW  523

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EYKG+TL+ GQANNAYIFPG GLGLI+SGAIRVH+DMLLAASEA
Sbjct  524  SQGRAIFASGSPFAPVEYKGKTLVPGQANNAYIFPGLGLGLIMSGAIRVHNDMLLAASEA  583

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+ENFDKGLIYPPF++IRKISA IAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  584  LAAQVTRENFDKGLIYPPFTDIRKISAQIAADVAAKAYELGLATRLPQPKDLVKYAESCM  643

Query  216  YSPTYRSYR  190
            YSPTYRSYR
Sbjct  644  YSPTYRSYR  652



>ref|XP_011002817.1| PREDICTED: NADP-dependent malic enzyme-like [Populus euphratica]
Length=569

 Score =   311 bits (798),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  381  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMASINEKPLILALSNPTSQSECTAEEAYTW  440

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY  R  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  441  SEGRAIFASGSPFDPVEYNSRVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  500

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V QEN DK LIYPPFSNIRKISA IAA+VAAKAYELGLA+RLP+P++LV YAESCM
Sbjct  501  LAEQVKQENLDKVLIYPPFSNIRKISADIAAKVAAKAYELGLASRLPRPKDLVKYAESCM  560

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  561  YSPLYRSYR  569



>ref|XP_009348545.1| PREDICTED: NADP-dependent malic enzyme-like [Pyrus x bretschneideri]
Length=641

 Score =   313 bits (803),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK+IKPTVLIG+SG GRTFTK+V+ AMAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LVDAVKSIKPTVLIGTSGVGRTFTKEVVEAMASLNERPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRA++ SGSPFPP EY G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TEGRAMYCSGSPFPPVEYNGKVYYPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+ VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P +L  YAESCM
Sbjct  573  LASMVTQEDFDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPRDLERYAESCM  632

Query  216  YSPTYRSYR  190
            YSP+YRS+R
Sbjct  633  YSPSYRSFR  641



>ref|XP_003546557.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Glycine max]
Length=643

 Score =   313 bits (803),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV  IKPTVLIG+SG GRTFTK+VI AMAS NE+PI+L+LSNPTSQSECTAEEAY W
Sbjct  455  LVDAVNKIKPTVLIGTSGQGRTFTKEVIEAMASINERPIILSLSNPTSQSECTAEEAYKW  514

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY+G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  515  SQGRAIFASGSPFPPVEYEGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  574

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QENFDKGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV +AESCM
Sbjct  575  LAAQVSQENFDKGLIYPPFTNIRKISAHIAANVAAKAYELGLATRLPQPKDLVKFAESCM  634

Query  216  YSPTYRSYR  190
            Y+P+YRSYR
Sbjct  635  YTPSYRSYR  643



>gb|ADU20198.1| NADP-dependent malic enzyme [Pyrus pyrifolia]
Length=641

 Score =   313 bits (803),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK+IKPTVLIG+SG GRTFTK+V+ AMAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LVDAVKSIKPTVLIGTSGVGRTFTKEVVEAMASLNERPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRA++ SGSPFPP EY G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TEGRAMYCSGSPFPPVEYNGKVYYPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+ VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P +L  YAESCM
Sbjct  573  LASMVTQEDFDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPRDLERYAESCM  632

Query  216  YSPTYRSYR  190
            YSP+YRS+R
Sbjct  633  YSPSYRSFR  641



>ref|XP_008242501.1| PREDICTED: NADP-dependent malic enzyme [Prunus mume]
Length=668

 Score =   314 bits (805),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  480  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTW  539

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGL+ISGAIRVH+DMLLAASE+
Sbjct  540  SKGRAIFASGSPFDPVEYNGKVYVPGQSNNAYIFPGFGLGLVISGAIRVHNDMLLAASES  599

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA EV++E F+KGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLP+PENLV YAESCM
Sbjct  600  LAGEVSEEYFEKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPENLVKYAESCM  659

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  660  YSPVYRNYR  668



>ref|XP_007018504.1| NADP-dependent malic enzyme [Theobroma cacao]
 gb|EOY15729.1| NADP-dependent malic enzyme [Theobroma cacao]
Length=591

 Score =   312 bits (799),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIGSSG GRTFTK++I  ++SFNEKP+++ALSNPTSQSECTAEEAYTW
Sbjct  403  LLGAVKAIKPTVLIGSSGVGRTFTKEIIETLSSFNEKPLIMALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  463  SRGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++EN+DKGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P NLV YAESCM
Sbjct  523  LAKQVSEENYDKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPANLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  583  YSPLYRTYR  591



>gb|KHM98720.1| NADP-dependent malic enzyme, chloroplastic [Glycine soja]
Length=643

 Score =   313 bits (803),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV  IKPTVLIG+SG GRTFTK+VI AMAS NE+PI+L+LSNPTSQSECTAEEAY W
Sbjct  455  LVDAVNKIKPTVLIGTSGQGRTFTKEVIEAMASINERPIILSLSNPTSQSECTAEEAYKW  514

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY+G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  515  SQGRAIFASGSPFPPVEYEGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  574

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QENFDKGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV +AESCM
Sbjct  575  LAAQVSQENFDKGLIYPPFTNIRKISAHIAANVAAKAYELGLATRLPQPKDLVKFAESCM  634

Query  216  YSPTYRSYR  190
            Y+P+YRSYR
Sbjct  635  YTPSYRSYR  643



>ref|XP_010925546.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Elaeis 
guineensis]
Length=623

 Score =   313 bits (801),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AV+AIKPT+LIG+SG GRTFTKDV+ AMASFN+KPI+LALSNPTSQSECTAEEAYTW
Sbjct  435  LLSAVQAIKPTILIGTSGVGRTFTKDVVEAMASFNQKPIILALSNPTSQSECTAEEAYTW  494

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  495  SKGRAIFASGSPFDPVEYEGKIFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  554

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FD+GLIYPPF+NIRKISA I+A VA+KAYELGLA+RLP+PENL+ YAESCM
Sbjct  555  LAQQVTQEHFDRGLIYPPFTNIRKISAKISANVASKAYELGLASRLPRPENLMKYAESCM  614

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  615  YTPLYRSYR  623



>gb|KJB07476.1| hypothetical protein B456_001G026200 [Gossypium raimondii]
Length=536

 Score =   310 bits (795),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG G+ FT++V+ AMAS NEKP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  348  LVDAVKAIKPTVLIGTSGVGKQFTREVVEAMASINEKPLIMALSNPTSQAECTAEEAYTW  407

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLG+I+SGAIRVHDDMLL ASEA
Sbjct  408  SEGRAIFASGSPFDPFEYDGKVFVPGQANNAYIFPGFGLGVIMSGAIRVHDDMLLTASEA  467

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E+F KGLIYPPFS+IRKISA+IAA+VAAKAYELGLA+ LPQPE+LV YAESCM
Sbjct  468  LAAQVTEEHFKKGLIYPPFSDIRKISANIAAKVAAKAYELGLASHLPQPEDLVKYAESCM  527

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  528  YSPVYRSYR  536



>ref|XP_003547744.1| PREDICTED: NADP-dependent malic enzyme-like [Glycine max]
Length=591

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVLIGSSG G+TFTK+VI A+ S NEKP+VLALSNPTSQSECTAEEAY W
Sbjct  403  LLEAVKVIKPTVLIGSSGVGKTFTKEVIEAVTSINEKPLVLALSNPTSQSECTAEEAYEW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  463  SEGRAIFASGSPFDPVEYKGKVYYSGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA  VT+EN++KGLIYPPFSNIRKISA+IAA VAAKAYELGLATRLP+P+NLV YAESCM
Sbjct  523  LAKLVTEENYEKGLIYPPFSNIRKISANIAASVAAKAYELGLATRLPRPQNLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  583  YTPVYRNYR  591



>ref|XP_002324789.2| hypothetical protein POPTR_0018s08250g [Populus trichocarpa]
 gb|EEF03354.2| hypothetical protein POPTR_0018s08250g [Populus trichocarpa]
Length=600

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  412  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMASINEKPLILALSNPTSQSECTAEEAYTW  471

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY  R  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  472  SEGRAIFASGSPFDPVEYNSRVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  531

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V QEN DK LIYPPFSNIRKISA+IAA+VAAKAYELGLA+RLP+P++LV YAESCM
Sbjct  532  LAEQVKQENLDKVLIYPPFSNIRKISANIAAKVAAKAYELGLASRLPRPKDLVKYAESCM  591

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  592  YSPLYRSYR  600



>gb|KDP40863.1| hypothetical protein JCGZ_24862 [Jatropha curcas]
Length=644

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG GRTFTK+V+ AMASF E+PI+LALSNPTSQSECTAEEAYTW
Sbjct  456  LLDAVNDIKPTVLIGTSGVGRTFTKEVVEAMASFYERPIILALSNPTSQSECTAEEAYTW  515

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFP  EY+G T + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  516  SQGRAIFASGSPFPAVEYEGNTHVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  575

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QENFD GLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  576  LAAQVSQENFDNGLIYPPFTNIRKISAHIAANVAAKAYELGLATRLPQPKDLVKYAESCM  635

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  636  YSPAYRSYR  644



>ref|XP_007216983.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
 gb|EMJ18182.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
Length=589

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPTVLIG+SGAGRTFTK+V+ +MAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  401  LVDAVNAIKPTVLIGTSGAGRTFTKEVVESMASLNERPIILALSNPTSQSECTAEEAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAI+ SGSPFPP EY+G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  461  TQGRAIYCSGSPFPPVEYEGKVYTPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QE++DKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P++L  YAESCM
Sbjct  521  LASQVSQEDYDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPKDLEKYAESCM  580

Query  216  YSPTYRSYR  190
            YSP+YRS+R
Sbjct  581  YSPSYRSFR  589



>ref|XP_010925545.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Elaeis 
guineensis]
Length=636

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AV+AIKPT+LIG+SG GRTFTKDV+ AMASFN+KPI+LALSNPTSQSECTAEEAYTW
Sbjct  448  LLSAVQAIKPTILIGTSGVGRTFTKDVVEAMASFNQKPIILALSNPTSQSECTAEEAYTW  507

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  508  SKGRAIFASGSPFDPVEYEGKIFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  567

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE+FD+GLIYPPF+NIRKISA I+A VA+KAYELGLA+RLP+PENL+ YAESCM
Sbjct  568  LAQQVTQEHFDRGLIYPPFTNIRKISAKISANVASKAYELGLASRLPRPENLMKYAESCM  627

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  628  YTPLYRSYR  636



>ref|XP_011010431.1| PREDICTED: NADP-dependent malic enzyme-like [Populus euphratica]
Length=648

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG G+TFTK+VI AMASFNEKPI+L+LSNPTSQSECTAEEAYTW
Sbjct  460  LLDAVNDIKPTVLIGTSGVGKTFTKEVIEAMASFNEKPIILSLSNPTSQSECTAEEAYTW  519

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY+G+T + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASEA
Sbjct  520  SQGRAIFASGSPFAPFEYEGKTFMPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASEA  579

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFD+GLIYPPF NIRKISA IAA+VAAKAYELGLATR+P P +LV +AESCM
Sbjct  580  LAAQVTQENFDQGLIYPPFKNIRKISAEIAAKVAAKAYELGLATRVPPPRDLVKHAESCM  639

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  640  YSPAYRSYR  648



>ref|XP_009771112.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Nicotiana 
sylvestris]
Length=643

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIGSSGAG+TFTK+V+ AMA+FNEKPI+ ALSNPTSQSECTAEEAYTW
Sbjct  455  LVNAVKSIKPTVLIGSSGAGKTFTKEVVQAMATFNEKPIIFALSNPTSQSECTAEEAYTW  514

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S GRAIFASGSPF P EYKG+  +SGQANNAYIFPG GLGL+ISGAIRVHDD+LLAASEA
Sbjct  515  SNGRAIFASGSPFAPVEYKGKVFVSGQANNAYIFPGLGLGLLISGAIRVHDDILLAASEA  574

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAAEV+QENF+KGLIYPPFSNIRKISAHIAA+VAAKAYELGLATRLPQPENLVAYAESCM
Sbjct  575  LAAEVSQENFEKGLIYPPFSNIRKISAHIAAKVAAKAYELGLATRLPQPENLVAYAESCM  634

Query  216  YSPTYRSYR  190
            YSP+YRSYR
Sbjct  635  YSPSYRSYR  643



>ref|XP_007012167.1| NADP-malic enzyme 4 [Theobroma cacao]
 gb|EOY29786.1| NADP-malic enzyme 4 [Theobroma cacao]
Length=724

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPT+LIG+SG G+ FTK+V+ AMASFNEKP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  536  LVDAVKAIKPTILIGTSGVGKQFTKEVVEAMASFNEKPLIMALSNPTSQAECTAEEAYTW  595

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLG+IISGAIRVHDDMLLAASEA
Sbjct  596  SEGRAIFASGSPFDPFEYDGKVFVPGQANNAYIFPGFGLGVIISGAIRVHDDMLLAASEA  655

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++VT+E+F KGLIYPPFSNIRKISA+IAA+VAAKAYELGLA+ LPQPE+LV YAESCM
Sbjct  656  LASQVTEEHFAKGLIYPPFSNIRKISANIAAKVAAKAYELGLASHLPQPEDLVKYAESCM  715

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  716  YSPVYRTYR  724



>ref|XP_009409372.1| PREDICTED: NADP-dependent malic enzyme-like [Musa acuminata subsp. 
malaccensis]
Length=627

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV+ IKP+VLIG+SG G+TFT+DV+  MASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  439  LLDAVQVIKPSVLIGTSGVGKTFTQDVVETMASFNEKPVILALSNPTSQSECTAEEAYTW  498

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY+G+T + GQANNAYIFPG GLGL+ISGAIRVHD+MLLAASEA
Sbjct  499  TKGRAIFASGSPFDPVEYEGKTFVPGQANNAYIFPGLGLGLVISGAIRVHDEMLLAASEA  558

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPF +IRKISAHIAA VAAK YELGLATRLP+PENLV YAESCM
Sbjct  559  LAQQVTQENFDKGLIYPPFKSIRKISAHIAASVAAKVYELGLATRLPRPENLVKYAESCM  618

Query  216  YSPTYRSYR  190
            Y+P YR YR
Sbjct  619  YTPAYRCYR  627



>gb|KJB07475.1| hypothetical protein B456_001G026200 [Gossypium raimondii]
Length=583

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG G+ FT++V+ AMAS NEKP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  395  LVDAVKAIKPTVLIGTSGVGKQFTREVVEAMASINEKPLIMALSNPTSQAECTAEEAYTW  454

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLG+I+SGAIRVHDDMLL ASEA
Sbjct  455  SEGRAIFASGSPFDPFEYDGKVFVPGQANNAYIFPGFGLGVIMSGAIRVHDDMLLTASEA  514

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E+F KGLIYPPFS+IRKISA+IAA+VAAKAYELGLA+ LPQPE+LV YAESCM
Sbjct  515  LAAQVTEEHFKKGLIYPPFSDIRKISANIAAKVAAKAYELGLASHLPQPEDLVKYAESCM  574

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  575  YSPVYRSYR  583



>ref|XP_009353550.1| PREDICTED: NADP-dependent malic enzyme [Pyrus x bretschneideri]
Length=641

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK+IKPTVLIG+SG GRTFTK+V+ AMAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LVDAVKSIKPTVLIGTSGVGRTFTKEVVEAMASLNERPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRAI+ SGSPFPP EY G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TEGRAIYCSGSPFPPVEYNGKVYYPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+ V+QE+FDKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P +L  YAESCM
Sbjct  573  LASMVSQEDFDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPRDLEKYAESCM  632

Query  216  YSPTYRSYR  190
            YSP+YR++R
Sbjct  633  YSPSYRNFR  641



>gb|KJB07473.1| hypothetical protein B456_001G026200 [Gossypium raimondii]
 gb|KJB07474.1| hypothetical protein B456_001G026200 [Gossypium raimondii]
Length=582

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG G+ FT++V+ AMAS NEKP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  394  LVDAVKAIKPTVLIGTSGVGKQFTREVVEAMASINEKPLIMALSNPTSQAECTAEEAYTW  453

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLG+I+SGAIRVHDDMLL ASEA
Sbjct  454  SEGRAIFASGSPFDPFEYDGKVFVPGQANNAYIFPGFGLGVIMSGAIRVHDDMLLTASEA  513

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E+F KGLIYPPFS+IRKISA+IAA+VAAKAYELGLA+ LPQPE+LV YAESCM
Sbjct  514  LAAQVTEEHFKKGLIYPPFSDIRKISANIAAKVAAKAYELGLASHLPQPEDLVKYAESCM  573

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  574  YSPVYRSYR  582



>gb|KJB70391.1| hypothetical protein B456_011G071400 [Gossypium raimondii]
 gb|KJB70394.1| hypothetical protein B456_011G071400 [Gossypium raimondii]
Length=646

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV  IKPTVLIG+SG GRTFTK+V+ AMA+ NEKPI+ +LSNPTSQSECTAEEAYTW
Sbjct  458  LVDAVNGIKPTVLIGTSGVGRTFTKEVVEAMAALNEKPIIFSLSNPTSQSECTAEEAYTW  517

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKGR  + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASEA
Sbjct  518  SEGRAIFASGSPFDPVEYKGRVFVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASEA  577

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF NIRKISAHIAA VAAKAYELGLATR PQP++LV YAE CM
Sbjct  578  LAAQVTQENFDKGLIYPPFRNIRKISAHIAASVAAKAYELGLATRQPQPKDLVKYAEHCM  637

Query  216  YSPTYRSYR  190
            Y+P Y+SYR
Sbjct  638  YNPAYQSYR  646



>gb|KJB06731.1| hypothetical protein B456_001G008900 [Gossypium raimondii]
Length=591

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIGSSG GRTFTK++I  + SFNEKP+++ALSNPTSQSECTAEEAYTW
Sbjct  403  LLGAVKAIKPTVLIGSSGVGRTFTKEIIETVTSFNEKPLIMALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  463  SQGRAIFASGSPFDPFEYNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+ EN++KGLIYPPFSNIRKISA+IAA VAAKAYELG+ATRLP+P NLV YAESCM
Sbjct  523  LAKQVSDENYNKGLIYPPFSNIRKISANIAANVAAKAYELGVATRLPRPANLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  583  YSPVYRSYR  591



>ref|XP_008450776.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
Length=591

 Score =   310 bits (795),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIGSSG GRTFTK+VI A++S NEKP+++ALSNPTSQSECTAEEAYTW
Sbjct  403  LLSAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSINEKPLIMALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEY G+T + GQ+NNAYIFPGFGLG++ISGAIRVHDDMLLAASEA
Sbjct  463  SEGRAIFASGSPFDPFEYNGKTFVPGQSNNAYIFPGFGLGVVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V++EN+DKGLIYPPF+NIRKISA+IAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  523  LAAQVSEENYDKGLIYPPFTNIRKISANIAANVAAKAYELGLATRLPRPADLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  583  YSPVYRTYR  591



>gb|KJB70393.1| hypothetical protein B456_011G071400 [Gossypium raimondii]
Length=645

 Score =   312 bits (799),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV  IKPTVLIG+SG GRTFTK+V+ AMA+ NEKPI+ +LSNPTSQSECTAEEAYTW
Sbjct  457  LVDAVNGIKPTVLIGTSGVGRTFTKEVVEAMAALNEKPIIFSLSNPTSQSECTAEEAYTW  516

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKGR  + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASEA
Sbjct  517  SEGRAIFASGSPFDPVEYKGRVFVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASEA  576

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF NIRKISAHIAA VAAKAYELGLATR PQP++LV YAE CM
Sbjct  577  LAAQVTQENFDKGLIYPPFRNIRKISAHIAASVAAKAYELGLATRQPQPKDLVKYAEHCM  636

Query  216  YSPTYRSYR  190
            Y+P Y+SYR
Sbjct  637  YNPAYQSYR  645



>ref|XP_009394174.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=638

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+V+ AMA+FNEKPI+LALSNPT+QSEC+AEEAYTW
Sbjct  450  LLDAVKAIKPTVLIGSSGVGRTFTKEVVEAMATFNEKPIILALSNPTTQSECSAEEAYTW  509

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY  +  + GQANNAYIFPGFGLGL+ISGA RVHDDMLLAASEA
Sbjct  510  SKGRAIFASGSPFDPVEYDEKIFVPGQANNAYIFPGFGLGLVISGATRVHDDMLLAASEA  569

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQEN DKGLIYPPFSNIRKISAHIAA VAAKAYELGLA+RLP P++LV YAESCM
Sbjct  570  LAQQVTQENLDKGLIYPPFSNIRKISAHIAANVAAKAYELGLASRLPCPKDLVKYAESCM  629

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  630  YNPVYRSYR  638



>gb|KHG23103.1| NADP-dependent malic enzyme [Gossypium arboreum]
Length=606

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV  IKPTVLIG+SG GRTFTK+V+ AMA+ NEKPI+ +LSNPTSQSECTAEEAYTW
Sbjct  418  LVDAVNGIKPTVLIGTSGVGRTFTKEVVEAMAALNEKPIIFSLSNPTSQSECTAEEAYTW  477

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EYKGR  + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAASEA
Sbjct  478  SQGRAIFASGSPFDPVEYKGRVFVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASEA  537

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF NIRKISAHIAA VAAKAYELGLATR PQP++LV YAE CM
Sbjct  538  LAAQVTQENFDKGLIYPPFRNIRKISAHIAASVAAKAYELGLATRQPQPKDLVKYAEHCM  597

Query  216  YSPTYRSYR  190
            Y+P Y+SYR
Sbjct  598  YNPAYQSYR  606



>gb|ABB86962.1| cytosolic NADP-malic enzyme [Malus domestica]
Length=641

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK+IKPTVLIG+SG GRTFTK+V+ AMAS NE+PI+LALSNPTSQSECTAEEAYT 
Sbjct  453  LVDAVKSIKPTVLIGTSGVGRTFTKEVVEAMASMNERPIILALSNPTSQSECTAEEAYTR  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRAI+ SGSPFPP EY G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TEGRAIYCSGSPFPPVEYNGKVYCPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+ VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P +LV YAESCM
Sbjct  573  LASMVTQEDFDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPRDLVKYAESCM  632

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  633  YSPIYRNYR  641



>ref|XP_004141663.1| PREDICTED: NADP-dependent malic enzyme-like [Cucumis sativus]
 ref|XP_004155950.1| PREDICTED: NADP-dependent malic enzyme-like [Cucumis sativus]
 gb|KGN45585.1| hypothetical protein Csa_7G452890 [Cucumis sativus]
Length=568

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GRTFTKDV+ AMA+ NEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  380  LIDAVKDIKPTVLIGTSGVGRTFTKDVVEAMAAINEKPIILALSNPTSQSECTAEEAYTW  439

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY+G   + GQANNAYIFPGFGLGLI+SG IRV +DMLLAASEA
Sbjct  440  TKGRAIFASGSPFNPVEYEGNVFVPGQANNAYIFPGFGLGLIMSGTIRVRNDMLLAASEA  499

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF+NIRKISA+IAA+VAAKAYELGLATRLPQPE+LV +AESCM
Sbjct  500  LAAQVTQENFDKGLIYPPFTNIRKISANIAAKVAAKAYELGLATRLPQPEDLVKHAESCM  559

Query  216  YSPTYRSYR  190
            YSP+Y++YR
Sbjct  560  YSPSYQNYR  568



>ref|XP_007216984.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
 gb|EMJ18183.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
Length=641

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPTVLIG+SGAGRTFTK+V+ +MAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LVDAVNAIKPTVLIGTSGAGRTFTKEVVESMASLNERPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAI+ SGSPFPP EY+G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TQGRAIYCSGSPFPPVEYEGKVYTPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QE++DKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P++L  YAESCM
Sbjct  573  LASQVSQEDYDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPKDLEKYAESCM  632

Query  216  YSPTYRSYR  190
            YSP+YRS+R
Sbjct  633  YSPSYRSFR  641



>ref|XP_007015739.1| NADP-malic enzyme 4 isoform 1 [Theobroma cacao]
 gb|EOY33358.1| NADP-malic enzyme 4 isoform 1 [Theobroma cacao]
Length=645

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV  IKPTVLIG+SG GRTFTK+V+ +MA+ N+KPI+ +LSNPTSQSECTAEEAYTW
Sbjct  457  LVDAVNGIKPTVLIGTSGVGRTFTKEVVESMAALNDKPIIFSLSNPTSQSECTAEEAYTW  516

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+GR  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  517  SQGRAIFASGSPFDPVEYEGRLFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  576

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT ENFDKGLIYPPF NIRKISAHIAA VAAKAYELGLATR+PQP++LV YAESCM
Sbjct  577  LAAQVTPENFDKGLIYPPFKNIRKISAHIAANVAAKAYELGLATRMPQPKDLVKYAESCM  636

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  637  YSPGYRSYR  645



>gb|AFR54473.1| cytosolic NADP-malic protein [Prunus armeniaca]
Length=640

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPTVLIG+SGAGRTFTK+V+ +MAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  452  LVDAVNAIKPTVLIGTSGAGRTFTKEVVESMASLNERPIILALSNPTSQSECTAEEAYTW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAI+ SGSPFPP EY+G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  512  TQGRAIYCSGSPFPPVEYEGKVYTPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  571

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QE++DKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P++L  YAESCM
Sbjct  572  LASQVSQEDYDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPKDLEKYAESCM  631

Query  216  YSPTYRSYR  190
            YSP+YRS+R
Sbjct  632  YSPSYRSFR  640



>ref|XP_008228427.1| PREDICTED: NADP-dependent malic enzyme [Prunus mume]
Length=641

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPTVLIG+SGAGRTFTK+V+ +MAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LVDAVNAIKPTVLIGTSGAGRTFTKEVVESMASLNERPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAI+ SGSPFPP EY+G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TQGRAIYCSGSPFPPVEYEGKVYTPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QE++DKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P++L  YAESCM
Sbjct  573  LASQVSQEDYDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPKDLEKYAESCM  632

Query  216  YSPTYRSYR  190
            YSP+YRS+R
Sbjct  633  YSPSYRSFR  641



>ref|XP_004135668.1| PREDICTED: NADP-dependent malic enzyme-like [Cucumis sativus]
 gb|KGN66170.1| Malic enzyme [Cucumis sativus]
Length=591

 Score =   310 bits (794),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIGSSG GRTFTK+V+ A++S NEKP+++ALSNPTSQSECTAEEAYTW
Sbjct  403  LLSAVKAIKPTVLIGSSGVGRTFTKEVVEAVSSINEKPLIMALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEY G+T + GQ+NNAYIFPGFGLG++ISGAIRVHDDMLLAASEA
Sbjct  463  SEGRAIFASGSPFDPFEYNGKTFVPGQSNNAYIFPGFGLGVVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V++EN+DKGLIYPPF+NIRKISA+IAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  523  LAAQVSEENYDKGLIYPPFTNIRKISANIAANVAAKAYELGLATRLPRPADLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  583  YSPVYRTYR  591



>gb|KHN16969.1| NADP-dependent malic enzyme [Glycine soja]
Length=600

 Score =   310 bits (794),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVLIGSSG G+TFTK+VI A+ S NEKP+VLALSNPTSQSECTAEEAY W
Sbjct  412  LLEAVKVIKPTVLIGSSGVGKTFTKEVIEAVTSINEKPLVLALSNPTSQSECTAEEAYEW  471

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  472  SEGRAIFASGSPFDPVEYKGKVYYSGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  531

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA  VT+EN++KGLIYPPFSNIRKISA+IAA VAAKAYELGLATRLP+P+NLV YAESCM
Sbjct  532  LAKLVTEENYEKGLIYPPFSNIRKISANIAASVAAKAYELGLATRLPRPQNLVKYAESCM  591

Query  216  YSPTYRSYR  190
            Y+P Y++YR
Sbjct  592  YTPVYQNYR  600



>gb|KDO51776.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=615

 Score =   310 bits (794),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPT+LIG+SG GRTFTK+V+ AMAS NEKPI+ +LSNPTSQSECTAEEAYTW
Sbjct  427  LVDAVNAIKPTILIGTSGQGRTFTKEVVEAMASLNEKPIIFSLSNPTSQSECTAEEAYTW  486

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY     + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAA+EA
Sbjct  487  SQGRAIFASGSPFDPFEYGDNVFVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAAAEA  546

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL+YPPF NIRKISAHIAA VAAKAYELGLATRLP P++LV YAESCM
Sbjct  547  LAGQVTQENFDKGLLYPPFKNIRKISAHIAAEVAAKAYELGLATRLPPPKDLVKYAESCM  606

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  607  YSPAYRTYR  615



>ref|XP_011019577.1| PREDICTED: NADP-dependent malic enzyme isoform X3 [Populus euphratica]
 ref|XP_011019578.1| PREDICTED: NADP-dependent malic enzyme isoform X3 [Populus euphratica]
Length=569

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AM S NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  381  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMTSINEKPLILALSNPTSQSECTAEEAYTW  440

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY  +  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  441  SKGRAIFASGSPFDPVEYNRKVFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  500

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V QENFDKGLIYPPFSNIR ISA+IAA+VAAKAYELGLA+RLP+P++LV YAESCM
Sbjct  501  LAAQVKQENFDKGLIYPPFSNIRNISANIAAKVAAKAYELGLASRLPRPKDLVKYAESCM  560

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  561  YSPVYRSYR  569



>gb|EYU21512.1| hypothetical protein MIMGU_mgv1a002703mg [Erythranthe guttata]
Length=645

 Score =   311 bits (796),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAI+PTVLIGSSGAG+TFT++V+ AM+S+N+KP++LALSNPTSQSECTAEEAY W
Sbjct  457  LLDAVKAIRPTVLIGSSGAGQTFTEEVVQAMSSYNKKPVILALSNPTSQSECTAEEAYKW  516

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRA+FASGSPF P EY G+  +SGQANNAY+FPG GLGLIISGAIRVHDDMLLAASEA
Sbjct  517  SEGRAVFASGSPFGPVEYNGKVYVSGQANNAYVFPGLGLGLIISGAIRVHDDMLLAASEA  576

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QEN D+GLIYPPF+NIRKISA IAARVAAKAYELGLATRLP PENLV YAESCM
Sbjct  577  LAEQVSQENLDRGLIYPPFANIRKISAQIAARVAAKAYELGLATRLPPPENLVEYAESCM  636

Query  216  YSPTYRSYR  190
            YSP YR+Y 
Sbjct  637  YSPNYRNYH  645



>ref|XP_008353539.1| PREDICTED: NADP-dependent malic enzyme-like [Malus domestica]
Length=641

 Score =   311 bits (796),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIG+SG GRTFTK+V+ AMAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LVNAVKSIKPTVLIGTSGVGRTFTKEVVEAMASLNERPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRA++ SGSPFPP EY G+    GQ+NNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TEGRAMYCSGSPFPPVEYNGKVYYPGQSNNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+ VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P +L  YAESCM
Sbjct  573  LASMVTQEDFDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPRDLERYAESCM  632

Query  216  YSPTYRSYR  190
            YSP+YRS+R
Sbjct  633  YSPSYRSFR  641



>gb|AHA11552.1| NADP-malic enzyme [Malus domestica]
Length=641

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LV+AVK+IKPTVLIG+SG GRTFTK+V+ AMAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LVNAVKSIKPTVLIGTSGVGRTFTKEVVEAMASLNERPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRA++ SGSPFPP EY G+    GQ+NNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TEGRAMYCSGSPFPPVEYNGKVYYPGQSNNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+ VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P +L  YAESCM
Sbjct  573  LASMVTQEDFDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPRDLERYAESCM  632

Query  216  YSPTYRSYR  190
            YSP+YRS+R
Sbjct  633  YSPSYRSFR  641



>gb|AFK37823.1| unknown [Lotus japonicus]
Length=238

 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIGSSG G+TFTK+VI AM S NEKP++LALSNPTSQSECTA++AY W
Sbjct  50   LIDAVKVIKPTVLIGSSGVGQTFTKEVIEAMTSNNEKPLILALSNPTSQSECTAQQAYEW  109

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P E KG+   SGQ+NNAYIFPGFGLGL++SGAIRVHDDMLLAASEA
Sbjct  110  SEGRAIFASGSPFDPVEIKGKVYYSGQSNNAYIFPGFGLGLVMSGAIRVHDDMLLAASEA  169

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++EN+ KGLIYPPF++IRKISA IAA VAAKAYELGLAT +P+P++LV YAESCM
Sbjct  170  LAKQVSEENYKKGLIYPPFTDIRKISADIAASVAAKAYELGLATHIPRPQDLVKYAESCM  229

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  230  YSPVYRNYR  238



>ref|XP_008362959.1| PREDICTED: NADP-dependent malic enzyme [Malus domestica]
Length=586

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYT+
Sbjct  398  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTY  457

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEYKG+  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  458  SEGRAIFASGSPFDPFEYKGKVFVPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  517

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++ENF  GLIYPP SNIRKISA +AA VAAKAY+LG+ATRLP+PENLV +AESCM
Sbjct  518  LAGQVSEENFAXGLIYPPLSNIRKISAQVAANVAAKAYDLGVATRLPRPENLVKHAESCM  577

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  578  YSPVYRNYR  586



>ref|XP_007150609.1| hypothetical protein PHAVU_005G166400g [Phaseolus vulgaris]
 gb|ESW22603.1| hypothetical protein PHAVU_005G166400g [Phaseolus vulgaris]
Length=643

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG GRTFTK+VI AMAS NEKPI+L+LSNPTSQSECTAEEAY W
Sbjct  455  LLDAVNQIKPTVLIGTSGQGRTFTKEVIEAMASNNEKPIILSLSNPTSQSECTAEEAYKW  514

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY+G+    GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  515  SQGRAIFASGSPFPPVEYEGKVFAPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  574

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QEN+DKGLIYPPF+NIRKISAHIAA+VAAKAYELGLATRLPQP++LV +AESCM
Sbjct  575  LASQVSQENYDKGLIYPPFTNIRKISAHIAAKVAAKAYELGLATRLPQPKDLVKFAESCM  634

Query  216  YSPTYRSYR  190
            Y+P+YRSYR
Sbjct  635  YTPSYRSYR  643



>dbj|BAD87057.1| putative NADP-dependent malic protein [Oryza sativa Japonica 
Group]
Length=388

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG G+TFT++V+ A++SFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  200  LLDAVKTIKPTVLIGTSGKGQTFTQEVVEAISSFNERPVIFALSNPTSQSECTAEQAYTW  259

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FASGSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  260  SKGRAVFASGSPFDPVEYDGKIYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  319

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL YPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  320  LAQQVTQENFDKGLTYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  379

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  380  YSPLYRNYR  388



>ref|XP_011019576.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Populus euphratica]
Length=598

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AM S NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  410  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMTSINEKPLILALSNPTSQSECTAEEAYTW  469

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY  +  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  470  SKGRAIFASGSPFDPVEYNRKVFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  529

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V QENFDKGLIYPPFSNIR ISA+IAA+VAAKAYELGLA+RLP+P++LV YAESCM
Sbjct  530  LAAQVKQENFDKGLIYPPFSNIRNISANIAAKVAAKAYELGLASRLPRPKDLVKYAESCM  589

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  590  YSPVYRSYR  598



>ref|XP_009352546.1| PREDICTED: NADP-dependent malic enzyme [Pyrus x bretschneideri]
Length=642

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYT+
Sbjct  454  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTY  513

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  514  SEGRAIFASGSPFDPVEYNGKVFIPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  573

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA  V++ENF +GLIYPP SNIRKISA IAA VAAKAY+LG+ATRLP+PENLV YAESCM
Sbjct  574  LAGLVSEENFAQGLIYPPLSNIRKISAQIAANVAAKAYDLGVATRLPRPENLVKYAESCM  633

Query  216  YSPTYRSYR  190
            YSPTYR+YR
Sbjct  634  YSPTYRNYR  642



>ref|XP_011019575.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Populus euphratica]
Length=599

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AM S NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  411  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMTSINEKPLILALSNPTSQSECTAEEAYTW  470

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY  +  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  471  SKGRAIFASGSPFDPVEYNRKVFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  530

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V QENFDKGLIYPPFSNIR ISA+IAA+VAAKAYELGLA+RLP+P++LV YAESCM
Sbjct  531  LAAQVKQENFDKGLIYPPFSNIRNISANIAAKVAAKAYELGLASRLPRPKDLVKYAESCM  590

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  591  YSPVYRSYR  599



>ref|XP_006426882.1| hypothetical protein CICLE_v10025125mg [Citrus clementina]
 ref|XP_006465687.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic [Citrus 
sinensis]
 gb|ESR40122.1| hypothetical protein CICLE_v10025125mg [Citrus clementina]
 gb|KDO51775.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=643

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPT+LIG+SG GRTFTK+V+ AMAS NEKPI+ +LSNPTSQSECTAEEAYTW
Sbjct  455  LVDAVNAIKPTILIGTSGQGRTFTKEVVEAMASLNEKPIIFSLSNPTSQSECTAEEAYTW  514

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY     + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAA+EA
Sbjct  515  SQGRAIFASGSPFDPFEYGDNVFVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAAAEA  574

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL+YPPF NIRKISAHIAA VAAKAYELGLATRLP P++LV YAESCM
Sbjct  575  LAGQVTQENFDKGLLYPPFKNIRKISAHIAAEVAAKAYELGLATRLPPPKDLVKYAESCM  634

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  635  YSPAYRTYR  643



>gb|AAT02534.1| NADP-dependent malic enzyme 2 [Hydrilla verticillata]
Length=614

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK+IKPTVLIGSSGAG+ FT++VI  MA FNEKPI+LALSNPTSQSEC+AE+AYTW
Sbjct  426  LLDAVKSIKPTVLIGSSGAGQAFTQEVIETMALFNEKPIILALSNPTSQSECSAEQAYTW  485

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EYKGRT + GQANNAYIFPGFGLGL++SGAIRVHDDMLLAAS+A
Sbjct  486  SKGRAIFASGSPFDPVEYKGRTFVPGQANNAYIFPGFGLGLVMSGAIRVHDDMLLAASKA  545

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA  LP+P+NLV +AE CM
Sbjct  546  LAEQVTDENFEKGLIYPPFSNIRKISAHIAANVAAKAYELGLAGNLPRPDNLVKHAEKCM  605

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  606  YSPIYRTYR  614



>ref|XP_009342530.1| PREDICTED: NADP-dependent malic enzyme-like [Pyrus x bretschneideri]
Length=641

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK+IKPTVLIG+SG GRTFTK+V+ AMAS NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  453  LVDAVKSIKPTVLIGTSGVGRTFTKEVVEAMASLNERPIILALSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EG AI+ SGSPFPP EY G+    GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  513  TEGCAIYCSGSPFPPVEYNGKVYYPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+ VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAK+YELGLATRLP+P +L  YAESCM
Sbjct  573  LASMVTQEDFDKGLIYPPFTNIRKISAHIAAKVAAKSYELGLATRLPEPRDLEKYAESCM  632

Query  216  YSPTYRSYR  190
            YSP+YR++R
Sbjct  633  YSPSYRNFR  641



>gb|KDO51774.1| hypothetical protein CISIN_1g006454mg [Citrus sinensis]
Length=644

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPT+LIG+SG GRTFTK+V+ AMAS NEKPI+ +LSNPTSQSECTAEEAYTW
Sbjct  456  LVDAVNAIKPTILIGTSGQGRTFTKEVVEAMASLNEKPIIFSLSNPTSQSECTAEEAYTW  515

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF PFEY     + GQANNAYIFPG GLGLI+SGAIRVHDDMLLAA+EA
Sbjct  516  SQGRAIFASGSPFDPFEYGDNVFVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAAAEA  575

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL+YPPF NIRKISAHIAA VAAKAYELGLATRLP P++LV YAESCM
Sbjct  576  LAGQVTQENFDKGLLYPPFKNIRKISAHIAAEVAAKAYELGLATRLPPPKDLVKYAESCM  635

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  636  YSPAYRTYR  644



>ref|XP_011093633.1| PREDICTED: NADP-dependent malic enzyme [Sesamum indicum]
Length=591

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+ AMAS NE+P++LALSNPTSQSECTAEEAYTW
Sbjct  403  LLDAVKAIKPTVLIGTSGVGKTFTKEVVEAMASLNERPLILALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRAIFASGSPF P E  G+  + GQANNAYIFPG G GL+ISGAIRVHDDMLLAASEA
Sbjct  463  TEGRAIFASGSPFDPVELNGKCFMPGQANNAYIFPGLGFGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE++DKG+IYPPFSNIRKISAHIAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  523  LAGQVTQEHYDKGMIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPADLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  583  YTPNYRSYR  591



>ref|XP_003543623.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Glycine max]
Length=647

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG GRTFTK+VI AMAS N++PI+L+LSNPTSQSECTAEEAY W
Sbjct  459  LLDAVNKIKPTVLIGTSGQGRTFTKEVIEAMASINKRPIILSLSNPTSQSECTAEEAYKW  518

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY+G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  519  SQGRAIFASGSPFPPVEYEGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  578

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QENFDKGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV +AESCM
Sbjct  579  LAAQVSQENFDKGLIYPPFTNIRKISAHIAANVAAKAYELGLATRLPQPKDLVKFAESCM  638

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  639  YTPAYRSYR  647



>gb|KHN32646.1| NADP-dependent malic enzyme, chloroplastic [Glycine soja]
Length=643

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG GRTFTK+VI AMAS N++PI+L+LSNPTSQSECTAEEAY W
Sbjct  455  LLDAVNKIKPTVLIGTSGQGRTFTKEVIEAMASINKRPIILSLSNPTSQSECTAEEAYKW  514

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EY+G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  515  SQGRAIFASGSPFPPVEYEGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  574

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QENFDKGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV +AESCM
Sbjct  575  LAAQVSQENFDKGLIYPPFTNIRKISAHIAANVAAKAYELGLATRLPQPKDLVKFAESCM  634

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  635  YTPAYRSYR  643



>ref|XP_010102421.1| NADP-dependent malic enzyme [Morus notabilis]
 gb|EXB93406.1| NADP-dependent malic enzyme [Morus notabilis]
Length=736

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  548  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMASLNEKPLILALSNPTSQSECTAEEAYTW  607

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P  Y+G+  + GQANNAYIFPGFGLGLIISGAIRVHD+MLLAASEA
Sbjct  608  SKGRAIFASGSPFEPVNYEGKVFVPGQANNAYIFPGFGLGLIISGAIRVHDNMLLAASEA  667

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKG+IYPPF+NIRKISAHIAA VAAK YELGLA+ LP+P++LV YAESCM
Sbjct  668  LAAQVTQENFDKGMIYPPFTNIRKISAHIAANVAAKVYELGLASHLPRPKDLVKYAESCM  727

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  728  YSPVYRSYR  736



>ref|XP_008447551.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
 ref|XP_008447552.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
Length=647

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GRTFTK+V+  MAS NE+PI+L+LSNPTSQSECTAEEAY W
Sbjct  459  LIDAVKEIKPTVLIGTSGVGRTFTKEVVETMASINEQPIILSLSNPTSQSECTAEEAYKW  518

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P ++KG+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  519  SQGRAIFASGSPFDPVKFKGKMFVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  578

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QE+FDKGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  579  LASQVSQEDFDKGLIYPPFTNIRKISAHIAASVAAKAYELGLATRLPQPKDLVKYAESCM  638

Query  216  YSPTYRSYR  190
            YSP+Y++YR
Sbjct  639  YSPSYQNYR  647



>ref|XP_008356453.1| PREDICTED: LOW QUALITY PROTEIN: NADP-dependent malic enzyme-like 
[Malus domestica]
Length=404

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYT+
Sbjct  216  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTY  275

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S GRAIFASGSPF P EYK +  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  276  SVGRAIFASGSPFDPVEYKDKVFVPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  335

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V +ENF +GLIYPP SNIRKISA +AA VAAKAY+LG+ATRLP+PENLV +AESCM
Sbjct  336  LAGQVFEENFAQGLIYPPLSNIRKISAQVAANVAAKAYDLGVATRLPRPENLVKHAESCM  395

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  396  YSPVYRNYR  404



>gb|KHN18149.1| NADP-dependent malic enzyme [Glycine soja]
Length=581

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  393  LLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  452

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  453  SKGKAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  512

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPFSNIRKISAHIAA+VAAKAY+LGLA+ LP+P++LV YAESCM
Sbjct  513  LAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVAAKAYDLGLASHLPRPKDLVKYAESCM  572

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  573  YSPGYRSYR  581



>gb|KHN40389.1| NADP-dependent malic enzyme [Glycine soja]
Length=578

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVLIGSSG G+TFTK+VI A+ S NEKP+VLALSNPTSQSECTAEEAY W
Sbjct  390  LLEAVKVIKPTVLIGSSGVGKTFTKEVIEAVTSINEKPLVLALSNPTSQSECTAEEAYQW  449

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  450  SEGRAIFASGSPFDPVEYKGKVYYSGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  509

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA  V+ EN++KGLIYPPFSNIR+ISA+IAA VA KAYELGLATRLP+P+NLV YAESCM
Sbjct  510  LAKLVSNENYEKGLIYPPFSNIREISANIAASVAGKAYELGLATRLPRPQNLVKYAESCM  569

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  570  YSPVYRNYR  578



>ref|XP_010267163.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nelumbo 
nucifera]
Length=626

 Score =   308 bits (790),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AMASFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  438  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMASFNERPVIFALSNPTSQSECTAEQAYTW  497

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P E  G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  498  SKGRAIFASGSPFDPVECNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  557

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT++NFDKGLIYPPF NIRKISA IAA VA+KAYELGLATRLP+P NLV YAESCM
Sbjct  558  LAGQVTEDNFDKGLIYPPFCNIRKISAEIAANVASKAYELGLATRLPRPANLVKYAESCM  617

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  618  YSPVYRNYR  626



>ref|XP_004150784.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Cucumis 
sativus]
 gb|KGN58034.1| Malic enzyme [Cucumis sativus]
Length=647

 Score =   309 bits (792),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GRTFTK+V+  MAS NE+PI+L+LSNPTSQSECTAEEAY W
Sbjct  459  LIDAVKEIKPTVLIGTSGVGRTFTKEVVETMASINEQPIILSLSNPTSQSECTAEEAYKW  518

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P ++KG+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  519  SQGRAIFASGSPFDPVKFKGKMFVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  578

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QE+FDKGLIYPPF+NIRKISAHIAA VAAKAYELGLATRLPQP++LV YAESCM
Sbjct  579  LASQVSQEDFDKGLIYPPFTNIRKISAHIAASVAAKAYELGLATRLPQPKDLVKYAESCM  638

Query  216  YSPTYRSYR  190
            YSP+Y++YR
Sbjct  639  YSPSYQNYR  647



>ref|XP_002309534.1| hypothetical protein POPTR_0006s25280g [Populus trichocarpa]
 gb|EEE93057.1| hypothetical protein POPTR_0006s25280g [Populus trichocarpa]
Length=569

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  381  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMASINEKPLILALSNPTSQSECTAEEAYTW  440

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GR IFASGSPF P EY  +  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  441  SKGRVIFASGSPFDPVEYNRKVFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  500

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V QE+FDKGLIYPPFSNIR ISA+IAA+VAAKAYELGLA+RLP+P++LV YAESCM
Sbjct  501  LAAQVKQEHFDKGLIYPPFSNIRNISANIAAKVAAKAYELGLASRLPRPKDLVKYAESCM  560

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  561  YSPVYRSYR  569



>gb|KJB65652.1| hypothetical protein B456_010G105100 [Gossypium raimondii]
Length=576

 Score =   307 bits (787),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG G+ FTK+V+ AMA+ NEKP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  388  LVDAVKAIKPTVLIGTSGVGKQFTKEVVEAMAALNEKPLIMALSNPTSQAECTAEEAYTW  447

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF PFEY G+  + GQANNAYIFPGFGLG+IISGAIRVHDDMLLAASEA
Sbjct  448  SEGRAIFASGSPFDPFEYDGKVFVPGQANNAYIFPGFGLGVIISGAIRVHDDMLLAASEA  507

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+E+++KGLIYPPFS+IRKISA+IAA+VAAKAYELGLA+ LPQP++LV YAESCM
Sbjct  508  LALQVTEEHYEKGLIYPPFSDIRKISANIAAKVAAKAYELGLASHLPQPKDLVKYAESCM  567

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  568  YSPKYRTYR  576



>ref|XP_003526504.2| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Glycine 
max]
Length=620

 Score =   308 bits (790),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  432  LLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  491

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  492  SKGKAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  551

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPFSNIRKISAHIAA+VAAKAY+LGLA+ LP+P++LV YAESCM
Sbjct  552  LAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVAAKAYDLGLASHLPRPKDLVKYAESCM  611

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  612  YSPGYRSYR  620



>ref|XP_003516804.1| PREDICTED: NADP-dependent malic enzyme-like [Glycine max]
Length=591

 Score =   307 bits (787),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVLIGSSG G+TFTK+VI A+ S NEKP+VLALSNPTSQSECTAEEAY W
Sbjct  403  LLEAVKVIKPTVLIGSSGVGKTFTKEVIEAVTSINEKPLVLALSNPTSQSECTAEEAYQW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  463  SEGRAIFASGSPFDPVEYKGKVYYSGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA  V+ EN++KGLIYPPFSNIR+ISA+IAA VA KAYELGLATRLP+P+NLV YAESCM
Sbjct  523  LAKLVSNENYEKGLIYPPFSNIREISANIAASVAGKAYELGLATRLPRPQNLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  583  YSPVYRNYR  591



>ref|XP_010267160.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Nelumbo 
nucifera]
Length=643

 Score =   309 bits (791),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AMASFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  455  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMASFNERPVIFALSNPTSQSECTAEQAYTW  514

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P E  G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  515  SKGRAIFASGSPFDPVECNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  574

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT++NFDKGLIYPPF NIRKISA IAA VA+KAYELGLATRLP+P NLV YAESCM
Sbjct  575  LAGQVTEDNFDKGLIYPPFCNIRKISAEIAANVASKAYELGLATRLPRPANLVKYAESCM  634

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  635  YSPVYRNYR  643



>ref|XP_010267161.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nelumbo 
nucifera]
Length=642

 Score =   309 bits (791),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AMASFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  454  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMASFNERPVIFALSNPTSQSECTAEQAYTW  513

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P E  G+  + GQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  514  SKGRAIFASGSPFDPVECNGKVFVPGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  573

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT++NFDKGLIYPPF NIRKISA IAA VA+KAYELGLATRLP+P NLV YAESCM
Sbjct  574  LAGQVTEDNFDKGLIYPPFCNIRKISAEIAANVASKAYELGLATRLPRPANLVKYAESCM  633

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  634  YSPVYRNYR  642



>ref|XP_006581459.1| PREDICTED: NADP-dependent malic enzyme-like isoform X4 [Glycine 
max]
Length=618

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  430  LLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  489

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  490  SKGKAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  549

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPFSNIRKISAHIAA+VAAKAY+LGLA+ LP+P++LV YAESCM
Sbjct  550  LAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVAAKAYDLGLASHLPRPKDLVKYAESCM  609

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  610  YSPGYRSYR  618



>ref|XP_003522719.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Glycine 
max]
 gb|KHN10180.1| NADP-dependent malic enzyme [Glycine soja]
Length=588

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  400  LLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  459

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  460  SKGKAIFASGSPFDPVEYEGKVFVPGQANNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  519

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPFSNIRKISAHIAA+VA KAY+LGLA+ LP+P++LV YAESCM
Sbjct  520  LAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVATKAYDLGLASHLPRPKDLVKYAESCM  579

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  580  YSPGYRSYR  588



>ref|XP_006581458.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Glycine 
max]
Length=648

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  460  LLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  519

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  520  SKGKAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  579

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPFSNIRKISAHIAA+VAAKAY+LGLA+ LP+P++LV YAESCM
Sbjct  580  LAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVAAKAYDLGLASHLPRPKDLVKYAESCM  639

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  640  YSPGYRSYR  648



>ref|XP_006581457.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Glycine 
max]
Length=649

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  461  LLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  520

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  521  SKGKAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  580

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPFSNIRKISAHIAA+VAAKAY+LGLA+ LP+P++LV YAESCM
Sbjct  581  LAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVAAKAYDLGLASHLPRPKDLVKYAESCM  640

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  641  YSPGYRSYR  649



>ref|XP_008337596.1| PREDICTED: NADP-dependent malic enzyme [Malus domestica]
Length=586

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYT+
Sbjct  398  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTY  457

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  458  SEGRAIFASGSPFDPVEYNGKVFIPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  517

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA  V++ENF +GLIYPP SNIRKISA IAA VAAKAY+LG+ATRLP+PENL+ YAESCM
Sbjct  518  LAGLVSEENFAQGLIYPPLSNIRKISAQIAANVAAKAYDLGVATRLPRPENLLKYAESCM  577

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  578  YSPIYRNYR  586



>ref|XP_007152912.1| hypothetical protein PHAVU_004G170800g [Phaseolus vulgaris]
 gb|ESW24906.1| hypothetical protein PHAVU_004G170800g [Phaseolus vulgaris]
Length=591

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVL+GSSG G+TFTK+VI A+AS NEKP+V+ALSNPTSQ+ECTAEEAY W
Sbjct  403  LLEAVKVIKPTVLVGSSGVGKTFTKEVIEALASINEKPLVMALSNPTSQAECTAEEAYQW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  463  SEGRAIFASGSPFDPIEYKGKVYYSGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA  VT+EN+ KGLIYPPFS+IR ISA+IAA VAAKAYELGLATRLP+P+NLV YAESCM
Sbjct  523  LAKLVTEENYKKGLIYPPFSDIRTISANIAADVAAKAYELGLATRLPRPQNLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  583  YTPVYRNYR  591



>ref|XP_006578239.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Glycine 
max]
Length=618

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  430  LLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  489

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  490  SKGKAIFASGSPFDPVEYEGKVFVPGQANNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  549

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPFSNIRKISAHIAA+VA KAY+LGLA+ LP+P++LV YAESCM
Sbjct  550  LAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVATKAYDLGLASHLPRPKDLVKYAESCM  609

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  610  YSPGYRSYR  618



>ref|XP_006578240.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Glycine 
max]
Length=617

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  429  LLDAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  488

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  489  SKGKAIFASGSPFDPVEYEGKVFVPGQANNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  548

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPFSNIRKISAHIAA+VA KAY+LGLA+ LP+P++LV YAESCM
Sbjct  549  LAAQVSQENYDKGLIYPPFSNIRKISAHIAAKVATKAYDLGLASHLPRPKDLVKYAESCM  608

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  609  YSPGYRSYR  617



>ref|XP_010521509.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic [Tarenaya 
hassleriana]
Length=630

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG GRTFT+DV+ AM+  NEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  442  LVDAVKAIKPTVLIGTSGVGRTFTQDVVEAMSDLNEKPIILALSNPTSQSECTAEEAYTW  501

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFA+GSPFPP EY G+T++ GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  502  SQGRAIFATGSPFPPVEYNGKTIVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  561

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA ++ +E+F+KG+I+PPF NIR ISA IAA+VA+KAYELGLATRLPQP++LV  AESCM
Sbjct  562  LAEQLAEEHFEKGMIFPPFKNIRMISARIAAKVASKAYELGLATRLPQPKDLVQCAESCM  621

Query  216  YSPTYRSYR  190
            YSP+YRSYR
Sbjct  622  YSPSYRSYR  630



>ref|XP_006450720.1| hypothetical protein CICLE_v10007668mg [Citrus clementina]
 gb|ESR63960.1| hypothetical protein CICLE_v10007668mg [Citrus clementina]
 gb|KDO79868.1| hypothetical protein CISIN_1g007112mg [Citrus sinensis]
Length=589

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPT+L+G+SG G+TFTK+V+ AMASFNEKP++ ALSNPTSQSECTAEEAYTW
Sbjct  401  LLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY G+  + GQ NNAYIFPG GLGLIISGAIRV D+MLLAASEA
Sbjct  461  SKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPGLGLGLIISGAIRVRDEMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAKAY+LGLA+RLP+P++LV+YAESCM
Sbjct  521  LAAQVTQEHFDKGLIYPPFTNIRKISAHIAAKVAAKAYDLGLASRLPRPKDLVSYAESCM  580

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  581  YSPMYRSYR  589



>gb|AEK25136.1| NADP-dependent malic enzyme [Hylocereus undatus]
Length=640

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++A+ ++KPTVLIGSSG GRTFTK+V+ AMA+++E+P++LALSNPTSQSECTAEEAYTW
Sbjct  452  LLNAINSLKPTVLIGSSGVGRTFTKEVVEAMATYSERPVILALSNPTSQSECTAEEAYTW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP E++G+T   GQANNAYIFPGFGLGLI+SGAIRVHDDMLLAASEA
Sbjct  512  SQGRAIFASGSPFPPVEFEGKTFTPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLAASEA  571

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++VT+E+F KGL+YPPF  IRKISAHIAA VA KAYELGLATRLPQP NLV YAESCM
Sbjct  572  LASQVTEEHFAKGLLYPPFKTIRKISAHIAANVATKAYELGLATRLPQPANLVKYAESCM  631

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  632  YSPAYRSYR  640



>ref|XP_006476016.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Citrus 
sinensis]
Length=607

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPT+L+G+SG G+TFTK+V+ AMASFNEKP++ ALSNPTSQSECTAEEAYTW
Sbjct  419  LLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTW  478

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY G+  + GQ NNAYIFPG GLGLIISGAIRV D+MLLAASEA
Sbjct  479  SKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPGLGLGLIISGAIRVRDEMLLAASEA  538

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAKAY+LGLA+RLP+P++LV+YAESCM
Sbjct  539  LAAQVTQEHFDKGLIYPPFTNIRKISAHIAAKVAAKAYDLGLASRLPRPKDLVSYAESCM  598

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  599  YSPMYRSYR  607



>ref|XP_004501098.1| PREDICTED: NADP-dependent malic enzyme-like [Cicer arietinum]
Length=575

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIGSSG G+TFTKDV+ AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  387  LLGAVKAIKPTVLIGSSGVGKTFTKDVVEAMASLNEKPLILALSNPTSQSECTAEEAYTW  446

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQ+NNAYIFPGFGLGLI+SGAIRV D+MLLAASEA
Sbjct  447  SKGKAIFASGSPFDPIEYEGKVFVPGQSNNAYIFPGFGLGLIMSGAIRVRDEMLLAASEA  506

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QEN+DKGLIYPPF+NIRKISAHIAA+VAAK YELGLA+ LP+P +LV YAESCM
Sbjct  507  LAEQVSQENYDKGLIYPPFTNIRKISAHIAAKVAAKTYELGLASHLPRPNDLVKYAESCM  566

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  567  YSPGYRSYR  575



>ref|XP_010249514.1| PREDICTED: NADP-dependent malic enzyme [Nelumbo nucifera]
Length=591

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPT+LIGSSG G+TFTK+V+ AMASFNE+P++ ALSNPTSQSECTAEEAY+W
Sbjct  403  LLDAVKAIKPTMLIGSSGVGQTFTKEVVEAMASFNERPVIFALSNPTSQSECTAEEAYSW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P E  G+  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLA+SEA
Sbjct  463  TKGRAIFASGSPFDPVECNGKVFVPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLASSEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V +ENF+KGLIYPPFSNIRKISA IAA VAAKAY+LGLATRLP+P NLV YAESCM
Sbjct  523  LAGQVAEENFEKGLIYPPFSNIRKISAEIAANVAAKAYDLGLATRLPRPANLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  583  YSPVYRSYR  591



>ref|XP_004302862.1| PREDICTED: LOW QUALITY PROTEIN: NADP-dependent malic enzyme [Fragaria 
vesca subsp. vesca]
Length=637

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV AIKPTVLIG+SG GRTFTK V+ AMA++NE+PI+LALSNPTSQSECTAEEAYTW
Sbjct  449  LVDAVNAIKPTVLIGTSGVGRTFTKKVVEAMATYNERPIILALSNPTSQSECTAEEAYTW  508

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAI+ SGSPFPP EY+G+    GQ+NNAYIFPGFGLGL++SG IRVHDDMLLAASEA
Sbjct  509  TQGRAIYCSGSPFPPVEYEGKVYTPGQSNNAYIFPGFGLGLLMSGTIRVHDDMLLAASEA  568

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++V+QE+FDKGLIYPPF+NIR+ISAHIAA+VAAK+YELGLATRLPQP++L  YAESCM
Sbjct  569  LASQVSQEDFDKGLIYPPFTNIREISAHIAAKVAAKSYELGLATRLPQPKDLFHYAESCM  628

Query  216  YSPTYRSYR  190
            YSP YRS++
Sbjct  629  YSPNYRSFK  637



>dbj|BAD87056.1| putative NADP-dependent malic protein [Oryza sativa Japonica 
Group]
 dbj|BAG94237.1| unnamed protein product [Oryza sativa Japonica Group]
Length=496

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG G+TFT++V+ A++SFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  308  LLDAVKTIKPTVLIGTSGKGQTFTQEVVEAISSFNERPVIFALSNPTSQSECTAEQAYTW  367

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FASGSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  368  SKGRAVFASGSPFDPVEYDGKIYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  427

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL YPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  428  LAQQVTQENFDKGLTYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  487

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  488  YSPLYRNYR  496



>gb|KDO79867.1| hypothetical protein CISIN_1g007112mg [Citrus sinensis]
Length=617

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPT+L+G+SG G+TFTK+V+ AMASFNEKP++ ALSNPTSQSECTAEEAYTW
Sbjct  429  LLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTW  488

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY G+  + GQ NNAYIFPG GLGLIISGAIRV D+MLLAASEA
Sbjct  489  SKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPGLGLGLIISGAIRVRDEMLLAASEA  548

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAKAY+LGLA+RLP+P++LV+YAESCM
Sbjct  549  LAAQVTQEHFDKGLIYPPFTNIRKISAHIAAKVAAKAYDLGLASRLPRPKDLVSYAESCM  608

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  609  YSPMYRSYR  617



>emb|CDP08185.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKP+VLIG+SG G+TFTK+V+ AMA+ NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  434  LVDAVKAIKPSVLIGTSGVGKTFTKEVVEAMAALNEKPLILALSNPTSQSECTAEEAYTW  493

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRAIFASGSPF P +Y G+  + GQANNAYIFPGFGLG+I+SG IRVHDD+LLAASEA
Sbjct  494  TEGRAIFASGSPFDPVKYDGKVFIPGQANNAYIFPGFGLGIIMSGTIRVHDDLLLAASEA  553

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+EN++KGLIYPPFSNIRKISAHIAA VAAKAYELGLATRLP+P++LV YAESCM
Sbjct  554  LAGQVTEENYEKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPQDLVKYAESCM  613

Query  216  YSPTYRSYR  190
            Y+P YR YR
Sbjct  614  YTPVYRQYR  622



>ref|XP_006476015.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Citrus 
sinensis]
Length=617

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPT+L+G+SG G+TFTK+V+ AMASFNEKP++ ALSNPTSQSECTAEEAYTW
Sbjct  429  LLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTW  488

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY G+  + GQ NNAYIFPG GLGLIISGAIRV D+MLLAASEA
Sbjct  489  SKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPGLGLGLIISGAIRVRDEMLLAASEA  548

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAKAY+LGLA+RLP+P++LV+YAESCM
Sbjct  549  LAAQVTQEHFDKGLIYPPFTNIRKISAHIAAKVAAKAYDLGLASRLPRPKDLVSYAESCM  608

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  609  YSPMYRSYR  617



>gb|AGH32501.1| malic enzyme [Stylosanthes guianensis]
Length=585

 Score =   305 bits (781),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIGSSG G+TFTK+V+  MAS N+KP++LALSNPTSQSECTAEEAYTW
Sbjct  397  LVDAVKAIKPTVLIGSSGVGKTFTKEVVETMASLNKKPLILALSNPTSQSECTAEEAYTW  456

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SGAIRV D+MLLAASEA
Sbjct  457  SKGQAIFASGSPFDPVEYEGKVFVPGQANNAYIFPGFGLGLIMSGAIRVRDEMLLAASEA  516

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPF+NIRKISAHIAA VAAKAYELGLA+ LPQP++LV YAESCM
Sbjct  517  LAAQVSQENYDKGLIYPPFTNIRKISAHIAANVAAKAYELGLASNLPQPKDLVKYAESCM  576

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  577  YSPGYRNYR  585



>ref|XP_008810493.1| PREDICTED: NADP-dependent malic enzyme [Phoenix dactylifera]
Length=641

 Score =   306 bits (784),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 171/190 (90%), Gaps = 1/190 (1%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG G+TFTK+V+ AMASFNEKPI+LALSNPTSQSECTAEEAY W
Sbjct  452  LLDAVKAIKPTVLIGSSGVGKTFTKEVVEAMASFNEKPIILALSNPTSQSECTAEEAYRW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P E  G+  + GQANNAYIFPG GLGL+ISGAIRVHDDMLLAASEA
Sbjct  512  SKGRAIFASGSPFDPVELNGKVFVPGQANNAYIFPGLGLGLVISGAIRVHDDMLLAASEA  571

Query  396  laaEVTQENFD-KGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESC  220
            LA +VTQEN D KGLIYPPFSNIRKISA IAA VAA AYELGLATRLP+P+NLV YAESC
Sbjct  572  LAQQVTQENLDNKGLIYPPFSNIRKISADIAANVAATAYELGLATRLPRPQNLVKYAESC  631

Query  219  MYSPTYRSYR  190
            MYSP YR+YR
Sbjct  632  MYSPIYRNYR  641



>gb|KGN62800.1| hypothetical protein Csa_2G373430 [Cucumis sativus]
Length=589

 Score =   305 bits (780),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L  AV+AIKPTVLIG+SG G+TFTK+V+ AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  401  LYGAVQAIKPTVLIGTSGVGKTFTKEVVEAMASFNEKPLILALSNPTSQSECTAEEAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  461  SQGRAIFASGSPFDPVEYDGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPF+NIRKISA+IAA+VAAKAYELGLA+RLP+P++LV +AESCM
Sbjct  521  LAAQVSQENYDKGLIYPPFTNIRKISANIAAKVAAKAYELGLASRLPRPKDLVKFAESCM  580

Query  216  YSPTYRSY  193
            YSP YRSY
Sbjct  581  YSPRYRSY  588



>gb|AET01514.2| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=588

 Score =   305 bits (780),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK IKPTVLIG+SG GRTFT+DV+ AMAS N+KPI+LALSNPTSQSECTAEEAYTW
Sbjct  400  LVDAVKQIKPTVLIGTSGQGRTFTQDVVEAMASLNKKPIILALSNPTSQSECTAEEAYTW  459

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++G AIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SG IR+HD +LLAASEA
Sbjct  460  TQGHAIFASGSPFSPVEYEGKVFVPGQANNAYIFPGFGLGLIMSGTIRMHDGLLLAASEA  519

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++VTQE++D+GLIYPPF+NIRKISAHIAA+VA KAYELGLATRLPQP++LV +AESCM
Sbjct  520  LASQVTQEHYDRGLIYPPFTNIRKISAHIAAKVATKAYELGLATRLPQPKDLVKFAESCM  579

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  580  YSPNYRSYR  588



>gb|AFM08812.1| NADP-dependent malic protein [Dimocarpus longan]
Length=645

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV  IKPT+LIG+SG G+TFTK+V+ AMA+ NEKPI+LALSNPTSQSECTAEEAY W
Sbjct  457  LVDAVNQIKPTILIGTSGKGKTFTKEVVEAMAALNEKPIILALSNPTSQSECTAEEAYNW  516

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  517  TQGRAIFASGSPFDPVEYEGKAYVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  576

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT ENF+KGLIYPPF +IRKISAHIAA+VAAK+YELGLATRLPQP++LV YAESCM
Sbjct  577  LAEQVTPENFEKGLIYPPFKSIRKISAHIAAKVAAKSYELGLATRLPQPKDLVKYAESCM  636

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  637  YSPAYRTYR  645



>ref|XP_004486781.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Cicer arietinum]
Length=641

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GRTFTK+VI AMAS NEKPI+L+LSNPTSQSECTAEEAY W
Sbjct  453  LLDAVKQIKPTVLIGTSGQGRTFTKEVIEAMASINEKPIILSLSNPTSQSECTAEEAYKW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPFPP EYKG+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  513  SKGRAIFASGSPFPPVEYKGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA EV++ENF+KGLI+PPF++IRKISA IAA+VAAKAYELGLATRLPQP++LV +AESCM
Sbjct  573  LAGEVSEENFEKGLIFPPFTDIRKISAQIAAKVAAKAYELGLATRLPQPKDLVKFAESCM  632

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  633  YTPAYRSYR  641



>gb|KJB18587.1| hypothetical protein B456_003G061800 [Gossypium raimondii]
Length=581

 Score =   304 bits (779),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV   KPTVLIG+SG GRTFTK+V+ AMA+ N++PI+ +LSNPTSQSECTAEEAYTW
Sbjct  393  LVDAVNGTKPTVLIGTSGVGRTFTKEVVEAMAALNDRPIIFSLSNPTSQSECTAEEAYTW  452

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+GR  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLL A+EA
Sbjct  453  SKGRAIFASGSPFDPVEYEGRVFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLEAAEA  512

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF NIR+ISA+IAA VAAKAYELGLATR P+P++LV YAESCM
Sbjct  513  LAAQVTQENFDKGLIYPPFKNIRQISANIAANVAAKAYELGLATRQPRPKDLVKYAESCM  572

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  573  YNPAYRSYR  581



>ref|XP_006450719.1| hypothetical protein CICLE_v10007668mg [Citrus clementina]
 gb|ESR63959.1| hypothetical protein CICLE_v10007668mg [Citrus clementina]
Length=665

 Score =   306 bits (784),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPT+L+G+SG G+TFTK+V+ AMASFNEKP++ ALSNPTSQSECTAEEAYTW
Sbjct  477  LLDAVKAIKPTMLMGTSGVGKTFTKEVVEAMASFNEKPVIFALSNPTSQSECTAEEAYTW  536

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY G+  + GQ NNAYIFPG GLGLIISGAIRV D+MLLAASEA
Sbjct  537  SKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPGLGLGLIISGAIRVRDEMLLAASEA  596

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQE+FDKGLIYPPF+NIRKISAHIAA+VAAKAY+LGLA+RLP+P++LV+YAESCM
Sbjct  597  LAAQVTQEHFDKGLIYPPFTNIRKISAHIAAKVAAKAYDLGLASRLPRPKDLVSYAESCM  656

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  657  YSPMYRSYR  665



>gb|AAD11429.1| malate dehydrogenase [Mesembryanthemum crystallinum]
Length=222

 Score =   292 bits (747),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L  AVKAIKPTVLIGSSG GRTFTK+VI AMASFNEKP+++ALSNPT+QSECTAEEAYTW
Sbjct  34   LSSAVKAIKPTVLIGSSGVGRTFTKEVIEAMASFNEKPLIMALSNPTTQSECTAEEAYTW  93

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF   EY+G+T + GQ+NNAYIFPGFGLGL+ISGAIRVH+DMLLAASEA
Sbjct  94   SKGRAIFASGSPFNSVEYEGKTFVPGQSNNAYIFPGFGLGLVISGAIRVHEDMLLAASEA  153

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQEN+DKG+IYPPFSNIRKISA IAA VAAKAY+LGLATRLP+PENLV YAE+CM
Sbjct  154  LAGQVTQENYDKGMIYPPFSNIRKISAAIAANVAAKAYDLGLATRLPRPENLVKYAENCM  213

Query  216  YSPTYRSYR  190
            YSP YRS+R
Sbjct  214  YSPVYRSFR  222



>gb|KHN41665.1| NADP-dependent malic enzyme [Glycine soja]
Length=591

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVLIGSSG GRTFTK+V+ AM S N+KP++LALSNPTSQSECTAEEAY W
Sbjct  403  LLEAVKVIKPTVLIGSSGVGRTFTKEVVEAMTSNNDKPLILALSNPTSQSECTAEEAYQW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASE+
Sbjct  463  SEGRAIFASGSPFDPVEYKGKVYASGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASES  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++EN+  GLIYPPFSNIRKISA+IAA VAAKAYELGLATRLP+P+NLV  AESCM
Sbjct  523  LAKQVSEENYKNGLIYPPFSNIRKISANIAANVAAKAYELGLATRLPRPQNLVKCAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  583  YTPVYRNYR  591



>ref|XP_004164764.1| PREDICTED: NADP-dependent malic enzyme-like [Cucumis sativus]
Length=616

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L  AV+AIKPTVLIG+SG G+TFTK+V+ AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  428  LYGAVQAIKPTVLIGTSGVGKTFTKEVVEAMASFNEKPLILALSNPTSQSECTAEEAYTW  487

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  488  SQGRAIFASGSPFDPVEYDGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  547

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPF+NIRKISA+IAA+VAAKAYELGLA+RLP+P++LV +AESCM
Sbjct  548  LAAQVSQENYDKGLIYPPFTNIRKISANIAAKVAAKAYELGLASRLPRPKDLVKFAESCM  607

Query  216  YSPTYRSY  193
            YSP YRSY
Sbjct  608  YSPRYRSY  615



>ref|XP_003568785.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like isoform 
X2 [Brachypodium distachyon]
Length=570

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AV++IKPTVLIG+SG GRTFTK+VI AMASFNEKP++ +LSNPTS SECTAEEAYTW
Sbjct  382  LLEAVQSIKPTVLIGTSGVGRTFTKEVIEAMASFNEKPVIFSLSNPTSHSECTAEEAYTW  441

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G A+FASGSPF P EY+G+T + GQ+NNAY+FPGFGLG++ISGAIRVHDDMLLAASEA
Sbjct  442  SKGTAVFASGSPFDPVEYEGKTYVPGQSNNAYVFPGFGLGVVISGAIRVHDDMLLAASEA  501

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QENFDKGLI+PPF+NIRKISA+IAA+VAAKAY+LGLA+RLP+P++LV YAESCM
Sbjct  502  LAEQVSQENFDKGLIFPPFTNIRKISANIAAKVAAKAYDLGLASRLPRPDDLVKYAESCM  561

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  562  YTPLYRSYR  570



>ref|XP_010231631.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like isoform 
X1 [Brachypodium distachyon]
Length=583

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AV++IKPTVLIG+SG GRTFTK+VI AMASFNEKP++ +LSNPTS SECTAEEAYTW
Sbjct  395  LLEAVQSIKPTVLIGTSGVGRTFTKEVIEAMASFNEKPVIFSLSNPTSHSECTAEEAYTW  454

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G A+FASGSPF P EY+G+T + GQ+NNAY+FPGFGLG++ISGAIRVHDDMLLAASEA
Sbjct  455  SKGTAVFASGSPFDPVEYEGKTYVPGQSNNAYVFPGFGLGVVISGAIRVHDDMLLAASEA  514

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V+QENFDKGLI+PPF+NIRKISA+IAA+VAAKAY+LGLA+RLP+P++LV YAESCM
Sbjct  515  LAEQVSQENFDKGLIFPPFTNIRKISANIAAKVAAKAYDLGLASRLPRPDDLVKYAESCM  574

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  575  YTPLYRSYR  583



>ref|XP_008445000.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
Length=589

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L  AV+AIKPTVLIG+SG G+TFTK+V+ AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  401  LYGAVQAIKPTVLIGTSGVGKTFTKEVVEAMASFNEKPLILALSNPTSQSECTAEEAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  461  SQGRAIFASGSPFDPVEYDGKAFVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPF+NIRKISA+IAA VAAKAYELGLA+RLP+P++LV +AESCM
Sbjct  521  LAAQVSQENYDKGLIYPPFTNIRKISANIAAEVAAKAYELGLASRLPRPKDLVKFAESCM  580

Query  216  YSPTYRSY  193
            YSP YRSY
Sbjct  581  YSPRYRSY  588



>tpg|DAA57813.1| TPA: malic enzyme [Zea mays]
Length=571

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFTKDV+ A++SFNE+PI+LALSNPTSQSECTAE+AYTW
Sbjct  383  LLDAVNAIKPTVLIGTSGKGQTFTKDVVEAISSFNERPIILALSNPTSQSECTAEQAYTW  442

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+A+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  443  SKGQAVFATGSPFDPVEYNGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  502

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  503  LAQQVTEENFEKGLIYPPFSNIRKISAHIAASVAAKAYELGLASRRPRPKDLVKYAESCM  562

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  563  YSPIYRNYR  571



>ref|XP_008220115.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Prunus mume]
Length=592

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG G+TFT++V+  MAS NEKP++LALSNPTSQSECTAEEAY W
Sbjct  404  LVDAVKAIKPTVLIGTSGVGKTFTREVVETMASLNEKPLILALSNPTSQSECTAEEAYAW  463

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY+ + L+ GQANNAYIFPGFGLGLI++GAIRVHDDMLLAASEA
Sbjct  464  TKGRAIFASGSPFDPVEYEKKLLVPGQANNAYIFPGFGLGLIMAGAIRVHDDMLLAASEA  523

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQEN+DKGLIYPPF+NIRKISA+IAA+VAAK YELGLA+ LP+P++LV YAESCM
Sbjct  524  LAAQVTQENYDKGLIYPPFTNIRKISANIAAKVAAKVYELGLASNLPRPKDLVKYAESCM  583

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  584  YSPLYRSYR  592



>ref|XP_008220114.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Prunus mume]
Length=614

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG G+TFT++V+  MAS NEKP++LALSNPTSQSECTAEEAY W
Sbjct  426  LVDAVKAIKPTVLIGTSGVGKTFTREVVETMASLNEKPLILALSNPTSQSECTAEEAYAW  485

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY+ + L+ GQANNAYIFPGFGLGLI++GAIRVHDDMLLAASEA
Sbjct  486  TKGRAIFASGSPFDPVEYEKKLLVPGQANNAYIFPGFGLGLIMAGAIRVHDDMLLAASEA  545

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQEN+DKGLIYPPF+NIRKISA+IAA+VAAK YELGLA+ LP+P++LV YAESCM
Sbjct  546  LAAQVTQENYDKGLIYPPFTNIRKISANIAAKVAAKVYELGLASNLPRPKDLVKYAESCM  605

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  606  YSPLYRSYR  614



>ref|XP_003630727.1| Malic enzyme [Medicago truncatula]
 gb|AET05203.1| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=591

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIGSSG G+TFTK+V+ AM   N+ P++LALSNPTSQSECTAEEAYTW
Sbjct  403  LLDAVKIIKPTVLIGSSGVGKTFTKEVVEAMTEINKIPLILALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+T  SGQ+NNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  463  SEGRAIFASGSPFDPVEYKGKTYYSGQSNNAYIFPGFGLGIVMSGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+EN+ KGL YPPFS+IRKISA+IAA VAAKAYELGLAT LP+PENLV YAESCM
Sbjct  523  LAKQVTEENYKKGLTYPPFSDIRKISANIAANVAAKAYELGLATHLPRPENLVKYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  583  YSPLYRNYR  591



>gb|KJB18586.1| hypothetical protein B456_003G061800 [Gossypium raimondii]
Length=645

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAV   KPTVLIG+SG GRTFTK+V+ AMA+ N++PI+ +LSNPTSQSECTAEEAYTW
Sbjct  457  LVDAVNGTKPTVLIGTSGVGRTFTKEVVEAMAALNDRPIIFSLSNPTSQSECTAEEAYTW  516

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+GR  + GQANNAYIFPGFGLGLI+SGAIRVHDDMLL A+EA
Sbjct  517  SKGRAIFASGSPFDPVEYEGRVFVPGQANNAYIFPGFGLGLIMSGAIRVHDDMLLEAAEA  576

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQENFDKGLIYPPF NIR+ISA+IAA VAAKAYELGLATR P+P++LV YAESCM
Sbjct  577  LAAQVTQENFDKGLIYPPFKNIRQISANIAANVAAKAYELGLATRQPRPKDLVKYAESCM  636

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  637  YNPAYRSYR  645



>ref|XP_004148395.1| PREDICTED: NADP-dependent malic enzyme-like [Cucumis sativus]
Length=631

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L  AV+AIKPTVLIG+SG G+TFTK+V+ AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  443  LYGAVQAIKPTVLIGTSGVGKTFTKEVVEAMASFNEKPLILALSNPTSQSECTAEEAYTW  502

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  503  SQGRAIFASGSPFDPVEYDGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  562

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPF+NIRKISA+IAA+VAAKAYELGLA+RLP+P++LV +AESCM
Sbjct  563  LAAQVSQENYDKGLIYPPFTNIRKISANIAAKVAAKAYELGLASRLPRPKDLVKFAESCM  622

Query  216  YSPTYRSY  193
            YSP YRSY
Sbjct  623  YSPRYRSY  630



>gb|AAT02533.1| NADP-dependent malic enzyme 1 [Hydrilla verticillata]
Length=654

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIGSSG    FT+DV+ AMASFNEKP++ ALSNPTS SECTAE+AYTW
Sbjct  466  LLDAVKMIKPTVLIGSSGVPNKFTQDVVEAMASFNEKPVIFALSNPTSNSECTAEQAYTW  525

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+T  SGQANNAYIFPGFGLGL++SGAIRVHDDMLLAASEA
Sbjct  526  SKGRAIFASGSPFDPVEYEGQTYTSGQANNAYIFPGFGLGLVMSGAIRVHDDMLLAASEA  585

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPF+NIRKISA+IAA+VAAKAYELGL+  LP+PENLV YAESCM
Sbjct  586  LAEQVTEENFEKGLIYPPFTNIRKISANIAAKVAAKAYELGLSGHLPRPENLVEYAESCM  645

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  646  YSPVYRSYR  654



>ref|XP_009616524.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009616525.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009616526.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nicotiana 
tomentosiformis]
Length=592

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+  MAS N KP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  404  LIDAVKAIKPTVLIGTSGVGKTFTKEVVETMASLNPKPLIMALSNPTSQAECTAEEAYTW  463

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF PFEY+GRT +SGQANNAYIFPGFGLG+I+SG IRVHDDMLLAASEA
Sbjct  464  SKGHAIFASGSPFDPFEYEGRTFVSGQANNAYIFPGFGLGIIMSGTIRVHDDMLLAASEA  523

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E++ KG IYPPF+NIRKISAHIAA VAAKAYELGLATRLP+P NL  YAESCM
Sbjct  524  LAAQVTEEDYLKGRIYPPFTNIRKISAHIAAEVAAKAYELGLATRLPRPTNLEKYAESCM  583

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  584  YTPVYRTYR  592



>ref|XP_007160295.1| hypothetical protein PHAVU_002G309600g [Phaseolus vulgaris]
 gb|ESW32289.1| hypothetical protein PHAVU_002G309600g [Phaseolus vulgaris]
Length=650

 Score =   305 bits (780),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVLIGSSG G+TFTK+V+ AM S N+KP++LALSNPTSQSECTAEEAY W
Sbjct  462  LLEAVKVIKPTVLIGSSGVGKTFTKEVVEAMTSNNDKPLILALSNPTSQSECTAEEAYQW  521

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGR IFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  522  SEGRTIFASGSPFDPVEYKGKVYASGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  581

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++EN+  GLIYPPFSNIRKISA+IAA VAAKAYELGLATRLP+P+NLV YAESCM
Sbjct  582  LAKQVSEENYKNGLIYPPFSNIRKISANIAANVAAKAYELGLATRLPRPQNLVEYAESCM  641

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  642  YTPVYRNYR  650



>ref|NP_001152396.1| LOC100286036 [Zea mays]
 gb|ACG47397.1| NADP-dependent malic enzyme [Zea mays]
Length=593

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFTKDV+ A++SFNE+PI+LALSNPTSQSECTAE+AYTW
Sbjct  405  LLDAVNAIKPTVLIGTSGKGQTFTKDVVEAISSFNERPIILALSNPTSQSECTAEQAYTW  464

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+A+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  465  SKGQAVFATGSPFDPVEYNGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  524

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  525  LAQQVTEENFEKGLIYPPFSNIRKISAHIAASVAAKAYELGLASRRPRPKDLVKYAESCM  584

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  585  YSPIYRNYR  593



>tpg|DAA57814.1| TPA: malic enzyme [Zea mays]
Length=593

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFTKDV+ A++SFNE+PI+LALSNPTSQSECTAE+AYTW
Sbjct  405  LLDAVNAIKPTVLIGTSGKGQTFTKDVVEAISSFNERPIILALSNPTSQSECTAEQAYTW  464

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+A+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  465  SKGQAVFATGSPFDPVEYNGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  524

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  525  LAQQVTEENFEKGLIYPPFSNIRKISAHIAASVAAKAYELGLASRRPRPKDLVKYAESCM  584

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  585  YSPIYRNYR  593



>gb|ACI46151.1| NADP-dependent malic enzyme [Hordeum vulgare]
Length=570

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AV++IKPTVLIG+SG G+TFT++VI AMASFNEKP++ +LSNPTS SECTAEEAYTW
Sbjct  382  LLEAVQSIKPTVLIGTSGVGKTFTQEVIEAMASFNEKPVIFSLSNPTSHSECTAEEAYTW  441

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G A+FASGSPF P EY+G+T + GQ+NNAY+FPGFGLG++ISGAIRVHDDMLLAASEA
Sbjct  442  SKGTAVFASGSPFDPVEYEGKTYVPGQSNNAYVFPGFGLGVVISGAIRVHDDMLLAASEA  501

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLI+PPF+NIRKISA+IAA+VAAKAY+LGLA+RLP+P++LV YAESCM
Sbjct  502  LAEQVTQENFDKGLIFPPFTNIRKISANIAAKVAAKAYDLGLASRLPRPDDLVKYAESCM  561

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  562  YTPLYRSYR  570



>emb|CDM84157.1| unnamed protein product [Triticum aestivum]
Length=593

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFT++V+ A++SFNE PI+LALSNPTSQ+ECTAE+AYTW
Sbjct  405  LLDAVNAIKPTVLIGTSGKGQTFTQEVVEAISSFNEMPIILALSNPTSQAECTAEQAYTW  464

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  465  SKGRAVFATGSPFDPVEYNGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  524

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  525  LAQQVTQENFDKGLIYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  584

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  585  YSPIYRNYR  593



>gb|ACL54508.1| unknown [Zea mays]
Length=593

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFTKDV+ A++SFNE+PI+LALSNPTSQSECTAE+AYTW
Sbjct  405  LLDAVNAIKPTVLIGTSGKGQTFTKDVVEAISSFNERPIILALSNPTSQSECTAEQAYTW  464

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+A+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAAS A
Sbjct  465  SKGQAVFATGSPFDPVEYNGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASVA  524

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  525  LAQQVTEENFEKGLIYPPFSNIRKISAHIAASVAAKAYELGLASRRPRPKDLVKYAESCM  584

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  585  YSPIYRNYR  593



>gb|EYU20414.1| hypothetical protein MIMGU_mgv1a003353mg [Erythranthe guttata]
Length=590

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+ AM+S NEKP++L+LSNPTSQSECTAEEAYTW
Sbjct  402  LLDAVKAIKPTVLIGTSGVGKTFTKEVVEAMSSINEKPVILSLSNPTSQSECTAEEAYTW  461

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+T + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  462  SEGRAIFASGSPFDPVEYNGQTFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  521

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+  +EN+ KGLIYPPF+NIRKISAHIAA VAAKAYELGLA+RLP+P++LVA+AESCM
Sbjct  522  LAAQAMEENYAKGLIYPPFTNIRKISAHIAANVAAKAYELGLASRLPRPKDLVAFAESCM  581

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  582  YTPVYRNYR  590



>ref|XP_004503480.1| PREDICTED: NADP-dependent malic enzyme-like [Cicer arietinum]
Length=591

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIGSSG G+TFTK+VI AM S NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  403  LIDAVKVIKPTVLIGSSGVGKTFTKEVIEAMTSNNEKPLILALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+   SGQ+NNAYIFPGFGLGL++SGAIRVHDDMLLAASE+
Sbjct  463  SEGRAIFASGSPFDPVEYNGKVYYSGQSNNAYIFPGFGLGLVMSGAIRVHDDMLLAASES  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT++++ KGL YPPFS+IRKISA+IAA VAAKAYELGLAT LP+PENLV YAESCM
Sbjct  523  LAKQVTEKDYAKGLTYPPFSDIRKISANIAANVAAKAYELGLATHLPRPENLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  583  YTPLYRNYR  591



>ref|XP_008369782.1| PREDICTED: NADP-dependent malic enzyme-like [Malus domestica]
Length=404

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIGSSG GRTFTK+VI A++SFNEKP++LALSNPTSQSECTAEEAYT+
Sbjct  216  LLDAVKAIKPTVLIGSSGVGRTFTKEVIEAVSSFNEKPLILALSNPTSQSECTAEEAYTY  275

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S GRAIFASGSPF P EYK +  + GQ+NNAYIFPGFGLGL+ISGAIRVHDDMLLAASEA
Sbjct  276  SVGRAIFASGSPFDPVEYKDKVFVPGQSNNAYIFPGFGLGLVISGAIRVHDDMLLAASEA  335

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V +ENF +GLIYP  SNIRKISA +AA VAAKAY+LG+ATRLP+PENLV +AESCM
Sbjct  336  LAGQVFEENFAQGLIYPXLSNIRKISAQVAANVAAKAYDLGVATRLPRPENLVKHAESCM  395

Query  216  YSPTYRSYR  190
            YSP YR+ R
Sbjct  396  YSPVYRNXR  404



>gb|AAK83074.1|AF288921_1 putative cytosolic NADP-malic enzyme [Flaveria pringlei]
Length=589

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKP+VLIG+SG G+TFT+DV+ AMA+FNE+P+++ALSNPTSQ+ECTAE+AYTW
Sbjct  401  LLDAVKAIKPSVLIGTSGVGQTFTQDVVEAMAAFNERPLIMALSNPTSQAECTAEQAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIF+SGSPF P+EYKG   + GQANNAYIFPG G GL+ISGAIRVHD+MLLAASEA
Sbjct  461  TQGRAIFSSGSPFDPYEYKGNLFIPGQANNAYIFPGLGFGLVISGAIRVHDEMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE++DKG+IYPP +NIRKISAHIAA VAAKAY+LGLATRLP+P +LV YAESCM
Sbjct  521  LANQVTQEHYDKGMIYPPLTNIRKISAHIAANVAAKAYDLGLATRLPRPADLVKYAESCM  580

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  581  YTPNYRSYR  589



>gb|ACX50497.1| NADP-dependent malic enzyme [Zea mays]
Length=608

 Score =   303 bits (775),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFTKDV+ A++SFNE+PI+LALSNPTSQSECTAE+AYTW
Sbjct  420  LLDAVNAIKPTVLIGTSGKGQTFTKDVVEAISSFNERPIILALSNPTSQSECTAEQAYTW  479

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+A+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  480  SKGQAVFATGSPFDPVEYNGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  539

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  540  LAQQVTEENFEKGLIYPPFSNIRKISAHIAASVAAKAYELGLASRRPRPKDLVKYAESCM  599

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  600  YSPIYRNYR  608



>gb|ABR26108.1| NADP-dependent malic enzyme [Oryza sativa Indica Group]
Length=187

 Score =   289 bits (739),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -1

Query  741  KAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTWSEGRA  562
            K   PTVLIG+SG G+TFT++V+ A++SFNE+P++ ALSNPTSQSECTAE+AYTWS+GRA
Sbjct  4    KLSNPTVLIGTSGKGQTFTQEVVEAISSFNERPVIFALSNPTSQSECTAEQAYTWSKGRA  63

Query  561  IFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasealaaEV  382
            +FASGSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEALA +V
Sbjct  64   VFASGSPFDPVEYDGKIYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEALAQQV  123

Query  381  TQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCMYSPTY  202
            TQENFDKGL YPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCMYSP Y
Sbjct  124  TQENFDKGLTYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCMYSPLY  183

Query  201  RSYR  190
            R+YR
Sbjct  184  RNYR  187



>gb|AFK40116.1| unknown [Medicago truncatula]
Length=591

 Score =   302 bits (773),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIGSSG G+TFTK+V+ AM   N+ P++LALSNPTSQSECTAEEAYTW
Sbjct  403  LLDAVKIIKPTVLIGSSGVGKTFTKEVVEAMTEINKIPLILALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+T  SGQ+NNAYIFPGFGLG+++SGAIRVHDDM LAASEA
Sbjct  463  SEGRAIFASGSPFDPVEYKGKTYYSGQSNNAYIFPGFGLGIVMSGAIRVHDDMPLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+EN+ KGL YPPFS+IRKISA+IAA VAAKAYELGLAT LP+PENLV YAESCM
Sbjct  523  LAKQVTEENYKKGLTYPPFSDIRKISANIAANVAAKAYELGLATHLPRPENLVEYAESCM  582

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  583  YSPLYRNYR  591



>gb|EEC71406.1| hypothetical protein OsI_03572 [Oryza sativa Indica Group]
 gb|EEE55314.1| hypothetical protein OsJ_03305 [Oryza sativa Japonica Group]
Length=593

 Score =   302 bits (773),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG G+TFT++V+ A++SFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  405  LLDAVKTIKPTVLIGTSGKGQTFTQEVVEAISSFNERPVIFALSNPTSQSECTAEQAYTW  464

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FASGSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  465  SKGRAVFASGSPFDPVEYDGKIYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  524

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL YPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  525  LAQQVTQENFDKGLTYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  584

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  585  YSPLYRNYR  593



>ref|XP_009616523.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Nicotiana 
tomentosiformis]
Length=624

 Score =   303 bits (775),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+  MAS N KP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  436  LIDAVKAIKPTVLIGTSGVGKTFTKEVVETMASLNPKPLIMALSNPTSQAECTAEEAYTW  495

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF PFEY+GRT +SGQANNAYIFPGFGLG+I+SG IRVHDDMLLAASEA
Sbjct  496  SKGHAIFASGSPFDPFEYEGRTFVSGQANNAYIFPGFGLGIIMSGTIRVHDDMLLAASEA  555

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E++ KG IYPPF+NIRKISAHIAA VAAKAYELGLATRLP+P NL  YAESCM
Sbjct  556  LAAQVTEEDYLKGRIYPPFTNIRKISAHIAAEVAAKAYELGLATRLPRPTNLEKYAESCM  615

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  616  YTPVYRTYR  624



>gb|AEM44701.1| NADP-malic protein [Hordeum vulgare subsp. spontaneum]
Length=222

 Score =   290 bits (741),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DA+++IKPTVLIG+SG GR FTK+V+ AMASFNE+P++ +LSNPTS SECTAEEAY W
Sbjct  34   LLDAIESIKPTVLIGTSGVGRAFTKEVVEAMASFNERPVIFSLSNPTSHSECTAEEAYNW  93

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRA+FASGSPF P E+ G+  + GQANNAYIFPGFGLG++ISGAIRVH+DMLLAASE 
Sbjct  94   TQGRAVFASGSPFDPVEHNGKIHVPGQANNAYIFPGFGLGVVISGAIRVHEDMLLAASET  153

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+ TQENFDKG I+PPF+NIRKISA IAA VAAKAYELGLATRLP+P +L  YAESCM
Sbjct  154  LAAQATQENFDKGSIFPPFTNIRKISALIAASVAAKAYELGLATRLPRPRDLEKYAESCM  213

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  214  YTPVYRSYR  222



>ref|XP_010325075.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Solanum 
lycopersicum]
Length=591

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+ AMAS N KP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  403  LIDAVKAIKPTVLIGTSGVGKTFTKEVVEAMASLNPKPLIMALSNPTSQAECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF P E++GRT +SGQANNAY+FPGFGLG+I+SG IRVHDDMLLAASEA
Sbjct  463  SKGHAIFASGSPFDPVEFEGRTFVSGQANNAYVFPGFGLGIIMSGTIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+EVT++++ KG IYPPF+NIRKISAHIAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  523  LASEVTEDDYLKGRIYPPFTNIRKISAHIAAEVAAKAYELGLATRLPRPSDLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  583  YTPLYRSYR  591



>ref|XP_006644644.1| PREDICTED: NADP-dependent malic enzyme-like [Oryza brachyantha]
Length=593

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKP+VLIG+SG G+TFTK+V+ A++S NE+P++LALSNPTSQSECTAE+AYTW
Sbjct  405  LLDAVNTIKPSVLIGTSGKGQTFTKEVVEAISSINERPVILALSNPTSQSECTAEQAYTW  464

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA++ASGSPF P EY G+T + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  465  SKGRAVYASGSPFDPVEYDGKTYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  524

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  525  LAQQVTQENFDKGLIYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  584

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  585  YSPIYRNYR  593



>dbj|BAB20887.2| NADP dependent malic enzyme [Oryza sativa Japonica Group]
Length=593

 Score =   301 bits (772),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG G+TFT++V+ A++SFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  405  LLDAVKTIKPTVLIGTSGKGQTFTQEVVEAISSFNERPVIFALSNPTSQSECTAEQAYTW  464

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FASGSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  465  SKGRAVFASGSPFDPVEYDGKIYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  524

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL YPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  525  LAQQVTQENFDKGLTYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  584

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  585  YSPLYRNYR  593



>ref|NP_001044107.1| Os01g0723400 [Oryza sativa Japonica Group]
 dbj|BAF06021.1| Os01g0723400, partial [Oryza sativa Japonica Group]
Length=592

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG G+TFT++V+ A++SFNE+P++ ALSNPTSQSECTAE+AYTW
Sbjct  404  LLDAVKTIKPTVLIGTSGKGQTFTQEVVEAISSFNERPVIFALSNPTSQSECTAEQAYTW  463

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FASGSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  464  SKGRAVFASGSPFDPVEYDGKIYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  523

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGL YPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  524  LAQQVTQENFDKGLTYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  583

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  584  YSPLYRNYR  592



>ref|XP_003525285.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Glycine 
max]
Length=633

 Score =   303 bits (775),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVK IKPTVLIGSSG GRTFTK+V+ AM S N+KP++LALSNPTSQSECTAEEAY W
Sbjct  445  LLEAVKVIKPTVLIGSSGVGRTFTKEVVEAMTSNNDKPLILALSNPTSQSECTAEEAYQW  504

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASE+
Sbjct  505  SEGRAIFASGSPFDPVEYKGKVYASGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASES  564

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++EN+  GLIYPPFSNIR+ISA+IAA VAAKAYELGLATRLP+P+NLV  AESCM
Sbjct  565  LAKQVSEENYKNGLIYPPFSNIRRISANIAANVAAKAYELGLATRLPRPQNLVKCAESCM  624

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  625  YTPVYRNYR  633



>ref|XP_004969797.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Setaria 
italica]
Length=590

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFT+DVI A++SFNE+PI+L+LSNPTSQSECTAE+AYTW
Sbjct  402  LLDAVNAIKPTVLIGTSGKGQTFTQDVIEAISSFNERPIILSLSNPTSQSECTAEQAYTW  461

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  462  SKGRAVFATGSPFDPVEYDGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  521

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  522  LAQQVSEENFEKGLIYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  581

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  582  YSPVYRNYR  590



>ref|XP_007137244.1| hypothetical protein PHAVU_009G111500g [Phaseolus vulgaris]
 gb|ESW09238.1| hypothetical protein PHAVU_009G111500g [Phaseolus vulgaris]
Length=589

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  401  LLEAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SGAIRV D+MLLAASEA
Sbjct  461  SKGRAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIMSGAIRVRDEMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V++EN+DKGLIYPPF+NIRKISA+IAA+VAAKAY+LGLA+ LP+P++LV YAESCM
Sbjct  521  LAAQVSEENYDKGLIYPPFTNIRKISANIAAKVAAKAYDLGLASHLPRPKDLVKYAESCM  580

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  581  YSPGYRSYR  589



>gb|EYU29291.1| hypothetical protein MIMGU_mgv1a002717mg [Erythranthe guttata]
Length=644

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIG+SG G+TFTK+V+ AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  456  LLAAVKAIKPTVLIGTSGVGQTFTKEVVEAMASMNEKPLILALSNPTSQSECTAEEAYTW  515

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SG IRVHDDMLLAASEA
Sbjct  516  SEGRAIFASGSPFDPVEYNGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDMLLAASEA  575

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+EN+ KGLIYPPF+NIRKISAHIAA+VAAK+YELGLA+RLP+PE+LV YAESCM
Sbjct  576  LAAQVTEENYAKGLIYPPFTNIRKISAHIAAKVAAKSYELGLASRLPRPEDLVKYAESCM  635

Query  216  YSPTYRSYR  190
            Y+P Y  YR
Sbjct  636  YTPIYGKYR  644



>emb|CAA56354.1| NADP dependent malic enzyme [Phaseolus vulgaris]
Length=589

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  401  LLEAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SGAIRV D+MLLAASEA
Sbjct  461  SKGRAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIMSGAIRVRDEMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V++EN+DKGLIYPPF+NIRKISA+IAA+VAAKAY+LGLA+ LP+P++LV YAESCM
Sbjct  521  LAAQVSEENYDKGLIYPPFTNIRKISANIAAKVAAKAYDLGLASHLPRPKDLVKYAESCM  580

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  581  YSPGYRSYR  589



>gb|KHN05334.1| NADP-dependent malic enzyme, chloroplastic [Glycine soja]
Length=588

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK IKPTVLIG+SG GRTFTKDVI AMAS NEKPI+L+LSNPTSQSECTAEEAYTW
Sbjct  400  LVDAVKEIKPTVLIGTSGQGRTFTKDVIEAMASINEKPIILSLSNPTSQSECTAEEAYTW  459

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  460  SQGRAIFASGSPFAPVEYDGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  519

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++VTQ+++DKGLIYPPFSNIRKISA IAA VAAKAYELGLAT LPQP++LV +AES M
Sbjct  520  LASQVTQKDYDKGLIYPPFSNIRKISARIAANVAAKAYELGLATSLPQPKDLVKFAESSM  579

Query  216  YSPTYRSYR  190
            Y+P YR YR
Sbjct  580  YTPLYRGYR  588



>ref|XP_004510309.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Cicer arietinum]
Length=634

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG G+TFT++V+ AMAS NEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  446  LLDAVNQIKPTVLIGTSGQGKTFTREVVEAMASNNEKPIILALSNPTSQSECTAEEAYTW  505

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  506  TQGRAIFASGSPFAPVEYDGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  565

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++VTQE++++GLI+PPF+NIRKISAHIAA+VA+KAYELGLATRLPQP++LV YAESCM
Sbjct  566  LASQVTQEDYNRGLIFPPFTNIRKISAHIAAKVASKAYELGLATRLPQPKDLVLYAESCM  625

Query  216  YSPTYRSYR  190
            Y+PTYR+YR
Sbjct  626  YTPTYRNYR  634



>ref|XP_007222062.1| hypothetical protein PRUPE_ppa003210mg [Prunus persica]
 gb|EMJ23261.1| hypothetical protein PRUPE_ppa003210mg [Prunus persica]
Length=592

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG G+TFT++V+  MAS NEKP++LALSNPTSQSECTAEEAY W
Sbjct  404  LVDAVKAIKPTVLIGTSGVGKTFTREVVETMASLNEKPLILALSNPTSQSECTAEEAYAW  463

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EY+ + L+ GQANNAYIFPGFGLGLI++GAIRVHDDMLLAASEA
Sbjct  464  TKGRAIFASGSPFDPVEYEKKLLVPGQANNAYIFPGFGLGLIMAGAIRVHDDMLLAASEA  523

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VTQEN+DKG+IYPPF+NIRKISA+IAA+VAAK YELGLA+ LP+P+ LV YAESCM
Sbjct  524  LAAQVTQENYDKGMIYPPFTNIRKISANIAAKVAAKVYELGLASNLPRPKYLVKYAESCM  583

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  584  YSPLYRSYR  592



>dbj|BAJ95153.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DA+++IKPTVLIG+SG GR FTK+V+ AMASFNE+P++ +LSNPTS SECTAEEAY W
Sbjct  78   LLDAIESIKPTVLIGTSGVGRAFTKEVVEAMASFNERPVIFSLSNPTSHSECTAEEAYNW  137

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRA+FASGSPF P E+ G+  + GQANNAYIFPGFGLG++ISGAIRVH+DMLLAASE 
Sbjct  138  TQGRAVFASGSPFDPVEHNGKIHVPGQANNAYIFPGFGLGVVISGAIRVHEDMLLAASET  197

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+ TQENFDKG I+PPF+NIRKISA IAA VAAKAYELGLATRLP+P +L  YAESCM
Sbjct  198  LAAQATQENFDKGSIFPPFTNIRKISALIAASVAAKAYELGLATRLPRPRDLEKYAESCM  257

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  258  YTPVYRSYR  266



>ref|XP_010325074.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Solanum 
lycopersicum]
Length=620

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+ AMAS N KP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  432  LIDAVKAIKPTVLIGTSGVGKTFTKEVVEAMASLNPKPLIMALSNPTSQAECTAEEAYTW  491

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF P E++GRT +SGQANNAY+FPGFGLG+I+SG IRVHDDMLLAASEA
Sbjct  492  SKGHAIFASGSPFDPVEFEGRTFVSGQANNAYVFPGFGLGIIMSGTIRVHDDMLLAASEA  551

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+EVT++++ KG IYPPF+NIRKISAHIAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  552  LASEVTEDDYLKGRIYPPFTNIRKISAHIAAEVAAKAYELGLATRLPRPSDLVKYAESCM  611

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  612  YTPLYRSYR  620



>ref|XP_003569705.1| PREDICTED: NADP-dependent malic enzyme-like [Brachypodium distachyon]
Length=659

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFT++V+ A++SFNE PI+LALSNPTSQ+ECTAE+AYTW
Sbjct  471  LLDAVNAIKPTVLIGTSGKGQTFTQEVVEAISSFNEMPIILALSNPTSQAECTAEQAYTW  530

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  531  SKGRAVFATGSPFDPVEYNGKMYVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  590

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENFDKGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  591  LAQQVTQENFDKGLIYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  650

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  651  YSPIYRNYR  659



>ref|XP_007137243.1| hypothetical protein PHAVU_009G111500g [Phaseolus vulgaris]
 gb|ESW09237.1| hypothetical protein PHAVU_009G111500g [Phaseolus vulgaris]
Length=615

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  427  LLEAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  486

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SGAIRV D+MLLAASEA
Sbjct  487  SKGRAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIMSGAIRVRDEMLLAASEA  546

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V++EN+DKGLIYPPF+NIRKISA+IAA+VAAKAY+LGLA+ LP+P++LV YAESCM
Sbjct  547  LAAQVSEENYDKGLIYPPFTNIRKISANIAAKVAAKAYDLGLASHLPRPKDLVKYAESCM  606

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  607  YSPGYRSYR  615



>dbj|BAC54101.1| cytosolic NADP-malic enzyme [Lithospermum erythrorhizon]
Length=577

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GR FTK+V+ AMASFNEKP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  389  LLDAVKDIKPTVLIGTSGVGRQFTKEVVEAMASFNEKPLIMALSNPTSQAECTAEEAYTW  448

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIF+SGSPF P EY G+  + GQANN YIFPG G GL+ISGAIRVHDDMLLAASEA
Sbjct  449  SEGRAIFSSGSPFDPVEYNGKVFVPGQANNCYIFPGLGFGLLISGAIRVHDDMLLAASEA  508

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT E++ KGLIYPPFS+IRKISA+IAA+VAAKAYELG+ATRLP+PENLV YAE CM
Sbjct  509  LANQVTDEHYAKGLIYPPFSDIRKISANIAAKVAAKAYELGVATRLPRPENLVEYAERCM  568

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  569  YSPIYRTYR  577



>gb|KEH36085.1| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=578

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVKAIKPTVLIGSSG G+TFTK+V+ AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  390  LLNAVKAIKPTVLIGSSGVGKTFTKEVVEAMASLNEKPLILALSNPTSQSECTAEEAYTW  449

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+AIFASGSPF P EY+G+  + GQ+NNAYIFPGFGLGLIISGAIRV D+MLLAASEA
Sbjct  450  SKGKAIFASGSPFDPVEYEGKVFVPGQSNNAYIFPGFGLGLIISGAIRVRDEMLLAASEA  509

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V+QEN+DKGLIYPPF+NIRKISA+IAA VAAK YELGLA+ LP+P++LV YAESCM
Sbjct  510  LAAQVSQENYDKGLIYPPFTNIRKISANIAASVAAKTYELGLASHLPRPKDLVKYAESCM  569

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  570  YSPGYRSYR  578



>ref|XP_006364722.1| PREDICTED: NADP-dependent malic enzyme-like [Solanum tuberosum]
Length=591

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+ AMAS N KP+++ALSNPTSQ+ECTA+EAYTW
Sbjct  403  LIDAVKAIKPTVLIGTSGVGKTFTKEVVEAMASLNPKPLIMALSNPTSQAECTADEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF P E++GRT +SGQANNAY+FPGFGLG+I+SG IRVHDDMLLAASEA
Sbjct  463  SKGHAIFASGSPFDPVEFEGRTFVSGQANNAYVFPGFGLGIIMSGTIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA+EVT++++ KG IYPPF+NIRKISAHIAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  523  LASEVTEDDYLKGRIYPPFTNIRKISAHIAAEVAAKAYELGLATRLPRPSDLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  583  YTPLYRSYR  591



>ref|XP_011078255.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
Length=591

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPT LIG+SG G+TFTK+V+ A+ASFN+KP+++ALSNPTSQSECTAEEAYTW
Sbjct  403  LLDAVKAIKPTALIGTSGVGKTFTKEVVEAIASFNQKPLIMALSNPTSQSECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            +EGRAIFASGSPF P E+ G+  + GQANNAYIFPG G GL+ISGAIRVHDDMLLAASEA
Sbjct  463  TEGRAIFASGSPFNPVEFNGKRFVPGQANNAYIFPGLGFGLVISGAIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V  E+ DKG+IYPPFSNIRKISAHIAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  523  LAGQVRDEHCDKGMIYPPFSNIRKISAHIAANVAAKAYELGLATRLPRPADLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P+YRSYR
Sbjct  583  YTPSYRSYR  591



>gb|KEH39546.1| NADP-dependent malic enzyme-like protein [Medicago truncatula]
Length=675

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV  IKPTVLIG+SG G  FTK+V+ AMAS NEKPI+L+LSNPTSQSECTAEEAYTW
Sbjct  487  LLDAVNKIKPTVLIGTSGQGSAFTKEVVEAMASINEKPIILSLSNPTSQSECTAEEAYTW  546

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIFASGSPF P EYKG+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  547  TQGRAIFASGSPFSPVEYKGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  606

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++ENF+KGLI+PPF+NIRKISAHIAA+VAAKAYELGLATRLPQP++LV +AESCM
Sbjct  607  LAEQVSEENFEKGLIFPPFTNIRKISAHIAAKVAAKAYELGLATRLPQPKDLVKFAESCM  666

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  667  YTPAYRSYR  675



>dbj|BAA24950.1| NADP-malic enzyme [Aloe arborescens]
Length=592

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVK IKPTVLIGSSG GRTFTK+VI AM+SF EKP++LALSNPTSQSECTAEEAYTW
Sbjct  404  LLGAVKTIKPTVLIGSSGVGRTFTKEVIEAMSSFTEKPVILALSNPTSQSECTAEEAYTW  463

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P  Y G+  + GQANNAYIFPG GLGL+ISGAIRVHDDMLLAASEA
Sbjct  464  SKGRAIFASGSPFDPVLYNGKLFVPGQANNAYIFPGLGLGLVISGAIRVHDDMLLAASEA  523

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQENF  GLIYPPFS IRKISA IAA VAAKAYELGLATRLP+P +LV YAESCM
Sbjct  524  LAQQVTQENFANGLIYPPFSIIRKISAQIAANVAAKAYELGLATRLPRPADLVKYAESCM  583

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  584  YTPAYRSYR  592



>sp|P37223.1|MAOX_MESCR RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME [Mesembryanthemum 
crystallinum]
 emb|CAA45772.1| NADP-malic enzyme [Mesembryanthemum crystallinum]
Length=585

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV+AIKPTVLIG+SG G+ FTK+V+ AMA+ N KP++LALSNPTSQSECTAEEAYTW
Sbjct  397  LIDAVQAIKPTVLIGTSGKGKQFTKEVVEAMANINAKPLILALSNPTSQSECTAEEAYTW  456

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF P EY+GRT + GQANNAYIFPGFGLGLI+ GAIRVHDDMLLAASEA
Sbjct  457  SQGHAIFASGSPFDPVEYEGRTFVPGQANNAYIFPGFGLGLIMCGAIRVHDDMLLAASEA  516

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++VT E+F KGLIYPPF +IRKISAHIAA VAAKAYELGLA+RLPQP +LV +AESCM
Sbjct  517  LASQVTGEHFIKGLIYPPFKDIRKISAHIAAGVAAKAYELGLASRLPQPADLVKFAESCM  576

Query  216  YSPTYRSYR  190
            Y+PTYRS+R
Sbjct  577  YNPTYRSFR  585



>tpg|DAA57815.1| TPA: malic enzyme [Zea mays]
Length=664

 Score =   301 bits (772),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFTKDV+ A++SFNE+PI+LALSNPTSQSECTAE+AYTW
Sbjct  476  LLDAVNAIKPTVLIGTSGKGQTFTKDVVEAISSFNERPIILALSNPTSQSECTAEQAYTW  535

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G+A+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  536  SKGQAVFATGSPFDPVEYNGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  595

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  596  LAQQVTEENFEKGLIYPPFSNIRKISAHIAASVAAKAYELGLASRRPRPKDLVKYAESCM  655

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  656  YSPIYRNYR  664



>ref|XP_003533042.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Glycine max]
Length=641

 Score =   301 bits (770),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVK IKPTVLIG+SG GRTFTKDVI AMAS NEKPI+L+LSNPTSQSECTAEEAYTW
Sbjct  453  LVDAVKEIKPTVLIGTSGQGRTFTKDVIEAMASINEKPIILSLSNPTSQSECTAEEAYTW  512

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  513  SQGRAIFASGSPFAPVEYDGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  572

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++VTQ+++DKGLIYPPFSNIRKISA IAA VAAKAYELGLAT LPQP++LV +AES M
Sbjct  573  LASQVTQKDYDKGLIYPPFSNIRKISARIAANVAAKAYELGLATSLPQPKDLVKFAESSM  632

Query  216  YSPTYRSYR  190
            Y+P YR YR
Sbjct  633  YTPLYRGYR  641



>ref|XP_004969796.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Setaria 
italica]
Length=652

 Score =   301 bits (770),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAV AIKPTVLIG+SG G+TFT+DVI A++SFNE+PI+L+LSNPTSQSECTAE+AYTW
Sbjct  464  LLDAVNAIKPTVLIGTSGKGQTFTQDVIEAISSFNERPIILSLSNPTSQSECTAEQAYTW  523

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRA+FA+GSPF P EY G+  + GQANNAYIFPGFGLG+++SGAIRVHDDMLLAASEA
Sbjct  524  SKGRAVFATGSPFDPVEYDGKIHVPGQANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEA  583

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+R P+P++LV YAESCM
Sbjct  584  LAQQVSEENFEKGLIYPPFSNIRKISAHIAANVAAKAYELGLASRRPRPKDLVKYAESCM  643

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  644  YSPVYRNYR  652



>gb|ABW77317.1| NADP-dependent malic enzyme [Triticum aestivum]
Length=570

 Score =   298 bits (764),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AV++IKPTVLIG+SG G+TFT++VI AMASFNEKP++ +LSNPTS SECTAEEAYTW
Sbjct  382  LLEAVQSIKPTVLIGTSGVGKTFTQEVIEAMASFNEKPVIFSLSNPTSHSECTAEEAYTW  441

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G A+FASGSPF P EY+G+T + GQ+NNAY+FPGFGLG++ISGAIRVHDDMLLAASEA
Sbjct  442  SKGTAVFASGSPFDPVEYEGKTFVPGQSNNAYVFPGFGLGVVISGAIRVHDDMLLAASEA  501

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA E TQENFDKGLI+PPF+NIRKISA IAA+VAAKAY+LGLA+RLP+P++LV YAESCM
Sbjct  502  LAEEATQENFDKGLIFPPFTNIRKISASIAAKVAAKAYDLGLASRLPRPDDLVKYAESCM  561

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  562  YTPLYRSYR  570



>ref|XP_009614468.1| PREDICTED: NADP-dependent malic enzyme-like [Nicotiana tomentosiformis]
Length=591

 Score =   299 bits (765),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG GRTFTK+VI AMAS NE+P+++ALSNPTSQ+ECTAEEAYTW
Sbjct  403  LLDAVKAIKPTVLIGTSGVGRTFTKEVIEAMASTNERPLIMALSNPTSQAECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGR +FASGSPFP FEY G+  + GQANN YIFPGFG GL++SG IRVHDDMLLAASEA
Sbjct  463  SEGRVVFASGSPFPSFEYNGKLNIPGQANNCYIFPGFGFGLVMSGTIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E+F KG+IYPPF++IRKISAHIAA VA KAYELG+ATRLP+P NLV YAESCM
Sbjct  523  LAAQVTEEHFAKGMIYPPFADIRKISAHIAASVATKAYELGVATRLPRPANLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  583  YTPNYRSYR  591



>ref|XP_009779848.1| PREDICTED: NADP-dependent malic enzyme [Nicotiana sylvestris]
Length=591

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GRTFTK+VI AMAS NE+P+++ALSNPTSQ+ECTAEEAYTW
Sbjct  403  LLDAVKTIKPTVLIGTSGVGRTFTKEVIEAMASTNERPLIMALSNPTSQAECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRA+FASGSPFP FEY G+  + GQANN YIFPGFG GL++SG IRVHDDMLLAASEA
Sbjct  463  SEGRAVFASGSPFPSFEYNGKLNIPGQANNCYIFPGFGFGLVMSGTIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E+F KG+IYPPF++IRKISAHIAA VA KAYELG+ATRLP+P NLV YAESCM
Sbjct  523  LAAQVTEEHFAKGMIYPPFADIRKISAHIAASVATKAYELGVATRLPRPANLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  583  YTPNYRSYR  591



>ref|XP_011092589.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Sesamum 
indicum]
 ref|XP_011092663.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Sesamum 
indicum]
 ref|XP_011092721.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Sesamum 
indicum]
 ref|XP_011092791.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Sesamum 
indicum]
Length=590

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIG+SG G+TFTK+VI AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  402  LLGAVKAIKPTVLIGTSGVGKTFTKEVIEAMASINEKPLILALSNPTSQSECTAEEAYTW  461

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P E+ G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  462  SEGRAIFASGSPFDPVEFNGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  521

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+EN+ KGLIYPPF+NIRKISAHIAA VAAKAYELGLA+ LP+P++LV YAESCM
Sbjct  522  LAAQVTEENYAKGLIYPPFTNIRKISAHIAANVAAKAYELGLASHLPRPKDLVKYAESCM  581

Query  216  YSPTYRSYR  190
            Y+P Y SYR
Sbjct  582  YTPVYGSYR  590



>gb|ABI98681.2| cytosolic NADP-malic enzyme [Nicotiana tabacum]
Length=591

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG GRTFTK+VI AMAS NE+P+++ALSNPTSQ+ECTAEEAYTW
Sbjct  403  LLDAVKAIKPTVLIGTSGVGRTFTKEVIEAMASTNERPLIMALSNPTSQAECTAEEAYTW  462

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRA+FASGSPFP FEY G+  + GQANN YIFPGFG GL++SG IRVHDDMLLAASEA
Sbjct  463  SEGRAVFASGSPFPSFEYNGKLNIPGQANNCYIFPGFGFGLVMSGTIRVHDDMLLAASEA  522

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E+F KG+IYPPF++IRKISAHIAA VAAKAYEL +ATRLP+P NLV YAESCM
Sbjct  523  LAAQVTEEHFAKGMIYPPFADIRKISAHIAASVAAKAYELVVATRLPRPANLVKYAESCM  582

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  583  YTPNYRSYR  591



>ref|XP_011081758.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
 ref|XP_011081759.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
Length=590

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIG+SG GRTFTK+V+ AMAS N+KP++LALSNPTSQSECTAEEAYTW
Sbjct  402  LLDAVKEIKPTVLIGTSGVGRTFTKEVVEAMASINQKPLILALSNPTSQSECTAEEAYTW  461

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G   + GQANNAYIFPGFGLGLI+SG +RVHDD+LLAASEA
Sbjct  462  SEGRAIFASGSPFQPVEYNGNMFVPGQANNAYIFPGFGLGLIMSGTVRVHDDLLLAASEA  521

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA + T+EN++KGLIYPPF+NIRKISA+IAA VAAKAYELGLA+RLP+P++LV +AESCM
Sbjct  522  LANQATEENYEKGLIYPPFTNIRKISANIAATVAAKAYELGLASRLPRPKDLVNFAESCM  581

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  582  YTPVYRNYR  590



>ref|XP_009801543.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009801544.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009801545.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nicotiana 
sylvestris]
Length=592

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+  MAS N KP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  404  LIDAVKAIKPTVLIGTSGVGKTFTKEVVETMASLNPKPLIMALSNPTSQAECTAEEAYTW  463

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF PFEY+GRT +SGQANNAYIFPGFGLG+I+SG IRVHDDMLLAASEA
Sbjct  464  SKGHAIFASGSPFDPFEYEGRTFVSGQANNAYIFPGFGLGIIMSGTIRVHDDMLLAASEA  523

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E++ KG IYP F+NIRKISAHIAA VAAKAYELGLATRLP+P +L  YAESCM
Sbjct  524  LAAQVTEEDYLKGRIYPSFTNIRKISAHIAAEVAAKAYELGLATRLPRPTDLEKYAESCM  583

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  584  YTPVYRTYR  592



>sp|P12628.1|MAOX_PHAVU RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME [Phaseolus 
vulgaris]
 gb|AAA19575.1| NADP-dependent malic enzyme [Phaseolus vulgaris]
Length=589

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++AVKAIKPTVLIGSSGAG+TFTK+V+  MAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  401  LLEAVKAIKPTVLIGSSGAGKTFTKEVVETMASLNEKPLILALSNPTSQSECTAEEAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+GRAIFASGSPF P EY+G+  + GQANNAYIFPGFGLGLI+SGAIRV D+MLLAASEA
Sbjct  461  SKGRAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIMSGAIRVRDEMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+V++EN+DKGLIYPPF+NIRKISA+IAA+VAAKAY+LGLA+ L +P++LV YAESCM
Sbjct  521  LAAQVSEENYDKGLIYPPFTNIRKISANIAAKVAAKAYDLGLASHLKRPKDLVKYAESCM  580

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  581  YSPGYRSYR  589



>gb|AAK83073.1|AF288920_1 putative cytosolic NADP-malic enzyme [Flaveria pringlei]
Length=589

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKP+VLIG+SG G+TFT++V+ AMA+FNE+P+++ALSNPTSQ+ECTAE+AYTW
Sbjct  401  LLDAVKAIKPSVLIGTSGVGQTFTQNVVEAMAAFNERPLIMALSNPTSQAECTAEQAYTW  460

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIF+SGSPF P+EY G   + GQANNAYIFPG G GL+ISGAIRVHD+MLLAASEA
Sbjct  461  TQGRAIFSSGSPFDPYEYNGNLFIPGQANNAYIFPGLGFGLVISGAIRVHDEMLLAASEA  520

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VTQE++DKG+IYPP +NIRKISAHIAA VAAKAY+LGLATRLP+P +LV YAESCM
Sbjct  521  LANQVTQEHYDKGMIYPPLTNIRKISAHIAANVAAKAYDLGLATRLPRPTDLVKYAESCM  580

Query  216  YSPTYRSYR  190
            Y+P YRSYR
Sbjct  581  YTPNYRSYR  589



>ref|XP_006580482.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Glycine 
max]
Length=600

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVD+ K IKPTVLIGSSG GRTFTK+V+ AM S N+KP++LALSNPTSQSECTAEEAY W
Sbjct  413  LVDS-KVIKPTVLIGSSGVGRTFTKEVVEAMTSNNDKPLILALSNPTSQSECTAEEAYQW  471

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EYKG+   SGQANNAYIFPGFGLGL+ISGAIRVHDDMLLAASE+
Sbjct  472  SEGRAIFASGSPFDPVEYKGKVYASGQANNAYIFPGFGLGLVISGAIRVHDDMLLAASES  531

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++EN+  GLIYPPFSNIR+ISA+IAA VAAKAYELGLATRLP+P+NLV  AESCM
Sbjct  532  LAKQVSEENYKNGLIYPPFSNIRRISANIAANVAAKAYELGLATRLPRPQNLVKCAESCM  591

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  592  YTPVYRNYR  600



>ref|XP_011092518.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Sesamum 
indicum]
Length=620

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+ AVKAIKPTVLIG+SG G+TFTK+VI AMAS NEKP++LALSNPTSQSECTAEEAYTW
Sbjct  432  LLGAVKAIKPTVLIGTSGVGKTFTKEVIEAMASINEKPLILALSNPTSQSECTAEEAYTW  491

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P E+ G+  + GQANNAYIFPGFGLGLI+SG IRVHDD+LLAASEA
Sbjct  492  SEGRAIFASGSPFDPVEFNGKVFVPGQANNAYIFPGFGLGLIMSGTIRVHDDLLLAASEA  551

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+EN+ KGLIYPPF+NIRKISAHIAA VAAKAYELGLA+ LP+P++LV YAESCM
Sbjct  552  LAAQVTEENYAKGLIYPPFTNIRKISAHIAANVAAKAYELGLASHLPRPKDLVKYAESCM  611

Query  216  YSPTYRSYR  190
            Y+P Y SYR
Sbjct  612  YTPVYGSYR  620



>ref|XP_010095359.1| NADP-dependent malic enzyme [Morus notabilis]
 gb|EXB59778.1| NADP-dependent malic enzyme [Morus notabilis]
Length=1017

 Score =   307 bits (786),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756   LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
             L+ AVKAIKPTVLIGSSG GR FTK+VI A+ SFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  829   LLSAVKAIKPTVLIGSSGVGRAFTKEVIEAVTSFNEKPLILALSNPTSQSECTAEEAYTW  888

Query  576   SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
             SEGRAIFASGSPF P EY G+   SGQANNAYIFPGFGLGL+ISGAIRVHD+MLLAASEA
Sbjct  889   SEGRAIFASGSPFDPIEYNGKVYYSGQANNAYIFPGFGLGLVISGAIRVHDEMLLAASEA  948

Query  396   laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
             LA +V +EN++KGLIYPPFS IRKISA IAA VAAKAYELGLATRLP+P NLV YAESCM
Sbjct  949   LAKQVKEENYEKGLIYPPFSIIRKISAEIAANVAAKAYELGLATRLPRPGNLVKYAESCM  1008

Query  216   YSPTYRSYR  190
             Y+PTYRSYR
Sbjct  1009  YTPTYRSYR  1017



>gb|ABK95522.1| unknown [Populus trichocarpa]
Length=496

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L++ VKAIKPTVLIG+SG G+TFTK+VI AMASFNEKP++LALSNPTSQSECTAEEAYTW
Sbjct  308  LLEVVKAIKPTVLIGTSGVGKTFTKEVIEAMASFNEKPLILALSNPTSQSECTAEEAYTW  367

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++G+AIFASGSPF P EY+G+  + GQ+NNAYIFPG GLGL+ISGAIRVHDDMLLAA+EA
Sbjct  368  TKGKAIFASGSPFDPVEYEGKVFVPGQSNNAYIFPGLGLGLVISGAIRVHDDMLLAAAEA  427

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA ++ +E   KGLIYPP SNIRKIS  IAA VAAKAYELGLATRLP+PENLV +AESCM
Sbjct  428  LAGQIKEEYLAKGLIYPPLSNIRKISVQIAANVAAKAYELGLATRLPRPENLVKHAESCM  487

Query  216  YSPTYRSYR  190
            YSP YR YR
Sbjct  488  YSPAYRYYR  496



>ref|XP_009801542.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+  MAS N KP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  436  LIDAVKAIKPTVLIGTSGVGKTFTKEVVETMASLNPKPLIMALSNPTSQAECTAEEAYTW  495

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF PFEY+GRT +SGQANNAYIFPGFGLG+I+SG IRVHDDMLLAASEA
Sbjct  496  SKGHAIFASGSPFDPFEYEGRTFVSGQANNAYIFPGFGLGIIMSGTIRVHDDMLLAASEA  555

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E++ KG IYP F+NIRKISAHIAA VAAKAYELGLATRLP+P +L  YAESCM
Sbjct  556  LAAQVTEEDYLKGRIYPSFTNIRKISAHIAAEVAAKAYELGLATRLPRPTDLEKYAESCM  615

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  616  YTPVYRTYR  624



>ref|XP_009801541.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Nicotiana 
sylvestris]
Length=640

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVKAIKPTVLIG+SG G+TFTK+V+  MAS N KP+++ALSNPTSQ+ECTAEEAYTW
Sbjct  452  LIDAVKAIKPTVLIGTSGVGKTFTKEVVETMASLNPKPLIMALSNPTSQAECTAEEAYTW  511

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            S+G AIFASGSPF PFEY+GRT +SGQANNAYIFPGFGLG+I+SG IRVHDDMLLAASEA
Sbjct  512  SKGHAIFASGSPFDPFEYEGRTFVSGQANNAYIFPGFGLGIIMSGTIRVHDDMLLAASEA  571

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LAA+VT+E++ KG IYP F+NIRKISAHIAA VAAKAYELGLATRLP+P +L  YAESCM
Sbjct  572  LAAQVTEEDYLKGRIYPSFTNIRKISAHIAAEVAAKAYELGLATRLPRPTDLEKYAESCM  631

Query  216  YSPTYRSYR  190
            Y+P YR+YR
Sbjct  632  YTPVYRTYR  640



>dbj|BAA74735.1| NADP-malic enzyme [Aloe arborescens]
Length=585

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+DAVK IKPTVLIGSSG G+TFTK+V  AM SFNEKP++LALSNPTSQSECTAE+AY+W
Sbjct  397  LLDAVKTIKPTVLIGSSGVGQTFTKEVAEAMPSFNEKPVILALSNPTSQSECTAEQAYSW  456

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            SEGRAIFASGSPF P EY G+  + GQANNAYIFPG GLGL+ISGAIRVHD+MLLAASEA
Sbjct  457  SEGRAIFASGSPFDPVEYNGKLFVPGQANNAYIFPGLGLGLVISGAIRVHDEMLLAASEA  516

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +VT+ENF  GLIYPPF+ IRKISAHIAA VAAKAYELGLAT LP+P NLV YAES M
Sbjct  517  LAQQVTEENFANGLIYPPFTIIRKISAHIAANVAAKAYELGLATHLPRPANLVKYAESRM  576

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  577  YSPLYRSYR  585



>ref|XP_010047290.1| PREDICTED: NADP-dependent malic enzyme [Eucalyptus grandis]
 gb|KCW79168.1| hypothetical protein EUGRSUZ_C00609 [Eucalyptus grandis]
Length=587

 Score =   297 bits (760),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            L+D+VKAIKPTVLIGSSG G+TFTK+V+ AMAS NEKPI+LALSNPTSQSECTAEEAYTW
Sbjct  399  LLDSVKAIKPTVLIGSSGVGKTFTKEVVEAMASLNEKPIILALSNPTSQSECTAEEAYTW  458

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++G+AIFASGSPF P  Y G+T + GQANNAYIFPG GLGLIISGAIRV+D MLLAASEA
Sbjct  459  TKGKAIFASGSPFDPVNYNGKTYVPGQANNAYIFPGLGLGLIISGAIRVNDGMLLAASEA  518

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA++   ENF+KGLIYPPFSNIRKISAHIAA VAAKAYELGLA+ LP+P++LV YAESCM
Sbjct  519  LASQAIPENFEKGLIYPPFSNIRKISAHIAASVAAKAYELGLASHLPRPKDLVKYAESCM  578

Query  216  YSPTYRSYR  190
            YSP YR+YR
Sbjct  579  YSPVYRNYR  587



>gb|AHA11551.1| NADP-malic enzyme [Malus domestica]
Length=593

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNEKPIVLALSNPTSQSECTAEEAYTW  577
            LVDAVKAIKPTVLIG+SG G+ FTKDV+  MAS NEKP++LALSNPTSQ+ECTAEEAYTW
Sbjct  405  LVDAVKAIKPTVLIGTSGVGKQFTKDVVETMASLNEKPLILALSNPTSQAECTAEEAYTW  464

Query  576  SEGRAIFASGSPFPPFEYKGRTLLSGQANNAYIFPGFGLGLIISGAIRVHDDMllaasea  397
            ++GRAIF SGSPF P EY+ + L+ GQANNAYIFPGFGLGLI++GAIRVHDDMLLAASEA
Sbjct  465  TKGRAIFGSGSPFDPVEYENKLLVPGQANNAYIFPGFGLGLIMAGAIRVHDDMLLAASEA  524

Query  396  laaEVTQENFDKGLIYPPFSNIRKISAHIAARVAAKAYELGLATRLPQPENLVAYAESCM  217
            LA +V++E++ KGLIYPPF+NIRKISA+IAA+VAAK YELGLA+ LP+P++LV YAESCM
Sbjct  525  LAMQVSEEHYAKGLIYPPFTNIRKISANIAAKVAAKVYELGLASNLPRPKDLVKYAESCM  584

Query  216  YSPTYRSYR  190
            YSP YRSYR
Sbjct  585  YSPRYRSYR  593



>ref|XP_008462427.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Cucumis 
melo]
Length=596

 Score =   297 bits (760),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 176/217 (81%), Gaps = 28/217 (13%)
 Frame = -1

Query  756  LVDAVKAIKPTVLIGSSGAGRTFTKDVIGAMASFNE------------------------  649
            L+DAVK IKPTVLIG+SG GRTFTKDV+ AMA+ NE                        
Sbjct  380  LIDAVKDIKPTVLIGTSGVGRTFTKDVVEAMAAINEVFYLPTCVLCRFKREIMLTVILLW  439

Query  648  ----KPIVLALSNPTSQSECTAEEAYTWSEGRAIFASGSPFPPFEYKGRTLLSGQANNAY  481
                KPI+LALSNPTSQSECTAEEAYTW+EGRAIFASGSPF P EY+G   + GQANNAY
Sbjct  440  IILQKPIILALSNPTSQSECTAEEAYTWTEGRAIFASGSPFDPVEYEGNVFVPGQANNAY  499

Query  480  IFPGFGLGLIISGAIRVHDDMllaasealaaEVTQENFDKGLIYPPFSNIRKISAHIAAR  301
            IFPGFGLGLI+SG IRV DDMLLAASEALAA+VTQENFDKGLIYPPF+NIRKISA+IAA+
Sbjct  500  IFPGFGLGLIMSGTIRVRDDMLLAASEALAAQVTQENFDKGLIYPPFTNIRKISANIAAK  559

Query  300  VAAKAYELGLATRLPQPENLVAYAESCMYSPTYRSYR  190
            VAAKAYELGLATRLPQPE+LV +AESCMY+P+Y++YR
Sbjct  560  VAAKAYELGLATRLPQPEDLVNHAESCMYNPSYQNYR  596



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260