BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001M13

Length=677
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP25339.1|  hypothetical protein JCGZ_20495                         266   5e-81   Jatropha curcas
gb|KHN16761.1|  Putative inactive receptor kinase                       256   6e-80   Glycine soja [wild soybean]
ref|XP_002509916.1|  ATP binding protein, putative                      260   8e-80   
ref|XP_004511532.1|  PREDICTED: probable inactive receptor kinase...    251   2e-78   Cicer arietinum [garbanzo]
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...    258   3e-78   Prunus mume [ume]
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...    258   5e-78   Solanum lycopersicum
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...    258   5e-78   Solanum tuberosum [potatoes]
gb|KEH21182.1|  LRR receptor-like kinase                                258   6e-78   Medicago truncatula
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg             258   1e-77   Prunus persica
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...    256   3e-77   
ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...    255   4e-77   Sesamum indicum [beniseed]
ref|XP_010104998.1|  putative inactive receptor kinase                  256   4e-77   Morus notabilis
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...    256   4e-77   Nicotiana sylvestris
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...    254   8e-77   
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...    254   2e-76   Glycine max [soybeans]
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...    253   3e-76   Fragaria vesca subsp. vesca
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...    253   4e-76   Populus trichocarpa [western balsam poplar]
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...    253   6e-76   Pyrus x bretschneideri [bai li]
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...    251   2e-75   Glycine max [soybeans]
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase     251   2e-75   Medicago truncatula
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg             250   3e-75   Citrus clementina [clementine]
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                   250   4e-75   Citrus sinensis [apfelsine]
ref|XP_008392458.1|  PREDICTED: probable inactive receptor kinase...    250   4e-75   
gb|AFK45382.1|  unknown                                                 249   4e-75   Medicago truncatula
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...    249   4e-75   Cicer arietinum [garbanzo]
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...    250   4e-75   
ref|XP_004167870.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    250   4e-75   
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...    250   4e-75   Citrus sinensis [apfelsine]
ref|XP_004503646.1|  PREDICTED: probable inactive receptor kinase...    250   5e-75   Cicer arietinum [garbanzo]
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...    250   5e-75   Cucumis sativus [cucumbers]
gb|KJB19053.1|  hypothetical protein B456_003G082600                    250   5e-75   Gossypium raimondii
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...    249   5e-75   Populus trichocarpa [western balsam poplar]
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g             249   1e-74   Phaseolus vulgaris [French bean]
gb|KHN25658.1|  Putative inactive receptor kinase                       243   2e-74   Glycine soja [wild soybean]
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...    248   2e-74   Populus euphratica
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...    248   2e-74   Populus euphratica
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...    248   3e-74   Populus euphratica
emb|CDP12117.1|  unnamed protein product                                248   3e-74   Coffea canephora [robusta coffee]
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...    248   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...    246   2e-73   Vitis vinifera
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g             244   2e-73   Phaseolus vulgaris [French bean]
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...    244   3e-73   Glycine max [soybeans]
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...    244   1e-72   
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...    243   2e-72   Glycine max [soybeans]
emb|CDY03526.1|  BnaC01g15560D                                          232   3e-72   
ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...    242   6e-72   Sesamum indicum [beniseed]
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...    240   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...    240   3e-71   Populus euphratica
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...    239   4e-71   Populus euphratica
ref|XP_010055829.1|  PREDICTED: probable inactive receptor kinase...    238   1e-70   Eucalyptus grandis [rose gum]
gb|EYU23390.1|  hypothetical protein MIMGU_mgv1a003016mg                237   3e-70   Erythranthe guttata [common monkey flower]
ref|XP_009628885.1|  PREDICTED: probable inactive receptor kinase...    237   3e-70   Nicotiana tomentosiformis
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g             236   6e-70   Populus trichocarpa [western balsam poplar]
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...    236   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g             236   9e-70   Populus trichocarpa [western balsam poplar]
ref|XP_002513601.1|  ATP binding protein, putative                      236   1e-69   Ricinus communis
gb|KDP22183.1|  hypothetical protein JCGZ_26014                         235   2e-69   Jatropha curcas
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...    235   2e-69   
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...    235   3e-69   Populus euphratica
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...    234   4e-69   Nicotiana sylvestris
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...    233   7e-69   Tarenaya hassleriana [spider flower]
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...    233   1e-68   Brassica rapa
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...    233   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg             232   3e-68   Eutrema salsugineum [saltwater cress]
ref|XP_004502606.1|  PREDICTED: probable inactive receptor kinase...    231   3e-68   
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...    232   4e-68   
ref|XP_004502605.1|  PREDICTED: probable inactive receptor kinase...    231   5e-68   Cicer arietinum [garbanzo]
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...    230   1e-67   Brassica rapa
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...    231   1e-67   
emb|CDY47625.1|  BnaA01g13400D                                          231   2e-67   Brassica napus [oilseed rape]
ref|XP_010053173.1|  PREDICTED: probable inactive receptor kinase...    230   2e-67   Eucalyptus grandis [rose gum]
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...    230   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...    229   3e-67   Camelina sativa [gold-of-pleasure]
gb|KJB52632.1|  hypothetical protein B456_008G271600                    229   5e-67   Gossypium raimondii
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein     229   5e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KEH35437.1|  receptor-like kinase                                    221   5e-67   Medicago truncatula
emb|CDP05105.1|  unnamed protein product                                229   6e-67   Coffea canephora [robusta coffee]
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...    229   6e-67   
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg             228   7e-67   Prunus persica
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...    228   1e-66   Vitis vinifera
gb|EPS60741.1|  hypothetical protein M569_14060                         227   1e-66   Genlisea aurea
gb|KHG27491.1|  hypothetical protein F383_14041                         228   2e-66   Gossypium arboreum [tree cotton]
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223             227   2e-66   Arabidopsis lyrata subsp. lyrata
emb|CDX94213.1|  BnaC07g38470D                                          227   2e-66   
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...    227   2e-66   Sesamum indicum [beniseed]
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                   226   5e-66   Citrus sinensis [apfelsine]
ref|XP_008793397.1|  PREDICTED: probable inactive receptor kinase...    226   6e-66   Phoenix dactylifera
ref|XP_008793541.1|  PREDICTED: probable inactive receptor kinase...    226   6e-66   Phoenix dactylifera
emb|CBI22555.3|  unnamed protein product                                226   8e-66   Vitis vinifera
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...    224   2e-65   Citrus sinensis [apfelsine]
ref|XP_006283316.1|  hypothetical protein CARUB_v10004355mg             224   2e-65   
ref|XP_010925785.1|  PREDICTED: probable inactive receptor kinase...    224   3e-65   
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...    224   3e-65   Solanum tuberosum [potatoes]
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...    224   3e-65   Phoenix dactylifera
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg             223   6e-65   
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...    224   7e-65   Eucalyptus grandis [rose gum]
gb|ACC91242.1|  leucine-rich repeat transmembrane protein kinase        223   9e-65   Arabidopsis halleri
ref|XP_003522551.1|  PREDICTED: probable inactive receptor kinase...    222   2e-64   Glycine max [soybeans]
gb|KHN44239.1|  Putative inactive receptor kinase                       221   3e-64   Glycine soja [wild soybean]
gb|KHN09234.1|  Putative inactive receptor kinase                       214   4e-64   Glycine soja [wild soybean]
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg             221   4e-64   
gb|KHN23405.1|  Putative inactive receptor kinase                       221   4e-64   Glycine soja [wild soybean]
ref|XP_008376682.1|  PREDICTED: probable inactive receptor kinase...    221   6e-64   Malus domestica [apple tree]
gb|AES72427.2|  LRR receptor-like kinase                                220   9e-64   Medicago truncatula
emb|CDY10964.1|  BnaA03g46230D                                          206   1e-63   Brassica napus [oilseed rape]
ref|XP_003526687.1|  PREDICTED: probable inactive receptor kinase...    220   1e-63   Glycine max [soybeans]
gb|EYU25187.1|  hypothetical protein MIMGU_mgv1a002923mg                219   1e-63   Erythranthe guttata [common monkey flower]
ref|XP_009413825.1|  PREDICTED: probable inactive receptor kinase...    219   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097875.1|  putative inactive receptor kinase                  219   4e-63   
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...    218   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...    218   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008380496.1|  PREDICTED: probable inactive receptor kinase...    216   2e-62   
ref|XP_009352112.1|  PREDICTED: probable inactive receptor kinase...    216   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_003602176.1|  Leucine-rich repeat receptor-like protein ki...    220   2e-62   
ref|XP_009375580.1|  PREDICTED: probable inactive receptor kinase...    216   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_004308019.1|  PREDICTED: probable inactive receptor kinase...    216   6e-62   Fragaria vesca subsp. vesca
gb|KHN08297.1|  Putative inactive receptor kinase                       214   2e-61   Glycine soja [wild soybean]
ref|XP_010445167.1|  PREDICTED: probable inactive receptor kinase...    215   2e-61   
ref|XP_007137558.1|  hypothetical protein PHAVU_009G136800g             213   3e-61   Phaseolus vulgaris [French bean]
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    211   2e-60   Sesamum indicum [beniseed]
ref|XP_006596280.1|  PREDICTED: probable inactive receptor kinase...    211   2e-60   Glycine max [soybeans]
ref|XP_010035197.1|  PREDICTED: probable inactive receptor kinase...    208   3e-59   Eucalyptus grandis [rose gum]
ref|XP_007141021.1|  hypothetical protein PHAVU_008G160700g             207   6e-59   Phaseolus vulgaris [French bean]
ref|XP_004145918.1|  PREDICTED: probable inactive receptor kinase...    206   1e-58   
gb|KGN49888.1|  hypothetical protein Csa_5G139660                       206   2e-58   Cucumis sativus [cucumbers]
ref|XP_008437572.1|  PREDICTED: probable inactive receptor kinase...    205   4e-58   Cucumis melo [Oriental melon]
ref|XP_009357339.1|  PREDICTED: probable inactive receptor kinase...    204   8e-58   
ref|XP_009368693.1|  PREDICTED: probable inactive receptor kinase...    204   9e-58   Pyrus x bretschneideri [bai li]
ref|XP_004149452.1|  PREDICTED: probable inactive receptor kinase...    203   2e-57   
ref|NP_001042446.1|  Os01g0223600                                       200   4e-57   
ref|XP_004498388.1|  PREDICTED: probable inactive receptor kinase...    202   4e-57   Cicer arietinum [garbanzo]
ref|XP_008439323.1|  PREDICTED: probable inactive receptor kinase...    202   5e-57   Cucumis melo [Oriental melon]
ref|XP_006645650.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
gb|KHN24722.1|  Putative inactive receptor kinase                       193   4e-56   Glycine soja [wild soybean]
gb|EYU36892.1|  hypothetical protein MIMGU_mgv1a0177021mg               188   7e-56   Erythranthe guttata [common monkey flower]
emb|CBI34446.3|  unnamed protein product                                192   8e-56   Vitis vinifera
gb|KEH40435.1|  LRR receptor-like kinase                                197   1e-55   Medicago truncatula
dbj|BAA94519.1|  putative receptor-like kinase                          198   1e-55   Oryza sativa Japonica Group [Japonica rice]
gb|EMT08914.1|  Putative inactive receptor kinase                       194   1e-55   
gb|EPS62971.1|  hypothetical protein M569_11816                         196   5e-55   Genlisea aurea
gb|KEH34523.1|  LRR receptor-like kinase                                196   7e-55   Medicago truncatula
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...    196   8e-55   
gb|KHN40997.1|  Putative inactive receptor kinase                       187   1e-54   Glycine soja [wild soybean]
gb|KHN30614.1|  Putative inactive receptor kinase                       187   1e-54   Glycine soja [wild soybean]
emb|CDP04037.1|  unnamed protein product                                186   2e-54   Coffea canephora [robusta coffee]
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...    195   2e-54   
ref|XP_003565740.1|  PREDICTED: probable inactive receptor kinase...    194   3e-54   Brachypodium distachyon [annual false brome]
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g             194   5e-54   Phaseolus vulgaris [French bean]
ref|XP_002454913.1|  hypothetical protein SORBIDRAFT_03g001310          192   6e-54   
dbj|BAJ94608.1|  predicted protein                                      194   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP13882.1|  unnamed protein product                                194   6e-54   Coffea canephora [robusta coffee]
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...    192   2e-53   
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...    192   2e-53   Glycine max [soybeans]
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative     191   4e-53   
gb|KHN18649.1|  Putative inactive receptor kinase                       191   5e-53   Glycine soja [wild soybean]
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...    191   6e-53   Fragaria vesca subsp. vesca
gb|KJB52637.1|  hypothetical protein B456_008G271600                    191   7e-53   Gossypium raimondii
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                   191   7e-53   Citrus sinensis [apfelsine]
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...    191   8e-53   Glycine max [soybeans]
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg             191   9e-53   Citrus clementina [clementine]
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...    191   9e-53   Glycine max [soybeans]
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...    191   9e-53   Glycine max [soybeans]
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...    190   9e-53   Sesamum indicum [beniseed]
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...    191   9e-53   Glycine max [soybeans]
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...    190   9e-53   
ref|XP_010094441.1|  putative inactive receptor kinase                  190   1e-52   Morus notabilis
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...    190   1e-52   Prunus mume [ume]
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg             190   1e-52   
gb|KDP45679.1|  hypothetical protein JCGZ_17286                         190   2e-52   Jatropha curcas
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                   190   2e-52   Citrus sinensis [apfelsine]
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                   190   2e-52   Citrus sinensis [apfelsine]
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg             190   2e-52   Citrus clementina [clementine]
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...    189   2e-52   
ref|XP_004967473.1|  PREDICTED: probable inactive receptor kinase...    189   2e-52   Setaria italica
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...    189   3e-52   
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...    189   3e-52   
gb|KDP21848.1|  hypothetical protein JCGZ_00635                         189   4e-52   Jatropha curcas
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...    189   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...    188   5e-52   Tarenaya hassleriana [spider flower]
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...    188   6e-52   
gb|AFK38063.1|  unknown                                                 176   7e-52   Lotus japonicus
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...    188   7e-52   Glycine max [soybeans]
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...    188   8e-52   
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...    187   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...    187   1e-51   Elaeis guineensis
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...    187   1e-51   
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g             187   1e-51   Phaseolus vulgaris [French bean]
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...    187   1e-51   Cucumis sativus [cucumbers]
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...    187   2e-51   Nicotiana sylvestris
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...    187   2e-51   Nelumbo nucifera [Indian lotus]
gb|KJB20517.1|  hypothetical protein B456_003G153000                    187   2e-51   Gossypium raimondii
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative     186   2e-51   Ricinus communis
ref|XP_011041763.1|  PREDICTED: probable inactive receptor kinase...    184   2e-51   Populus euphratica
gb|KHG05843.1|  hypothetical protein F383_32232                         186   3e-51   Gossypium arboreum [tree cotton]
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...    186   3e-51   Nicotiana tomentosiformis
ref|XP_006842562.1|  hypothetical protein AMTR_s00077p00144570          176   4e-51   
emb|CDP03386.1|  unnamed protein product                                186   5e-51   Coffea canephora [robusta coffee]
ref|XP_004236305.1|  PREDICTED: probable inactive receptor kinase...    185   1e-50   Solanum lycopersicum
ref|XP_008673504.1|  PREDICTED: probable inactive receptor kinase...    185   1e-50   Zea mays [maize]
ref|XP_008673506.1|  PREDICTED: probable inactive receptor kinase...    185   1e-50   Zea mays [maize]
gb|ABK93951.1|  unknown                                                 179   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...    184   1e-50   Populus euphratica
gb|ACN57520.1|  At2g26730-like protein                                  174   2e-50   Capsella rubella
ref|XP_002325632.1|  putative plant disease resistance family pro...    184   2e-50   Populus trichocarpa [western balsam poplar]
gb|ACN57540.1|  At2g26730-like protein                                  174   2e-50   Capsella grandiflora
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...    184   2e-50   Nicotiana tomentosiformis
gb|ACN57533.1|  At2g26730-like protein                                  173   2e-50   Capsella grandiflora
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...    183   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...    184   3e-50   Nicotiana sylvestris
tpg|DAA52804.1|  TPA: putative leucine-rich repeat receptor-like ...    184   3e-50   
ref|XP_006351444.1|  PREDICTED: probable inactive receptor kinase...    184   3e-50   Solanum tuberosum [potatoes]
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...    184   3e-50   Nicotiana tomentosiformis
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...    184   3e-50   Nicotiana sylvestris
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...    183   3e-50   Sesamum indicum [beniseed]
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...    183   5e-50   Phoenix dactylifera
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...    182   6e-50   Nicotiana sylvestris
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...    183   6e-50   Medicago truncatula
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...    183   7e-50   Vitis vinifera
emb|CBI15804.3|  unnamed protein product                                182   7e-50   Vitis vinifera
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    183   7e-50   Nicotiana tomentosiformis
ref|XP_002319979.1|  putative plant disease resistance family pro...    182   7e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...    182   8e-50   Populus euphratica
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...    182   8e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEW08175.1|  hypothetical protein 2_2125_01                          171   9e-50   Pinus radiata
gb|ABR17070.1|  unknown                                                 176   1e-49   Picea sitchensis
gb|ACN57547.1|  At2g26730-like protein                                  172   1e-49   Capsella grandiflora
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...    182   1e-49   
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg             182   1e-49   Citrus clementina [clementine]
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg             182   1e-49   Citrus clementina [clementine]
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...    182   1e-49   Solanum tuberosum [potatoes]
emb|CDY02808.1|  BnaC02g10810D                                          178   1e-49   
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...    182   1e-49   Phoenix dactylifera
ref|XP_009614171.1|  PREDICTED: probable inactive receptor kinase...    182   1e-49   Nicotiana tomentosiformis
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...    182   1e-49   Cicer arietinum [garbanzo]
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                   181   2e-49   Citrus sinensis [apfelsine]
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg             182   2e-49   
emb|CDY58565.1|  BnaC03g12450D                                          181   2e-49   Brassica napus [oilseed rape]
ref|XP_009782917.1|  PREDICTED: probable inactive receptor kinase...    181   2e-49   Nicotiana sylvestris
ref|NP_001168844.1|  uncharacterized LOC100382649 precursor             181   2e-49   Zea mays [maize]
gb|ACN30771.1|  unknown                                                 181   2e-49   Zea mays [maize]
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...    181   2e-49   
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...    181   2e-49   Solanum tuberosum [potatoes]
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    181   2e-49   
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    181   3e-49   Sesamum indicum [beniseed]
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...    181   3e-49   
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    181   4e-49   Nicotiana sylvestris
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...    181   4e-49   Brassica rapa
gb|ACN57550.1|  At2g26730-like protein                                  170   5e-49   Capsella grandiflora
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...    181   5e-49   Nicotiana sylvestris
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...    180   5e-49   
ref|XP_010098027.1|  putative inactive receptor kinase                  180   7e-49   
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...    179   7e-49   Populus euphratica
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                   179   8e-49   Citrus sinensis [apfelsine]
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg             179   8e-49   Citrus clementina [clementine]
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...    179   8e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006371315.1|  putative plant disease resistance family pro...    179   8e-49   
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...    179   1e-48   Populus euphratica
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...    179   1e-48   Populus euphratica
ref|XP_010533192.1|  PREDICTED: probable inactive receptor kinase...    179   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g             179   1e-48   
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    179   1e-48   
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...    179   1e-48   Solanum lycopersicum
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...    179   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...    179   1e-48   Camelina sativa [gold-of-pleasure]
gb|KJB71491.1|  hypothetical protein B456_011G125200                    179   1e-48   Gossypium raimondii
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...    179   2e-48   Solanum lycopersicum
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...    179   2e-48   Citrus sinensis [apfelsine]
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...    179   2e-48   Populus euphratica
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...    178   2e-48   
ref|XP_008244615.1|  PREDICTED: probable inactive receptor kinase...    177   3e-48   Prunus mume [ume]
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...    178   3e-48   Pyrus x bretschneideri [bai li]
emb|CDY32713.1|  BnaA02g07750D                                          178   3e-48   Brassica napus [oilseed rape]
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg             178   3e-48   
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...    178   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...    178   3e-48   Sesamum indicum [beniseed]
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...    178   3e-48   Cucumis melo [Oriental melon]
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg             178   4e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002864562.1|  predicted protein                                  177   4e-48   Arabidopsis lyrata subsp. lyrata
gb|KJB29842.1|  hypothetical protein B456_005G120900                    177   4e-48   Gossypium raimondii
gb|KJB54134.1|  hypothetical protein B456_009G022300                    177   5e-48   
ref|XP_010098956.1|  putative inactive receptor kinase                  177   6e-48   
ref|XP_009393622.1|  PREDICTED: probable inactive receptor kinase...    177   6e-48   
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...    177   6e-48   
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...    177   7e-48   
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg             177   7e-48   
gb|KHG24076.1|  hypothetical protein F383_10304                         177   7e-48   
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...    177   7e-48   
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...    177   7e-48   
ref|XP_004172749.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    177   8e-48   
gb|KHG17391.1|  hypothetical protein F383_22576                         177   8e-48   
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...    177   9e-48   
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...    177   9e-48   
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...    176   1e-47   
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...    177   1e-47   
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...    177   1e-47   
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...    176   2e-47   
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...    176   2e-47   
gb|AAK92807.1|  putative receptor protein kinase                        176   2e-47   
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...    176   2e-47   
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...    176   2e-47   
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein     176   2e-47   
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg             176   2e-47   
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...    176   2e-47   
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein     176   2e-47   
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...    176   2e-47   
ref|XP_004167200.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    176   2e-47   
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...    176   2e-47   
emb|CDY48185.1|  BnaA04g15490D                                          175   3e-47   
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg             175   3e-47   
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544             175   3e-47   
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...    175   3e-47   
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...    175   3e-47   
emb|CAN80590.1|  hypothetical protein VITISV_040789                     175   3e-47   
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...    175   3e-47   
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...    175   3e-47   
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...    175   4e-47   
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...    174   4e-47   
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...    175   4e-47   
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative     175   4e-47   
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...    175   4e-47   
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    175   4e-47   
emb|CDX71488.1|  BnaC04g17230D                                          175   5e-47   
ref|XP_004167125.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    174   5e-47   
ref|XP_004149854.1|  PREDICTED: probable inactive receptor kinase...    174   6e-47   
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...    174   8e-47   
gb|ACA61611.1|  hypothetical protein AP2_E06.2                          174   8e-47   
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    174   8e-47   
gb|ACZ98536.1|  protein kinase                                          174   8e-47   
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090          174   9e-47   
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...    174   9e-47   
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...    174   9e-47   
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...    174   9e-47   
gb|KDP32336.1|  hypothetical protein JCGZ_13261                         174   1e-46   
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...    174   1e-46   
gb|KHF99691.1|  hypothetical protein F383_18108                         173   1e-46   
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg             174   1e-46   
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    173   1e-46   
gb|EPS74415.1|  hypothetical protein M569_00340                         173   1e-46   
gb|KJB64834.1|  hypothetical protein B456_010G067400                    173   1e-46   
gb|KHG18372.1|  hypothetical protein F383_03411                         173   2e-46   
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...    173   2e-46   
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...    172   2e-46   
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    172   2e-46   
ref|XP_010688116.1|  PREDICTED: probable inactive receptor kinase...    173   2e-46   
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...    172   2e-46   
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor             172   3e-46   
gb|EPS63924.1|  hypothetical protein M569_10855                         172   3e-46   
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...    172   3e-46   
gb|EAZ05160.1|  hypothetical protein OsI_27356                          172   3e-46   
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...    172   3e-46   
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...    172   3e-46   
gb|KJB67957.1|  hypothetical protein B456_010G219700                    172   4e-46   
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...    172   4e-46   
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...    172   5e-46   
ref|XP_010671535.1|  PREDICTED: probable inactive receptor kinase...    172   5e-46   
ref|NP_001060650.1|  Os07g0681100                                       172   6e-46   
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg             171   6e-46   
emb|CDY04464.1|  BnaA07g12900D                                          171   6e-46   
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...    171   7e-46   
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...    171   9e-46   
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...    171   9e-46   
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg                171   1e-45   
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                     171   1e-45   
gb|KHN37771.1|  Putative inactive receptor kinase                       165   1e-45   
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...    171   1e-45   
gb|EEE55588.1|  hypothetical protein OsJ_03884                          164   1e-45   
gb|KHN25793.1|  Putative inactive receptor kinase                       171   1e-45   
gb|KJB27114.1|  hypothetical protein B456_004G278900                    170   1e-45   
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...    170   2e-45   
ref|XP_002870624.1|  kinase family protein                              166   2e-45   
ref|XP_006579204.1|  PREDICTED: probable inactive receptor kinase...    167   3e-45   
ref|XP_002960794.1|  hypothetical protein SELMODRAFT_74002              170   3e-45   
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    169   3e-45   
gb|KHN00038.1|  Putative inactive receptor kinase                       162   3e-45   
gb|EEC75189.1|  hypothetical protein OsI_11426                          168   4e-45   
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                    169   4e-45   
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                  169   4e-45   
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...    169   5e-45   
gb|KJB07168.1|  hypothetical protein B456_001G003200                    169   5e-45   
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...    169   5e-45   
emb|CDY54343.1|  BnaC03g14930D                                          169   5e-45   
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...    168   6e-45   
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g             169   7e-45   
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...    168   8e-45   
ref|XP_010109178.1|  putative inactive receptor kinase                  168   9e-45   
ref|XP_002865969.1|  hypothetical protein ARALYDRAFT_357577             167   1e-44   
gb|EAY91619.1|  hypothetical protein OsI_13254                          160   1e-44   
ref|NP_001050019.1|  Os03g0332900                                       167   1e-44   
gb|KHN48152.1|  Putative inactive receptor kinase                       160   2e-44   
gb|EMT17815.1|  Putative inactive receptor kinase                       167   2e-44   
gb|KDP21623.1|  hypothetical protein JCGZ_03294                         167   2e-44   
ref|NP_001051064.1|  Os03g0712400                                       159   2e-44   
gb|KEH35517.1|  receptor-like kinase                                    167   2e-44   
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...    167   2e-44   
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...    167   2e-44   
gb|KHN40012.1|  Putative inactive receptor kinase                       159   2e-44   
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...    167   2e-44   
ref|XP_010271320.1|  PREDICTED: probable inactive receptor kinase...    167   3e-44   
gb|EPS73425.1|  hypothetical protein M569_01324                         166   3e-44   
emb|CDX88667.1|  BnaA03g09820D                                          167   3e-44   
emb|CDY47068.1|  BnaA03g12300D                                          166   3e-44   
ref|XP_010553544.1|  PREDICTED: probably inactive receptor-like p...    162   3e-44   
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...    166   4e-44   
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...    166   4e-44   
gb|EYU24506.1|  hypothetical protein MIMGU_mgv1a0087053mg               161   4e-44   
gb|KFK26952.1|  hypothetical protein AALP_AA8G314900                    165   5e-44   
ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...    166   5e-44   
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg                166   5e-44   
ref|XP_006280204.1|  hypothetical protein CARUB_v10026109mg             166   6e-44   
ref|XP_008810158.1|  PREDICTED: probable inactive receptor kinase...    166   7e-44   
dbj|BAE99195.1|  receptor protein kinase like protein                   165   1e-43   
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...    165   1e-43   
ref|NP_200144.1|  putative inactive receptor kinase                     165   1e-43   
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...    165   1e-43   
ref|XP_003631134.1|  Atypical receptor-like kinase MARK                 165   1e-43   
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g             164   1e-43   
gb|EMT12910.1|  Putative inactive receptor kinase                       165   2e-43   
dbj|BAH57151.1|  AT3G08680                                              158   2e-43   
ref|XP_009132484.1|  PREDICTED: probable inactive receptor kinase...    164   2e-43   
dbj|BAB62593.1|  putative receptor-like protein kinase                  164   2e-43   
dbj|BAJ93317.1|  predicted protein                                      164   2e-43   
dbj|BAK07296.1|  predicted protein                                      164   2e-43   
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110          164   2e-43   
gb|KEH23299.1|  LRR receptor-like kinase                                164   2e-43   
gb|KHN40609.1|  Putative inactive receptor kinase                       164   3e-43   
ref|XP_010442890.1|  PREDICTED: probable inactive receptor kinase...    164   3e-43   
ref|XP_010445702.1|  PREDICTED: probable inactive receptor kinase...    164   3e-43   
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...    164   3e-43   
ref|XP_010482722.1|  PREDICTED: probable inactive receptor kinase...    164   3e-43   
gb|AET05610.2|  LRR receptor-like kinase                                164   4e-43   
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...    163   4e-43   
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...    163   5e-43   
ref|XP_004308997.1|  PREDICTED: probable inactive receptor kinase...    163   5e-43   
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...    163   5e-43   
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...    163   5e-43   
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...    163   6e-43   
ref|XP_006826909.1|  hypothetical protein AMTR_s00010p00158940          163   6e-43   
gb|EEE59802.1|  hypothetical protein OsJ_12326                          159   6e-43   
gb|EYU30898.1|  hypothetical protein MIMGU_mgv1a003238mg                162   7e-43   
ref|XP_004145847.1|  PREDICTED: probable inactive receptor kinase...    163   8e-43   
ref|XP_010921194.1|  PREDICTED: probable inactive receptor kinase...    159   9e-43   
ref|NP_974867.1|  probably inactive receptor-like protein kinase        158   1e-42   
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...    162   1e-42   
ref|XP_008381374.1|  PREDICTED: probable inactive receptor kinase...    155   1e-42   
gb|EMT09037.1|  Putative inactive receptor kinase                       162   1e-42   
ref|XP_006284079.1|  hypothetical protein CARUB_v10005208mg             158   1e-42   
ref|XP_010925124.1|  PREDICTED: probable inactive receptor kinase...    162   1e-42   
emb|CDX98821.1|  BnaC09g50140D                                          162   1e-42   
ref|XP_009122125.1|  PREDICTED: probable leucine-rich repeat rece...    162   1e-42   
ref|NP_198983.2|  probably inactive receptor-like protein kinase        158   1e-42   
ref|XP_008457025.1|  PREDICTED: probable inactive receptor kinase...    162   1e-42   
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...    162   1e-42   
ref|XP_008388374.1|  PREDICTED: probable inactive receptor kinase...    162   2e-42   
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g             161   2e-42   
gb|KHN35064.1|  Putative inactive receptor kinase                       160   3e-42   
gb|KFK24939.1|  hypothetical protein AALP_AA8G045400                    161   3e-42   
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg                161   3e-42   
ref|XP_006401720.1|  hypothetical protein EUTSA_v10013013mg             161   3e-42   
gb|ACU19868.1|  unknown                                                 155   3e-42   
ref|NP_001168214.1|  uncharacterized protein LOC100381972               155   3e-42   
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...    161   3e-42   
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...    161   3e-42   
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...    161   3e-42   
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...    160   4e-42   
gb|ACB41630.1|  At2g26730-like protein                                  150   4e-42   
ref|XP_004137511.1|  PREDICTED: probable inactive receptor kinase...    160   5e-42   
ref|XP_008466324.1|  PREDICTED: probable inactive receptor kinase...    160   5e-42   
gb|AFO11639.1|  At2g26730-like protein                                  149   6e-42   
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...    160   6e-42   
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...    160   6e-42   
ref|XP_002972265.1|  hypothetical protein SELMODRAFT_267563             160   6e-42   
ref|XP_010268752.1|  PREDICTED: probable inactive receptor kinase...    160   7e-42   
ref|XP_004163815.1|  PREDICTED: probable inactive receptor kinase...    160   7e-42   
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg             160   7e-42   
gb|AFO11664.1|  At2g26730-like protein                                  149   8e-42   
ref|XP_002984179.1|  hypothetical protein SELMODRAFT_156455             160   8e-42   
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...    160   8e-42   
ref|XP_006651742.1|  PREDICTED: probable inactive receptor kinase...    159   1e-41   
ref|XP_006289209.1|  hypothetical protein CARUB_v10002657mg             159   1e-41   
ref|XP_008813619.1|  PREDICTED: probable inactive receptor kinase...    157   1e-41   
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    159   1e-41   
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor             159   1e-41   
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...    159   1e-41   
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...    159   1e-41   
ref|XP_010452417.1|  PREDICTED: probable leucine-rich repeat rece...    159   1e-41   
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...    159   1e-41   
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...    159   1e-41   
gb|KHN10529.1|  Putative inactive receptor kinase                       158   2e-41   
ref|XP_002871141.1|  hypothetical protein ARALYDRAFT_325150             159   2e-41   
gb|KJB83149.1|  hypothetical protein B456_013G231600                    150   2e-41   
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170             159   2e-41   
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...    159   2e-41   
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...    159   2e-41   
ref|XP_002991819.1|  hypothetical protein SELMODRAFT_42017              159   2e-41   
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein     159   2e-41   
emb|CDY35996.1|  BnaA05g29540D                                          158   2e-41   
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg             159   2e-41   
gb|AAK18840.1|AC082645_10  putative receptor kinase                     159   3e-41   
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg             158   3e-41   
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...    158   3e-41   



>gb|KDP25339.1| hypothetical protein JCGZ_20495 [Jatropha curcas]
Length=627

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GLSAIMS LAPP++RAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  461  NSRHYGCVSDLGLSAIMSQLAPPISRAAGYRAPEVTDTRKAAQPSDVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIALSCVVRM
Sbjct  521  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRFPNIEEEMVEMLQIALSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  221
            PDQRPKM +VVKMIE VRR D  ENR S EN
Sbjct  581  PDQRPKMQDVVKMIENVRRVD-TENRPSSEN  610



>gb|KHN16761.1| Putative inactive receptor kinase [Glycine soja]
Length=369

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSD+GL+ I SSLA P++RAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  193  NSKQYGCVSDLGLATISSSLALPISRAAGYRAPEVTDTRKAAQPSDVYSFGVVLLELLTG  252

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  253  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEMLQIAMSCVVRM  312

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  197
            PDQRPKM EVVKMIE VR+ D  +   S  N A +L  S
Sbjct  313  PDQRPKMSEVVKMIENVRQTD-AQTHSSSGNQAEQLKFS  350



>ref|XP_002509916.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51303.1| ATP binding protein, putative [Ricinus communis]
Length=536

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GLS IMS LA P++RAAGYRAPEV DTRKA  P+DVYSFGV+LLELLTG
Sbjct  369  NSRQYGCVSDLGLSTIMSPLAAPISRAAGYRAPEVTDTRKAGQPADVYSFGVVLLELLTG  428

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIALSCVVR+
Sbjct  429  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRFPNIEEEMVEMLQIALSCVVRI  488

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  221
            PDQRPKMP+VVKMIE VRR D  +NR S EN
Sbjct  489  PDQRPKMPDVVKMIESVRRID-TDNRPSSEN  518



>ref|XP_004511532.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Cicer arietinum]
Length=356

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+KQYGCVSD+GL+ IMSS+  PV+RAAGYRAPEV DTRKA   SDVYSFGV+LLELLTG
Sbjct  186  NTKQYGCVSDLGLATIMSSVTQPVSRAAGYRAPEVTDTRKATQASDVYSFGVVLLELLTG  245

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  246  KSPIHTTRGDEIIHLVRWVHSVVREEWTAEVFDLELMRCPNIEEEMVEMLQIAMSCVVRM  305

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQ  185
             DQRPKM E+V MIE VR+ D +ENR S EN A   +  +  Q
Sbjct  306  HDQRPKMSEIVSMIENVRQID-IENRPSSENQAESETQHTFSQ  347



>ref|XP_008239079.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008239080.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSDVGL+ IMSSLAPP++RAAGYRAPEV DTRKA   +DVYSFGV+LLELLTG
Sbjct  461  NSQQYGCVSDVGLATIMSSLAPPISRAAGYRAPEVTDTRKAGQAADVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEI+HLVRWVHSVVREEWTAEVFD++L++  +IEEEMVEMLQIA+SCVVRM
Sbjct  521  KSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDIELMRYLNIEEEMVEMLQIAMSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKM +VVKMIE VRRND+ ENR S  N +   +P
Sbjct  581  PDQRPKMLDVVKMIESVRRNDN-ENRPSSGNRSESSTP  617



>ref|XP_004245544.1| PREDICTED: probable inactive receptor kinase At4g23740 [Solanum 
lycopersicum]
Length=642

 Score =   258 bits (659),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSDVGLS IMSSLA PVARAAG+RAPEV DTRKA  PSDVYSFGVLLLELLTG
Sbjct  471  NSKQYGCVSDVGLSTIMSSLAHPVARAAGFRAPEVTDTRKATQPSDVYSFGVLLLELLTG  530

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDE+IHLVRWVHSVVREEWTAEVFD++LL+ P+IEEEMVEMLQIA+SCVVRM
Sbjct  531  KSPIHTTNGDEVIHLVRWVHSVVREEWTAEVFDLELLRYPNIEEEMVEMLQIAMSCVVRM  590

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
             DQRPKM EVVKMIE VR    LEN+ S E  A   +P
Sbjct  591  SDQRPKMFEVVKMIENVRPTS-LENQLSSEGKAETSTP  627



>ref|XP_006343895.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Solanum 
tuberosum]
Length=642

 Score =   258 bits (659),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSDVGLS IMSSLA PVARAAG+RAPEV DTRKA  PSDVYSFGVLLLELLTG
Sbjct  471  NSKQYGCVSDVGLSTIMSSLAHPVARAAGFRAPEVTDTRKATQPSDVYSFGVLLLELLTG  530

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDE+IHLVRWVHSVVREEWTAEVFD++LL+ P+IEEEMVEMLQIA+SCVVRM
Sbjct  531  KSPIHTTNGDEVIHLVRWVHSVVREEWTAEVFDLQLLRYPNIEEEMVEMLQIAMSCVVRM  590

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
             DQRPKM EVVKMIE VR    LEN  S E  A   +P
Sbjct  591  SDQRPKMFEVVKMIENVRPTS-LENEHSSEGKAETSTP  627



>gb|KEH21182.1| LRR receptor-like kinase [Medicago truncatula]
Length=639

 Score =   258 bits (658),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+KQYGCVSD+GL+ I +SLA P++RAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  459  NTKQYGCVSDLGLATISTSLALPISRAAGYRAPEVTDTRKAAQPSDVYSFGVVLLELLTG  518

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  519  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEMLQIAMSCVVRM  578

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN-GASRLSPSS  194
            PDQRPKM EVVKMIE VR+ D+ + + S EN G  +LS  +
Sbjct  579  PDQRPKMSEVVKMIENVRQIDNTQTQPSSENQGGVKLSSQT  619



>ref|XP_007210296.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
 gb|EMJ11495.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
Length=656

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSDVGL+ IMSSLAPP++RAAGYRAPEV DTRKA   +DVYSFGV+LLELLTG
Sbjct  488  NSQQYGCVSDVGLATIMSSLAPPISRAAGYRAPEVTDTRKAGQAADVYSFGVVLLELLTG  547

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEI+HLVRWVHSVVREEWTAEVFD++L++  +IEEEMVEMLQIA+SCVVRM
Sbjct  548  KSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDIELMRYLNIEEEMVEMLQIAMSCVVRM  607

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKM +VVKMIE VRRND+ ENR S  N +   +P
Sbjct  608  PDQRPKMLDVVKMIESVRRNDN-ENRPSSGNRSESSTP  644



>ref|XP_009629119.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=648

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSDVGLS+IMSSLA PVARAAG+RAPE+ DTRKA  PSDVYSFGVLLLELLTG
Sbjct  478  NSKQYGCVSDVGLSSIMSSLAHPVARAAGFRAPEITDTRKATQPSDVYSFGVLLLELLTG  537

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+ P+IEEEMVEMLQIA+SCVVRM
Sbjct  538  KSPIHTTNGDEIIHLVRWVHSVVREEWTAEVFDLELLRYPNIEEEMVEMLQIAMSCVVRM  597

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
             DQRPKM EVVKMIE VR    L+N+ S E      +P
Sbjct  598  ADQRPKMSEVVKMIENVRPTG-LDNQLSSEGKTENSTP  634



>ref|XP_011080874.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 2/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+Q+GCVSD+GLS IMSSLAPP+ARAAGYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  468  NSRQFGCVSDLGLSTIMSSLAPPIARAAGYRAPEVTDTRKATQPSDVYSFGVILLELLTG  527

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPVHTT+GDEI+HLVRWVHSVVREEWTAEVFDV+LL+ PDIEEE+VEMLQIA++CVVRM
Sbjct  528  KSPVHTTNGDEIVHLVRWVHSVVREEWTAEVFDVELLRYPDIEEELVEMLQIAMACVVRM  587

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
             DQRPKM EVVKMIE VR  +   NR S E  +   +P
Sbjct  588  SDQRPKMSEVVKMIENVRLAE--TNRTSSEVKSENSTP  623



>ref|XP_010104998.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC02955.1| putative inactive receptor kinase [Morus notabilis]
Length=646

 Score =   256 bits (653),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+Q+GCVSDVGL++IMSSLAPP++RAAGYRAPEV DTRKAA PSD+YSFGV+LLELLTG
Sbjct  476  NSRQFGCVSDVGLASIMSSLAPPISRAAGYRAPEVTDTRKAAQPSDIYSFGVVLLELLTG  535

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWT EVFD++L++ P+IEEEMVEMLQIA++CVVRM
Sbjct  536  KSPIHTTAGDEIIHLVRWVHSVVREEWTDEVFDIELMRYPNIEEEMVEMLQIAMACVVRM  595

Query  313  PDQRPKMPEVVKMIEGVRRNDH  248
            PDQRPKM +VVKMIE VRR D+
Sbjct  596  PDQRPKMSDVVKMIENVRRIDN  617



>ref|XP_009799943.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=649

 Score =   256 bits (653),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSDVGLS+IMSSLA PVARAAG+RAPE+ DTRKA  PSDVYS+GVLLLELLTG
Sbjct  479  NSKQYGCVSDVGLSSIMSSLAHPVARAAGFRAPEITDTRKATQPSDVYSYGVLLLELLTG  538

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPVHTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+ P+IEEEMVEMLQIA+SCVVRM
Sbjct  539  KSPVHTTNGDEIIHLVRWVHSVVREEWTAEVFDLELLRYPNIEEEMVEMLQIAMSCVVRM  598

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
             DQRPKM EVVKMIE VR    LEN+ S E      +P
Sbjct  599  ADQRPKMSEVVKMIENVRPTG-LENQFSSEGRTENSTP  635



>ref|XP_007040424.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040425.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040426.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24925.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24926.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24927.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=626

 Score =   254 bits (650),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GLS IMS LAPP++RAAGYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  461  NSEQYGCVSDLGLSTIMSPLAPPISRAAGYRAPEVTDTRKAMQPSDVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA++CVVRM
Sbjct  521  KSPIHTTGGDEIVHLVRWVHSVVREEWTAEVFDIELMRYPNIEEEMVEMLQIAMTCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKMPE+VKM+E VR  +  ENR S  N +   +P
Sbjct  581  PDQRPKMPELVKMLENVRHIES-ENRPSSGNRSESSTP  617



>ref|XP_006584744.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006584745.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
 ref|XP_006584746.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Glycine max]
 ref|XP_006584747.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X4 [Glycine max]
 ref|XP_006584748.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X5 [Glycine max]
 ref|XP_006584749.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X6 [Glycine max]
 ref|XP_006584750.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X7 [Glycine max]
 ref|XP_006584751.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X8 [Glycine max]
Length=638

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSD+GL+ I SSLA P++RAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  462  NSKQYGCVSDLGLATISSSLALPISRAAGYRAPEVTDTRKAAQPSDVYSFGVVLLELLTG  521

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  522  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEMLQIAMSCVVRM  581

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  197
            PDQRPKM EVVKMIE VR+ D  +   S  N A +L  S
Sbjct  582  PDQRPKMSEVVKMIENVRQTD-AQTHSSSGNQAEQLKFS  619



>ref|XP_004300851.1| PREDICTED: probable inactive receptor kinase At4g23740 [Fragaria 
vesca subsp. vesca]
Length=635

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSD+GL+ IMSSLA P++RA+GYRAPEV DTRKAA P+DVYSFGV+LLELLTG
Sbjct  460  NTQQYGCVSDIGLTTIMSSLAAPISRASGYRAPEVTDTRKAAQPADVYSFGVMLLELLTG  519

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEI+HLVRWVHSVVREEWTAEVFD++L++ P IEEEMVEMLQIA+SCV RM
Sbjct  520  KSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDLELMRYPGIEEEMVEMLQIAMSCVARM  579

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKM +VVKMIE VR  D+ +NR S EN +   +P
Sbjct  580  PDQRPKMLDVVKMIENVRHMDN-DNRPSSENRSESSTP  616



>ref|XP_002299495.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE84300.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I S LAPP+ARAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  461  NSQQYGCVSDLGLATITSPLAPPIARAAGYRAPEVADTRKAAQPSDVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA+SCV RM
Sbjct  521  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMSCVARM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PD+RPKM +VV+MIE VR+ D  EN +S +N +   +P
Sbjct  581  PDKRPKMTDVVRMIENVRQMD-TENHQSPQNRSESSTP  617



>ref|XP_009336254.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=654

 Score =   253 bits (646),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSDVGL+ IMSSLAPP++RAAGYRAPEV DTRK+  P+DVYSFGV+LLELLTG
Sbjct  486  NTQQYGCVSDVGLATIMSSLAPPISRAAGYRAPEVTDTRKSGQPADVYSFGVVLLELLTG  545

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEI+HLVRWVHSVVREEWTAEVFD++L++  +IEEEMVEMLQIA+SCVVRM
Sbjct  546  KSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDIELMRYLNIEEEMVEMLQIAMSCVVRM  605

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKM +VVKMIE VR+ D+ +NR S  N +   +P
Sbjct  606  PDQRPKMLDVVKMIESVRQADN-DNRPSSGNRSESSTP  642



>ref|XP_006580544.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006580545.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
 gb|KHM99924.1| Putative inactive receptor kinase [Glycine soja]
Length=615

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+KQYGCVSD+GL+ I SSLA P++RAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  462  NTKQYGCVSDLGLATISSSLALPISRAAGYRAPEVTDTRKAAQPSDVYSFGVVLLELLTG  521

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  522  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEMLQIAMSCVVRM  581

Query  313  PDQRPKMPEVVKMIEGVRRND  251
            PDQRPKM EVVKMIE VR+ D
Sbjct  582  PDQRPKMSEVVKMIENVRQID  602



>ref|XP_003611028.1| Probably inactive receptor-like protein kinase [Medicago truncatula]
 gb|AES93986.1| LRR receptor-like kinase [Medicago truncatula]
Length=610

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+KQYGCVSD+GL+ IMSS+  P++RA+GYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  436  NTKQYGCVSDLGLATIMSSVVQPISRASGYRAPEVTDTRKATQPSDVYSFGVVLLELLTG  495

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SC  RM
Sbjct  496  KSPIHTTRGDEIVHLVRWVHSVVREEWTAEVFDLELMRCPNIEEEMVEMLQIAMSCATRM  555

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQ  185
            PDQRP M E+VKMIE VR+ D +ENR S EN A   +   I Q
Sbjct  556  PDQRPMMSEIVKMIENVRQLD-IENRPSSENQAESAAQHQISQ  597



>ref|XP_006439412.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
 gb|ESR52652.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
Length=625

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I S+LAP +ARAAGYRAPEV D+RKA   SDVYSFGV+LLE+LTG
Sbjct  461  NSQQYGCVSDLGLTTITSALAPVIARAAGYRAPEVTDSRKATQASDVYSFGVVLLEILTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQIA+SCVVRM
Sbjct  521  KSPIHTTGGDELVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIAMSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKMP+VV++IE VR ND  ENR S  N +   +P
Sbjct  581  PDQRPKMPDVVRVIENVRPNDS-ENRPSSGNKSESSTP  617



>gb|KDO76442.1| hypothetical protein CISIN_1g006922mg [Citrus sinensis]
Length=625

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I S+LAP +ARAAGYRAPEV D+RKA   SDVYSFGV+LLE+LTG
Sbjct  461  NSQQYGCVSDLGLTTITSALAPVIARAAGYRAPEVTDSRKATQASDVYSFGVVLLEILTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQIA+SCVVRM
Sbjct  521  KSPIHTTGGDELVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIAMSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKMP+VV++IE VR ND  ENR S  N +   +P
Sbjct  581  PDQRPKMPDVVRVIENVRPNDS-ENRPSSGNKSESSTP  617



>ref|XP_008392458.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +QYGCVSDVGL+ I SSLAPP++RAAGYRAPEV DTRK+  P+DVYSFGV+LLELLTG
Sbjct  461  NMQQYGCVSDVGLATITSSLAPPISRAAGYRAPEVTDTRKSGQPADVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++L++   IEEEMVEMLQIA+SCV RM
Sbjct  521  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDLELMRYLYIEEEMVEMLQIAMSCVARM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  191
            PDQRPKM +V KMIE VRR D+ +NR S EN +   +P+ +
Sbjct  581  PDQRPKMLDVAKMIENVRRADN-DNRTSSENRSESSTPAPV  620



>gb|AFK45382.1| unknown [Medicago truncatula]
Length=610

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+KQYGCVSD+GL+ IMSS+  P++RA+GYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  436  NTKQYGCVSDLGLATIMSSVVQPISRASGYRAPEVTDTRKATQPSDVYSFGVVLLELLTG  495

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SC  RM
Sbjct  496  KSPIHTTRGDEIVHLVRWVHSVVREEWTAEVFDLELMRCPNIEEEMVEMLQIAMSCATRM  555

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQ  185
            PDQRP M E+VKMIE VR+ D +ENR + EN A   +   I Q
Sbjct  556  PDQRPMMSEIVKMIENVRQLD-IENRPTSENQAESAAQHQISQ  597



>ref|XP_004511531.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Cicer arietinum]
Length=607

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+KQYGCVSD+GL+ IMSS+  PV+RAAGYRAPEV DTRKA   SDVYSFGV+LLELLTG
Sbjct  437  NTKQYGCVSDLGLATIMSSVTQPVSRAAGYRAPEVTDTRKATQASDVYSFGVVLLELLTG  496

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  497  KSPIHTTRGDEIIHLVRWVHSVVREEWTAEVFDLELMRCPNIEEEMVEMLQIAMSCVVRM  556

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQ  185
             DQRPKM E+V MIE VR+ D +ENR S EN A   +  +  Q
Sbjct  557  HDQRPKMSEIVSMIENVRQID-IENRPSSENQAESETQHTFSQ  598



>ref|XP_008437363.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437364.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437365.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437367.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=628

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I SSL+PP++RAAGYRAPEV DTRKA   SDV+SFGV+LLELLTG
Sbjct  461  NSQQYGCVSDLGLATITSSLSPPISRAAGYRAPEVTDTRKATQASDVFSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIALSCV R+
Sbjct  521  KSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIALSCVARI  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQECS  176
            PDQRPKMPE+VKMIE VR  +  ENR S     S + P ++E E S
Sbjct  581  PDQRPKMPEIVKMIENVRPMEA-ENRPSTNQLESSMLPQAVETENS  625



>ref|XP_004167870.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740-like [Cucumis sativus]
Length=628

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I SSL+PP++RAAGYRAPEV DTRKA   SDV+SFGV+LLELLTG
Sbjct  461  NSQQYGCVSDLGLATITSSLSPPISRAAGYRAPEVTDTRKATQASDVFSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIALSCV R+
Sbjct  521  KSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIALSCVARI  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQECS  176
            PDQRPKMPE+VKMIE VR  +  ENR S     S + P ++E E S
Sbjct  581  PDQRPKMPEIVKMIENVRPMEA-ENRPSTNQLESSMLPQAVETENS  625



>ref|XP_006476438.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=625

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I S+LAP +ARAAGYRAPEV D+RKA   SDVYSFGV+LLE+LTG
Sbjct  461  NSQQYGCVSDLGLTTITSALAPVIARAAGYRAPEVTDSRKATQASDVYSFGVVLLEILTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQIA+SCVVRM
Sbjct  521  KSPIHTTGGDELVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIAMSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKMP+VV++IE VR ND  ENR S  N +   +P
Sbjct  581  PDQRPKMPDVVRVIENVRPNDS-ENRPSSGNKSESSTP  617



>ref|XP_004503646.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cicer 
arietinum]
Length=645

 Score =   250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+KQYGCVSD+GL+ I SSL  P++RAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  465  NTKQYGCVSDLGLATISSSLPLPISRAAGYRAPEVTDTRKAAQPSDVYSFGVVLLELLTG  524

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  525  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRFPNIEEEMVEMLQIAMSCVVRM  584

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGAS-RLS  203
            PDQRPK+ EVVKMIE VR+ D    + S +N A  RLS
Sbjct  585  PDQRPKISEVVKMIENVRQIDAQTQQSSDQNQAGLRLS  622



>ref|XP_004143879.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN50039.1| hypothetical protein Csa_5G151550 [Cucumis sativus]
Length=628

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I SSL+PP++RAAGYRAPEV DTRKA   SDV+SFGV+LLELLTG
Sbjct  461  NSQQYGCVSDLGLATITSSLSPPISRAAGYRAPEVTDTRKATQASDVFSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIALSCV R+
Sbjct  521  KSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIALSCVARI  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQECS  176
            PDQRPKMPE+VKMIE VR  +  ENR S     S + P ++E E S
Sbjct  581  PDQRPKMPEIVKMIENVRPMEA-ENRPSTNQLESSMLPQAVETENS  625



>gb|KJB19053.1| hypothetical protein B456_003G082600 [Gossypium raimondii]
 gb|KJB19054.1| hypothetical protein B456_003G082600 [Gossypium raimondii]
Length=630

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYG VSD+GLS IM +LAPP++RAAGYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  461  NSQQYGSVSDLGLSTIMGALAPPISRAAGYRAPEVTDTRKAMQPSDVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA++CVVRM
Sbjct  521  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDIELMRYPNIEEEMVEMLQIAMTCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKM ++VKMIE VR  +  ENR+S  N +   +P
Sbjct  581  PDQRPKMADLVKMIENVRAIES-ENRQSSGNRSESSTP  617



>ref|XP_002303623.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78602.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL  I SSLAPP+ARAAGYRAPEV DTRKAA PSD+YSFGV+LLELLTG
Sbjct  461  NSRCYGCVSDLGLVTITSSLAPPIARAAGYRAPEVADTRKAAQPSDIYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT  DEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  521  KSPIHTTGSDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKM EVVKMIE VR+ D  EN +  E+ +   +P
Sbjct  581  PDQRPKMTEVVKMIENVRQID-TENHQPSESRSESSTP  617



>ref|XP_007160136.1| hypothetical protein PHAVU_002G295600g [Phaseolus vulgaris]
 gb|ESW32130.1| hypothetical protein PHAVU_002G295600g [Phaseolus vulgaris]
Length=637

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYG VSD+GL+ I SSLA P++RAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  461  NSKQYGSVSDLGLATISSSLALPISRAAGYRAPEVTDTRKAAQPSDVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  521  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEMLQIAMSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRL  206
            PDQRPKM EVVKMIE VR+ D  E   S  N A +L
Sbjct  581  PDQRPKMSEVVKMIENVRQIDG-EPYSSSGNQAEQL  615



>gb|KHN25658.1| Putative inactive receptor kinase [Glycine soja]
Length=425

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSD+GL+ IMSS+A P++RAAGYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  261  NSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEVTDTRKATQPSDVYSFGVVLLELLTG  320

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPV+TT  DEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVR+
Sbjct  321  KSPVYTTGSDEIVHLVRWVHSVVREEWTAEVFDLELIRYPNIEEEMVEMLQIAMSCVVRV  380

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRS  230
            PDQRPKM E+VKMIE VR+ + + N+ S
Sbjct  381  PDQRPKMLELVKMIENVRQIEIVVNQPS  408



>ref|XP_011022559.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=622

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL  I SSLAPP+ARAAGYRAPE+ DTRKAA PSD+YSFGV+LLELLTG
Sbjct  461  NSQCYGCVSDLGLVTITSSLAPPIARAAGYRAPEIADTRKAAQPSDIYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT  DEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA+SCVVRM
Sbjct  521  KSPIHTTGSDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRND  251
            PDQRPKM EVVKMIE VR+ D
Sbjct  581  PDQRPKMTEVVKMIENVRQID  601



>ref|XP_011026938.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
 ref|XP_011026939.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
Length=626

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I S L PP+ARAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  461  NSQQYGCVSDLGLATITSPLTPPIARAAGYRAPEVADTRKAAQPSDVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA+SCV RM
Sbjct  521  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMSCVARM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PD+RPKM +VV MIE VR+ D  EN ++ +N +   +P
Sbjct  581  PDKRPKMTDVVIMIENVRQMD-TENHQTPQNRSESSTP  617



>ref|XP_011026937.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Populus euphratica]
Length=652

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ I S L PP+ARAAGYRAPEV DTRKAA PSDVYSFGV+LLELLTG
Sbjct  487  NSQQYGCVSDLGLATITSPLTPPIARAAGYRAPEVADTRKAAQPSDVYSFGVVLLELLTG  546

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA+SCV RM
Sbjct  547  KSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMSCVARM  606

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PD+RPKM +VV MIE VR+ D  EN ++ +N +   +P
Sbjct  607  PDKRPKMTDVVIMIENVRQMD-TENHQTPQNRSESSTP  643



>emb|CDP12117.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GLS +MSSLA P+ARAAGYRAPEV+DTRKA   SDVYSFGV+LLELLTG
Sbjct  466  NSRQYGCVSDLGLSTVMSSLALPIARAAGYRAPEVMDTRKATQSSDVYSFGVMLLELLTG  525

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTTSGDEI+HLVRWVHSVVREEWTAEVFD++LL+ P+IEEE+VEMLQIA++CVVRM
Sbjct  526  KSPIHTTSGDEIVHLVRWVHSVVREEWTAEVFDLELLRYPNIEEELVEMLQIAMACVVRM  585

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCE--NGASRLSP  200
            PDQRPKM EV KMI  VR    + NR S E   G S  +P
Sbjct  586  PDQRPKMSEVAKMIANVRPT-AIRNRSSGELKTGNSSQTP  624



>ref|XP_009352353.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009352354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=629

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSDVGL+ I SSLAPP++RAAGYRAPEV DTRK+  P+DVYSFGV+LLELLTG
Sbjct  461  NTQQYGCVSDVGLATITSSLAPPISRAAGYRAPEVTDTRKSGQPADVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++L++   IEEEMVEMLQIA+SCV RM
Sbjct  521  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDLELMRYLYIEEEMVEMLQIAMSCVARM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKM +V KMIE VRR D+ +NR   EN +   +P
Sbjct  581  PDQRPKMLDVAKMIENVRRADN-DNRPCSENRSESSTP  617



>ref|XP_010658906.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658908.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658911.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658915.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 136/158 (86%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++ YGCVSD+GL+ +MS LAPP++RAAGYRAPEV DTRKA+  SDVYSFGV+LLELLTG
Sbjct  459  NARGYGCVSDLGLTTVMSPLAPPISRAAGYRAPEVTDTRKASQSSDVYSFGVVLLELLTG  518

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE+IHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA+ CV+RM
Sbjct  519  KSPIHATGGDEVIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMGCVIRM  578

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKMP+VV++IE VR  D  +NR S E  +   +P
Sbjct  579  PDQRPKMPDVVRLIENVRHTD-TDNRSSFETRSEGSTP  615



>ref|XP_007158557.1| hypothetical protein PHAVU_002G162400g [Phaseolus vulgaris]
 gb|ESW30551.1| hypothetical protein PHAVU_002G162400g [Phaseolus vulgaris]
Length=590

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+KQYGCVSD+GL+ IMSS+  P++RAAGYRAPEV DTRKA  P+DVYSFGV+LLELLTG
Sbjct  423  NTKQYGCVSDLGLATIMSSVPIPISRAAGYRAPEVTDTRKATQPADVYSFGVVLLELLTG  482

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPV+TT GDEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVR 
Sbjct  483  KSPVYTTGGDEIVHLVRWVHSVVREEWTAEVFDLELIRYPNIEEEMVEMLQIAMSCVVRD  542

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRR-SCENGA  215
            PDQRPKM EVVKMIE VR+ D + N++ S EN A
Sbjct  543  PDQRPKMSEVVKMIENVRQIDTVVNQQASSENQA  576



>ref|XP_006590496.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=589

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSD+GL+ IMSS+A P++RAAGYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  425  NSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEVTDTRKATQPSDVYSFGVVLLELLTG  484

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPV+TT  DEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVR+
Sbjct  485  KSPVYTTGADEIVHLVRWVHSVVREEWTAEVFDLELIRYPNIEEEMVEMLQIAMSCVVRL  544

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRS  230
            PDQRPKM E+VKMIE VR+ + + N+ S
Sbjct  545  PDQRPKMLELVKMIESVRQIEIVVNQPS  572



>ref|XP_010251541.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251542.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251543.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
Length=636

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL+A+MS +APP++RAAGYRAPEV+DTRKA   SDVYS+GVLLLELLTG
Sbjct  461  NSQNYGCVSDLGLAALMSPVAPPISRAAGYRAPEVLDTRKATQASDVYSYGVLLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPVH T GDE++HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMV MLQIA++CVVRM
Sbjct  521  KSPVHATGGDEVVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVGMLQIAMACVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  197
            P+QRPKMP+VVKM+E +RR D   +R+S E  +   +P+
Sbjct  581  PEQRPKMPDVVKMLEDIRRLDT-GDRQSTETKSESSTPT  618



>ref|XP_003516715.2| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=635

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSD+GL+ IMSS+A P++RAAGYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  471  NSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEVTDTRKATQPSDVYSFGVVLLELLTG  530

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPV+TT  DEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA+SCVVR+
Sbjct  531  KSPVYTTGSDEIVHLVRWVHSVVREEWTAEVFDLELIRYPNIEEEMVEMLQIAMSCVVRV  590

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRS  230
            PDQRPKM E+VKMIE VR+ + + N+ S
Sbjct  591  PDQRPKMLELVKMIENVRQIEIVVNQPS  618



>emb|CDY03526.1| BnaC01g15560D [Brassica napus]
Length=256

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++ GCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  92   NSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  151

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  152  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEMLQIAMSCVVKA  211

Query  313  PDQRPKMPEVVKMIEGV-RRNDHL--ENRRSCENGASRLS  203
            PDQRPKM ++V++IE V  R   L  + +   ENGAS  S
Sbjct  212  PDQRPKMSDLVRLIESVGNRQASLGPDPKPKSENGASETS  251



>ref|XP_011073578.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N  Q+GCVSD GLSA+MS+LA P+ARAAGYRAPEV DTRK+  PSDVYSFGV+LLELLTG
Sbjct  468  NPHQFGCVSDPGLSAVMSALALPIARAAGYRAPEVTDTRKSTQPSDVYSFGVILLELLTG  527

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T+GDE+IHLVRWVHSVVREEWTAEVFDV+LL+ P+IEEE+VEMLQI +SCVVRM
Sbjct  528  KSPIHMTNGDEVIHLVRWVHSVVREEWTAEVFDVELLRYPNIEEELVEMLQIGMSCVVRM  587

Query  313  PDQRPKMPEVVKMIEGVR  260
            PDQRPKM EVVKM+E VR
Sbjct  588  PDQRPKMSEVVKMVENVR  605



>ref|XP_010538821.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
 ref|XP_010538822.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=616

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+  GCVSD+GLSA+MS L PP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  462  NSQLDGCVSDLGLSAVMSPLTPPISRQAGYRAPEVTDTRKSSQASDVYSFGVVLLELLTG  521

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LLK PDIEEEMVEMLQIA+SCVVR+
Sbjct  522  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLKYPDIEEEMVEMLQIAMSCVVRV  581

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGA  215
            PDQRPKM ++V+++E VRR     +  S   GA
Sbjct  582  PDQRPKMSDLVRLLENVRRKPDRGSESSTPTGA  614



>ref|XP_011001931.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001932.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001933.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL+++MS + PPV RAAGYRAPEV DTRKA H SDVYS+GVLLLELLTG
Sbjct  461  NSQGYGCVSDIGLASLMSPMPPPVMRAAGYRAPEVTDTRKATHASDVYSYGVLLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEMLQI LSCVVRM
Sbjct  521  KSPMHTTGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEMLQIGLSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKMP+VVKM+E +R+
Sbjct  581  PEQRPKMPDVVKMVEEIRQ  599



>ref|XP_011001936.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001938.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL+++MS + PPV RAAGYRAPEV DTRKA H SDVYS+GVLLLELLTG
Sbjct  461  NSQGYGCVSDIGLASLMSPMPPPVMRAAGYRAPEVTDTRKATHASDVYSYGVLLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEMLQI LSCVVRM
Sbjct  521  KSPMHTTGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEMLQIGLSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKMP+VVKM+E +R+
Sbjct  581  PEQRPKMPDVVKMVEEIRQ  599



>ref|XP_010055829.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055830.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055831.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055832.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW72378.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72379.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72380.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
Length=634

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +QYGCVSD+GL+A+MSSLAPP++RAAGYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  465  NPQQYGCVSDLGLAAVMSSLAPPISRAAGYRAPEVTDTRKAGQPSDVYSFGVVLLELLTG  524

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPVH T   E++HLVRWVHSVVREEWTAEVFDV+L++ P+IEEE+VEMLQIA++CVVRM
Sbjct  525  KSPVHATGYGEMVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEELVEMLQIAMACVVRM  584

Query  313  PDQRPKMPEVVKMIEGVR  260
            PDQRPKM +V KMIE VR
Sbjct  585  PDQRPKMADVAKMIENVR  602



>gb|EYU23390.1| hypothetical protein MIMGU_mgv1a003016mg [Erythranthe guttata]
Length=615

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+Q GC+SD+ LSAIMS+LAPPVARAAGYRAPEVVDTRKA  PSDVYSFGV+LLELLTG
Sbjct  464  NSRQLGCISDIALSAIMSALAPPVARAAGYRAPEVVDTRKATQPSDVYSFGVILLELLTG  523

Query  493  KSPVHT-TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSPVHT   GDEI++LVRWVHSVVREEWTAEVFDV+LL+ P+IEEE+VEMLQIA+ CVVR
Sbjct  524  KSPVHTINGGDEIVNLVRWVHSVVREEWTAEVFDVELLRCPNIEEELVEMLQIAMGCVVR  583

Query  316  MPDQRPKMPEVVKMIEGVRR  257
              D+RPKM +V +MIEGVR+
Sbjct  584  AADRRPKMADVARMIEGVRK  603



>ref|XP_009628885.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
 ref|XP_009628886.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=625

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS  +GC+SD+GL+ IMS L PPV RAAGY+ PEV D+RK +  SDVYSFGVLLLELLTG
Sbjct  457  NSHGFGCISDLGLATIMSPLVPPVMRAAGYQPPEVTDSRKVSQASDVYSFGVLLLELLTG  516

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T  +E++HLVRWVHSVVREEWTAEVFDV+LLK P+IEEEMVEMLQI LSCV RM
Sbjct  517  KSPIHATGTNEVVHLVRWVHSVVREEWTAEVFDVELLKYPNIEEEMVEMLQIGLSCVARM  576

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  188
            PDQRPKMP+VVKM+EGVRR +    R S E     L+P   E
Sbjct  577  PDQRPKMPQVVKMVEGVRRVN-TGTRPSSEGSTPNLTPPMTE  617



>ref|XP_006374322.1| hypothetical protein POPTR_0015s06040g [Populus trichocarpa]
 gb|ERP52119.1| hypothetical protein POPTR_0015s06040g [Populus trichocarpa]
Length=634

 Score =   236 bits (603),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL+++MS + PP+ RAAGYRAPEV D+RKAAH SDVYS+GVLLLELLTG
Sbjct  461  NSQGYGCVSDIGLASLMSPVPPPMMRAAGYRAPEVTDSRKAAHASDVYSYGVLLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEMLQI ++CVVRM
Sbjct  521  KSPMHATGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEMLQIGMACVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKMP+VVKM+E +RR
Sbjct  581  PEQRPKMPDVVKMVEEIRR  599



>ref|XP_009380537.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=639

 Score =   236 bits (603),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSD+GL +I++ + PPV+R+AGYRAPEVVDTRKA+  SD YSFGVLLLELLTG
Sbjct  469  NNQQYGCVSDLGLPSIINPMVPPVSRSAGYRAPEVVDTRKASQASDAYSFGVLLLELLTG  528

Query  493  KSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSP+     GDE+IHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA+SCVVR
Sbjct  529  KSPIQIVGGGDEVIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMSCVVR  588

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
            MPD+RPKMPEVV+MIEG+RR D
Sbjct  589  MPDRRPKMPEVVRMIEGMRRFD  610



>ref|XP_002317741.1| hypothetical protein POPTR_0012s01230g [Populus trichocarpa]
 gb|EEE95961.1| hypothetical protein POPTR_0012s01230g [Populus trichocarpa]
Length=633

 Score =   236 bits (602),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ +GCVSD+GL+++MS + PPV RAAGYRAPEV DTRKA H SDVYS+GV LLELLTG
Sbjct  461  NSQGHGCVSDIGLASLMSPMPPPVMRAAGYRAPEVTDTRKATHASDVYSYGVFLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEMLQI LSCVVRM
Sbjct  521  KSPMHTTGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEMLQIGLSCVVRM  580

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKMP+VVKM+E +R+
Sbjct  581  PEQRPKMPDVVKMVEEIRQ  599



>ref|XP_002513601.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49004.1| ATP binding protein, putative [Ricinus communis]
Length=621

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SDVGL+ +MSS+ PPV RAAGYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  460  NSEGYGCISDVGLATLMSSMPPPVMRAAGYRAPEVTDTRKATHASDVYSFGVLLLELLTG  519

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP H T GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI ++CV RM
Sbjct  520  KSPTHATGGDEVVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMNCVTRM  579

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKM +VV+M+E VR+
Sbjct  580  PEQRPKMLDVVRMVEEVRQ  598



>gb|KDP22183.1| hypothetical protein JCGZ_26014 [Jatropha curcas]
Length=632

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SD+GL+ +MS +  PV RAAGYRAPEV D+RKA H SDVYSFGVLLLELLTG
Sbjct  460  NSEGYGCISDMGLATLMSPMPAPVMRAAGYRAPEVTDSRKATHASDVYSFGVLLLELLTG  519

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H+  GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI ++CVVRM
Sbjct  520  KSPIHSAGGDEVVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMNCVVRM  579

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKMP+VVKM+E +RR
Sbjct  580  PEQRPKMPDVVKMVEEIRR  598



>ref|XP_007038934.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY23435.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=630

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL+A+MS + PPV RAAGYRAPEV DTRKA   SDVYSFGVLLLE+LTG
Sbjct  457  NSEGYGCVSDIGLAAVMSPMPPPVMRAAGYRAPEVADTRKATQASDVYSFGVLLLEILTG  516

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI +SCVVRM
Sbjct  517  KSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVVRM  576

Query  313  PDQRPKMPEVVKMIEGVRRND  251
            P+QRPKM ++V+M+E +RR +
Sbjct  577  PEQRPKMSDLVRMVEEIRRAN  597



>ref|XP_011007941.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011007942.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL+ +MS + PP+ RAAGYRAPEV D+RKAAH SDVYS+GVLLLELLTG
Sbjct  461  NSQGYGCVSDIGLATLMSPVPPPMMRAAGYRAPEVTDSRKAAHASDVYSYGVLLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEMLQI ++CV+RM
Sbjct  521  KSPMHATGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEMLQIGMACVMRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  221
            P+QRPKMP+VVKM+E +RR    E+R S E+
Sbjct  581  PEQRPKMPDVVKMVEEIRRLS-TEDRPSTES  610



>ref|XP_009796898.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796899.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796900.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=625

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ +GC+SD+GL+ IMS L PPV RAAGY+ PEV D+RK +  SDVYSFGVLLLELLTG
Sbjct  457  NSQGFGCISDLGLATIMSPLVPPVMRAAGYQPPEVTDSRKVSQASDVYSFGVLLLELLTG  516

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T  +E++HLVRWVHSVVREEWTAEVFDV+LLK P+IEEEMVEMLQI L+CV RM
Sbjct  517  KSPIHATGTNEVVHLVRWVHSVVREEWTAEVFDVELLKYPNIEEEMVEMLQIGLTCVARM  576

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQECS  176
            PDQRPKM +VVKM+EGVRR +    R S E     L+P   E   S
Sbjct  577  PDQRPKMSQVVKMVEGVRRVN-TGTRPSSEGSTPNLTPPMTEIRSS  621



>ref|XP_010541406.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=621

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+  GCVSD+GLSA+ S LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  466  NSQGSGCVSDLGLSAVTSPLAPPISRQAGYRAPEVTDTRKSSQASDVYSFGVVLLELLTG  525

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LLK P+IEEEMVEMLQ+A+SCVVR+
Sbjct  526  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLKYPNIEEEMVEMLQLAMSCVVRI  585

Query  313  PDQRPKMPEVVKMIEGVR  260
            PD+RPKM ++V++IE VR
Sbjct  586  PDRRPKMSDLVRLIESVR  603



>ref|XP_009137388.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=616

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++YGCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  456  NSERYGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  515

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  516  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEMLQIAMSCVVKA  575

Query  313  PDQRPKMPEVVKMIEGV-RRNDHLENR  236
            PDQRPKM ++V+++E V  R   LE +
Sbjct  576  PDQRPKMSDLVRLVESVGNRRASLETK  602



>ref|XP_010676354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Beta 
vulgaris subsp. vulgaris]
Length=617

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS +YGCVSD GL+++MS LAPP++RAAGYRAPEV DTRKA   SDVYSFGV LLELLTG
Sbjct  462  NSLKYGCVSDFGLASVMSPLAPPISRAAGYRAPEVTDTRKATQASDVYSFGVFLLELLTG  521

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPVHTT GDE++HLVRWVHSVVREEWTAEVFD+++L+ P +EEEMVEMLQIAL+CV R+
Sbjct  522  KSPVHTTGGDELVHLVRWVHSVVREEWTAEVFDLEILRFPHVEEEMVEMLQIALTCVARV  581

Query  313  PDQRPKMPEVVKMIEGVR  260
             DQRP+MP+++KMIE VR
Sbjct  582  ADQRPRMPDLLKMIEEVR  599



>ref|XP_006413522.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
 gb|ESQ54975.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
Length=630

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 137/162 (85%), Gaps = 2/162 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++ GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  466  NSERNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  525

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  526  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKA  585

Query  313  PDQRPKMPEVVKMIE--GVRRNDHLENRRSCENGASRLSPSS  194
            PDQRP+M ++V+++E  G RR   LE +   EN AS  S  S
Sbjct  586  PDQRPRMSDLVRLMENVGNRRAASLEPKPKSENEASETSTPS  627



>ref|XP_004502606.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Cicer arietinum]
Length=597

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 130/162 (80%), Gaps = 3/162 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  437  NSQGYGCVSDIGLATLMSPIPSPGTRATGYRAPEVTDTRKATHSSDVYSFGVLLLELLTG  496

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP++TT G++++ LVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEMLQI ++C  RM
Sbjct  497  KSPIYTTEGEQVVQLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEMLQIGMACAARM  556

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  188
            PDQRPKM EVV+M+EG+RR    ENR S     S  S  +I+
Sbjct  557  PDQRPKMDEVVRMMEGIRRT---ENRPSSTESRSEASTPTID  595



>ref|XP_010915719.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915720.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915721.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=640

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGC+SD+GL+++M+ + PPV+R AGYRAPEVVD RK    SDVYSFGVL+LELLTG
Sbjct  474  NNQQYGCISDLGLTSLMNPMVPPVSRTAGYRAPEVVDLRKTTQASDVYSFGVLMLELLTG  533

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+  T GDE++HLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++CVVRM
Sbjct  534  KSPIQITGGDEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMTCVVRM  593

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  221
            P+QRPKM EVV+MIE VRR D   NR S E 
Sbjct  594  PEQRPKMSEVVRMIEDVRRFDT-GNRPSSEG  623



>ref|XP_004502605.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Cicer arietinum]
Length=621

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 130/162 (80%), Gaps = 3/162 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  461  NSQGYGCVSDIGLATLMSPIPSPGTRATGYRAPEVTDTRKATHSSDVYSFGVLLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP++TT G++++ LVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEMLQI ++C  RM
Sbjct  521  KSPIYTTEGEQVVQLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEMLQIGMACAARM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  188
            PDQRPKM EVV+M+EG+RR    ENR S     S  S  +I+
Sbjct  581  PDQRPKMDEVVRMMEGIRRT---ENRPSSTESRSEASTPTID  619



>ref|XP_009137362.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=628

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++ GCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  464  NSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  523

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  524  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEMLQIAMSCVVKA  583

Query  313  PDQRPKMPEVVKMIEGV-RRNDHL--ENRRSCENGASRLS  203
            PDQRPKM ++V++IE V  R   L  E +   EN AS  S
Sbjct  584  PDQRPKMSDLVRLIESVGNRQASLGPEPKPKSENEASETS  623



>ref|XP_009409433.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409434.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409435.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            +++QYGCV+D+GL +I++ + PPV+R AGYRAPEVVDTRKA+  SDVYSFGVLLLELLTG
Sbjct  474  SNQQYGCVADLGLPSIINPMVPPVSRTAGYRAPEVVDTRKASQASDVYSFGVLLLELLTG  533

Query  493  KSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSP+    G DE+IHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++CV R
Sbjct  534  KSPIRVVGGGDEVIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMNCVSR  593

Query  316  MPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  224
            MP++RPKMPEVV+MIEGVRR D   NR S E
Sbjct  594  MPERRPKMPEVVRMIEGVRRFDS-GNRPSTE  623



>emb|CDY47625.1| BnaA01g13400D [Brassica napus]
Length=662

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++ GCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  498  NSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  557

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  558  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEMLQIAMSCVVKA  617

Query  313  PDQRPKMPEVVKMIEGV  263
            PDQRPKM ++V++IE V
Sbjct  618  PDQRPKMSDLVRLIESV  634



>ref|XP_010053173.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010053174.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW77437.1| hypothetical protein EUGRSUZ_D01777 [Eucalyptus grandis]
Length=634

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 130/155 (84%), Gaps = 7/155 (5%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++ YGC+SD+GL+ +MS LA P++RA GYRAPEV DTRKA  PSDVYSFGV+LLELLTG
Sbjct  462  NAEGYGCISDLGLATVMSGLAAPISRATGYRAPEVTDTRKATQPSDVYSFGVVLLELLTG  521

Query  493  KSPVHTTSG-------DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIA  335
            KSP+H T+        DEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA
Sbjct  522  KSPIHGTTSGSGGGGGDEIMHLVRWVHSVVREEWTAEVFDIELMRYPNIEEEMVEMLQIA  581

Query  334  LSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS  230
            +SCV R+PDQRPKMP++VK+IE VR + H +  +S
Sbjct  582  MSCVARLPDQRPKMPDLVKLIENVRSSSHTQENKS  616



>ref|XP_010448663.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
 ref|XP_010448664.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=641

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 139/166 (84%), Gaps = 5/166 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++ GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  476  NSERSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  535

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  536  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEMLQIAMSCVVKA  595

Query  313  PDQRPKMPEVVKMIE--GVRRNDHL--ENRRSCENGASRLS-PSSI  191
             DQRPKM ++V++IE  G RR   +  E++   EN AS  S PS I
Sbjct  596  ADQRPKMSDLVRLIENVGNRRTSSIEPESKPKSENEASEASTPSEI  641



>ref|XP_010433865.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
 ref|XP_010433866.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=639

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 139/166 (84%), Gaps = 5/166 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++ GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  474  NSERSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  533

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  534  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEMLQIAMSCVVKA  593

Query  313  PDQRPKMPEVVKMIE--GVRRNDHL--ENRRSCENGASRLS-PSSI  191
             DQRPKM ++V++IE  G RR   +  E++   EN AS  S PS I
Sbjct  594  ADQRPKMSDLVRLIENVGNRRTSSIEPESKPKSENEASEASTPSEI  639



>gb|KJB52632.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52633.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52634.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52638.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52639.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
Length=634

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++YGCVSD+GL+A+MS +  PV RAAGYRAPEV DTRKA   SDVYSFGV LLELLTG
Sbjct  460  NSERYGCVSDIGLAAVMSPMPLPVMRAAGYRAPEVTDTRKATQASDVYSFGVFLLELLTG  519

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQIA+SCV R+
Sbjct  520  KSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIAMSCVARV  579

Query  313  PDQRPKMPEVVKMIEGVRR---NDHLENRRSCENGASRLSPSSIEQECS  176
             +QRPKM  +VKM+E +RR    + L      E  AS   P ++ +  S
Sbjct  580  AEQRPKMAGLVKMVEEIRRVNNGNQLSFEAKSETSASTSIPHAVAETAS  628



>ref|NP_194105.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9SUQ3.1|Y4374_ARATH RecName: Full=Probable inactive receptor kinase At4g23740; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA23040.1| putative receptor kinase [Arabidopsis thaliana]
 emb|CAB81292.1| putative receptor kinase [Arabidopsis thaliana]
 dbj|BAC42978.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAP40406.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|ACN59347.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84800.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=638

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 137/167 (82%), Gaps = 6/167 (4%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  472  NSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  531

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  532  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKA  591

Query  313  PDQRPKMPEVVKMIE--GVRRND---HLENRRSCENGASRLS-PSSI  191
             DQRPKM ++V++IE  G RR       E +   ENGAS  S PS I
Sbjct  592  ADQRPKMSDLVRLIENVGNRRTSIEPEPELKPKSENGASETSTPSEI  638



>gb|KEH35437.1| receptor-like kinase [Medicago truncatula]
Length=347

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCVSD+GL  +MSS+    ARA GYRAPEV+DTRKA H SDVYSFGVLLLELLTG
Sbjct  191  NSQGYGCVSDIGLVTLMSSIPSQGARATGYRAPEVIDTRKATHSSDVYSFGVLLLELLTG  250

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K PV++T G++ +HLVRWV SVVREEWTAEVFD +LL+   IEEEMVEMLQI ++C  RM
Sbjct  251  KPPVYSTEGEQAVHLVRWVKSVVREEWTAEVFDTELLRYSSIEEEMVEMLQIGMACAARM  310

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  191
            PDQRPKM EVV+M+EG+R     ENR S     S++S  ++
Sbjct  311  PDQRPKMAEVVRMMEGIRH----ENRPSSTESGSQVSTPTV  347



>emb|CDP05105.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+ +++ +APPV R AGYRAPEV D+RK +  SDVYSFGVLLLELLTG
Sbjct  457  NSQQYGCVSDLGLATLITPIAPPVMRTAGYRAPEVTDSRKVSQASDVYSFGVLLLELLTG  516

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML+I ++CV RM
Sbjct  517  KSPIHATGGDEVIHLVRWVNSVVREEWTAEVFDVELLRFPNIEEEMVEMLRIGMTCVARM  576

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKM +V+KM+E +RR
Sbjct  577  PEQRPKMSDVLKMVEDMRR  595



>ref|XP_008234792.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008234793.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008234794.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV D+GL+ +MS + PP ARA GYR+PEV DTRK++H SDVYSFGVL+LELLTG
Sbjct  458  NSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTG  517

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT G+E+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI +SCV RM
Sbjct  518  KSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARM  577

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRP MP+VVK +E +R+
Sbjct  578  PEQRPSMPDVVKRVEEIRQ  596



>ref|XP_007220432.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 ref|XP_007220433.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 gb|EMJ21631.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 gb|EMJ21632.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
Length=629

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV D+GL+ +MS + PP ARA GYR+PEV DTRK++H SDVYSFGVL+LELLTG
Sbjct  458  NSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTG  517

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT G+E+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI +SCV RM
Sbjct  518  KSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARM  577

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRP MP+VVK +E +R+
Sbjct  578  PEQRPSMPDVVKRVEEIRQ  596



>ref|XP_010662595.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662596.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662597.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662598.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 128/150 (85%), Gaps = 1/150 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++YGCVSD+GL  +M+    P+ RAAGYRAPEV DTRKA+  SDVYSFGVLLLELLTG
Sbjct  455  NSRRYGCVSDLGLGTLMTPTPMPMTRAAGYRAPEVTDTRKASQASDVYSFGVLLLELLTG  514

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI ++CVV+M
Sbjct  515  KSPIHNTGGDEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMNCVVKM  574

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCE  224
            P+QRPKM EVVKM+E +++ +   NR S E
Sbjct  575  PEQRPKMAEVVKMMESIQQVN-TGNRPSSE  603



>gb|EPS60741.1| hypothetical protein M569_14060 [Genlisea aurea]
Length=589

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N K +GCVSD+GLS IM SL+P VARA+GYRAPEV DTR+A   SDVYSFGV+LLELLTG
Sbjct  435  NPKSFGCVSDLGLSTIMGSLSPSVARASGYRAPEVTDTRRATQASDVYSFGVVLLELLTG  494

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPV TT G+E++HLVRWVHSVVREEWTAEVFDV+LL++P +EEE+VEMLQIAL+CVVR 
Sbjct  495  KSPVVTTGGEEMVHLVRWVHSVVREEWTAEVFDVELLRVPGVEEELVEMLQIALACVVRA  554

Query  313  PDQRPKMPEVVKMIE  269
            P++RPKMPEVVKMIE
Sbjct  555  PEKRPKMPEVVKMIE  569



>gb|KHG27491.1| hypothetical protein F383_14041 [Gossypium arboreum]
Length=634

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++YGCVSD+GL+A+MS +  PV RAAGYRAPEV DTRKA   SDVYSFGV LLELLTG
Sbjct  460  NSERYGCVSDIGLAAVMSPMPLPVMRAAGYRAPEVTDTRKATQASDVYSFGVFLLELLTG  519

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQIA+SCV R+
Sbjct  520  KSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIAMSCVARV  579

Query  313  PDQRPKMPEVVKMIEGVRR---NDHLENRRSCENGASRLSPSSIEQECS  176
             +QRPKM  +VKM+E +RR    + L      E  AS   P ++ +  S
Sbjct  580  VEQRPKMAGLVKMVEEIRRVNNGNQLSFETKSEASASTSIPHAVAETTS  628



>ref|XP_002869766.1| hypothetical protein ARALYDRAFT_914223 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46025.1| hypothetical protein ARALYDRAFT_914223 [Arabidopsis lyrata subsp. 
lyrata]
Length=637

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 137/175 (78%), Gaps = 20/175 (11%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  469  NSENNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  528

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  529  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVKA  588

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRS-------------CENGASRLS-PSSI  191
             DQRPKM ++V++IE V       NRR+              ENGAS  S PS I
Sbjct  589  ADQRPKMSDLVRLIENV------GNRRTSIEPEPEPELKPKSENGASETSTPSEI  637



>emb|CDX94213.1| BnaC07g38470D [Brassica napus]
Length=615

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++ GCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  455  NSEREGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  514

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  515  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEMLQIAMSCVVKA  574

Query  313  PDQRPKMPEVVKMIEGV-RRNDHLENR  236
            PDQRPK+ ++V+++E V  R   LE +
Sbjct  575  PDQRPKISDLVRLMESVGNRRASLETK  601



>ref|XP_011076041.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076042.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076043.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076044.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=627

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ +GCVSD+GL+ +MS +APPV R AGYRAPE+ DTRK + PSDVYSFGVLLLELLTG
Sbjct  455  NSQLHGCVSDLGLATLMSPIAPPVMRTAGYRAPEITDTRKVSQPSDVYSFGVLLLELLTG  514

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPVH + G+E+IHLVRWVHSVVREEWT EVFDV+LL+ P+IEEEMV MLQI LSCV RM
Sbjct  515  KSPVHASGGEEVIHLVRWVHSVVREEWTGEVFDVELLRYPNIEEEMVAMLQIGLSCVARM  574

Query  313  PDQRPKMPEVVKMIEGVRRND  251
            P+QRPK+ EVVKM+E +R ++
Sbjct  575  PEQRPKIGEVVKMLEEIRSSN  595



>gb|KDO56147.1| hypothetical protein CISIN_1g007167mg [Citrus sinensis]
Length=615

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 135/170 (79%), Gaps = 5/170 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ + CVSD+GL+A+MS + PP  RAAGYRAPEV DTRKA   SDV+SFGVLLLELLTG
Sbjct  437  NSQGHVCVSDIGLAALMSPMPPPAMRAAGYRAPEVTDTRKATQASDVFSFGVLLLELLTG  496

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQ+ ++CVVRM
Sbjct  497  KSPIHATGGDEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQVGMACVVRM  556

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN----GASRLSPSSIEQECS  176
            P++RPKM +V+KM+E +RR    EN  S EN     +S  +P + E   S
Sbjct  557  PEERPKMADVLKMVEDIRR-VKAENPPSTENRSEISSSAATPKATETASS  605



>ref|XP_008793397.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008793471.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Phoenix dactylifera]
Length=637

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 2/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+++M+ + PPV+R AGYRAPEVVD RKA   SDVYSFGVL+LELLTG
Sbjct  470  NSQQYGCVSDLGLTSLMNPMIPPVSRTAGYRAPEVVDLRKATQASDVYSFGVLVLELLTG  529

Query  493  KSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSP+    G DE++HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++C  R
Sbjct  530  KSPIQIKGGGDEVVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMTCAAR  589

Query  316  MPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  224
            MPDQRP+M EVV+M+E VRR D   NR S E
Sbjct  590  MPDQRPRMTEVVRMLEDVRRFD-TGNRPSSE  619



>ref|XP_008793541.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Phoenix dactylifera]
Length=626

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 2/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+++M+ + PPV+R AGYRAPEVVD RKA   SDVYSFGVL+LELLTG
Sbjct  470  NSQQYGCVSDLGLTSLMNPMIPPVSRTAGYRAPEVVDLRKATQASDVYSFGVLVLELLTG  529

Query  493  KSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSP+    G DE++HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++C  R
Sbjct  530  KSPIQIKGGGDEVVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMTCAAR  589

Query  316  MPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  224
            MPDQRP+M EVV+M+E VRR D   NR S E
Sbjct  590  MPDQRPRMTEVVRMLEDVRRFD-TGNRPSSE  619



>emb|CBI22555.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   226 bits (576),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 128/150 (85%), Gaps = 1/150 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++YGCVSD+GL  +M+    P+ RAAGYRAPEV DTRKA+  SDVYSFGVLLLELLTG
Sbjct  455  NSRRYGCVSDLGLGTLMTPTPMPMTRAAGYRAPEVTDTRKASQASDVYSFGVLLLELLTG  514

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI ++CVV+M
Sbjct  515  KSPIHNTGGDEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMNCVVKM  574

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCE  224
            P+QRPKM EVVKM+E +++ +   NR S E
Sbjct  575  PEQRPKMAEVVKMMESIQQVN-TGNRPSSE  603



>ref|XP_006490586.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=619

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 135/170 (79%), Gaps = 5/170 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ + CVSD+GL+A+MS + PP  RAAGYRAPEV DTRKA   SDV+SFGVLLLELLTG
Sbjct  441  NSQGHVCVSDIGLAALMSPMPPPAMRAAGYRAPEVTDTRKATQASDVFSFGVLLLELLTG  500

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQ+ ++CVVRM
Sbjct  501  KSPIHATGGDEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQVGMACVVRM  560

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN----GASRLSPSSIEQECS  176
            P++RPKM +V+KM+E ++R    EN  S EN     +S  +P + E   S
Sbjct  561  PEERPKMADVLKMVEDIQR-VKAENPPSTENRSEISSSAATPKATETASS  609



>ref|XP_006283316.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
 gb|EOA16214.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
Length=598

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  434  NLEHSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  493

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  494  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEMLQIAMSCVVKS  553

Query  313  PDQRPKMPEVVKMIEGV---RRNDHLENRRSCENGASRLS-PSSI  191
             DQRPKM ++V++IE V   R +   E +   EN AS  S PS I
Sbjct  554  ADQRPKMSDLVRLIENVGNRRTSIDPEPKPKSENEASETSTPSEI  598



>ref|XP_010925785.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010925786.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=641

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 2/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSD+GL+++M+   PPV+R AGYRAPEVVD RKA   SDVYSFGVL+LELLTG
Sbjct  474  NNRQYGCVSDLGLTSLMNPTIPPVSRTAGYRAPEVVDLRKATQASDVYSFGVLMLELLTG  533

Query  493  KSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSP+    G DE+IHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEMLQIA++CV R
Sbjct  534  KSPIQIKGGGDEVIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEMLQIAMTCVAR  593

Query  316  MPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  224
            MP+QRP+M EVV+MIE VRR D   NR S E
Sbjct  594  MPEQRPRMTEVVRMIEDVRRFD-TGNRPSSE  623



>ref|XP_006350601.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350602.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006350603.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Solanum tuberosum]
Length=629

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ +GC+SD+GL+ IM  +A P+ RAAGY+ PEV D+RK +  +DVYSFGVL+LELLTG
Sbjct  461  NSQGFGCISDLGLATIMGPIATPIVRAAGYQPPEVTDSRKVSQTTDVYSFGVLILELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP H T   +I+HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI L+CV RM
Sbjct  521  KSPTHATGTSDIVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGLTCVSRM  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            P+QRPKM EVVKM+EGVRR +    R S E     L+P
Sbjct  581  PEQRPKMTEVVKMVEGVRRVN-TGTRTSTEASTPNLTP  617



>ref|XP_008794990.1| PREDICTED: probable inactive receptor kinase At4g23740 [Phoenix 
dactylifera]
 ref|XP_008794991.1| PREDICTED: probable inactive receptor kinase At4g23740 [Phoenix 
dactylifera]
Length=642

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSD+GL+++M+ + PPV+R AGYRAPEVVD RKA+  SDVYSFGVL+LELLTG
Sbjct  475  NNQQYGCVSDLGLASLMNPMIPPVSRTAGYRAPEVVDLRKASQASDVYSFGVLVLELLTG  534

Query  493  KSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSP+    G DE++HLVRWV SVVREEWTAEVFDV+L++ P+IEEE+VEMLQIA++CVVR
Sbjct  535  KSPIQIIGGGDEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEELVEMLQIAMTCVVR  594

Query  316  MPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  221
            MP+QRPKM EVV+MIE VRR D   NR S E 
Sbjct  595  MPEQRPKMSEVVRMIEDVRRFD-TGNRPSSEG  625



>ref|XP_006283317.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
 gb|EOA16215.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
Length=635

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  471  NLEHSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  530

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  531  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEMLQIAMSCVVKS  590

Query  313  PDQRPKMPEVVKMIEGV---RRNDHLENRRSCENGASRLS-PSSI  191
             DQRPKM ++V++IE V   R +   E +   EN AS  S PS I
Sbjct  591  ADQRPKMSDLVRLIENVGNRRTSIDPEPKPKSENEASETSTPSEI  635



>ref|XP_010059849.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010059857.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010059865.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW90565.1| hypothetical protein EUGRSUZ_A02671 [Eucalyptus grandis]
Length=665

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N K YGC+SD+GL+ I++ + P   RAAGYRAPEV+DTRK    SDVYSFGVLLLELLTG
Sbjct  461  NEKGYGCISDIGLATIINPIPPTSTRAAGYRAPEVIDTRKVFQASDVYSFGVLLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H+T+G+E IHLVRWV SVVREEWTAEVFDV+LL+ P+IEEEMVEML++ ++CVV+ 
Sbjct  521  KSPLHSTNGNESIHLVRWVQSVVREEWTAEVFDVQLLRYPNIEEEMVEMLKVGMACVVKR  580

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  221
            P+QRPKMPEVVK++E +RR     NR S EN
Sbjct  581  PEQRPKMPEVVKLLEDIRRGSS-ANRPSSEN  610



>gb|ACC91242.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
halleri]
Length=636

 Score =   223 bits (568),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 7/168 (4%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  469  NSENNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  528

Query  493  KSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSP+HTT+G DEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+
Sbjct  529  KSPIHTTAGRDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEMLQIAMSCVVK  588

Query  316  MPDQRPKMPEVVKMIE--GVRRND---HLENRRSCENGASRLS-PSSI  191
              DQRPKM ++V++IE  G RR       E +   ENGAS  S PS I
Sbjct  589  AADQRPKMSDLVRLIETVGNRRTSIEPEPELKPKSENGASESSTPSEI  636



>ref|XP_003522551.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=633

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  463  NSQGYGCISDIGLATLMSPIPMPAMRATGYRAPEVTDTRKATHASDVYSFGVLLLELLTG  522

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP++ T G++++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMV MLQI ++C  R+
Sbjct  523  KSPINNTEGEQVVHLVRWVNSVVREEWTAEVFDVQLLRYPNIEEEMVGMLQIGMACAARI  582

Query  313  PDQRPKMPEVVKMIEGVRR  257
            PDQRPKMP+VV+MIE +RR
Sbjct  583  PDQRPKMPDVVRMIEEIRR  601



>gb|KHN44239.1| Putative inactive receptor kinase [Glycine soja]
Length=633

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  463  NSQGYGCISDIGLATLMSPIPMPAMRATGYRAPEVTDTRKATHASDVYSFGVLLLELLTG  522

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP++ T G++++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMV MLQI ++C  R+
Sbjct  523  KSPINNTEGEQVVHLVRWVNSVVREEWTAEVFDVQLLRYPNIEEEMVVMLQIGMACAARI  582

Query  313  PDQRPKMPEVVKMIEGVRR  257
            PDQRPKMP+VV+MIE +RR
Sbjct  583  PDQRPKMPDVVRMIEEIRR  601



>gb|KHN09234.1| Putative inactive receptor kinase [Glycine soja]
Length=361

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 127/159 (80%), Gaps = 4/159 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSK YGC+SD+GL+A+M+    P  RA GYRAPE  DTRKA   SDVYSFGVLLLELLTG
Sbjct  194  NSKGYGCLSDIGLAALMN----PALRATGYRAPEATDTRKAIPASDVYSFGVLLLELLTG  249

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            +SP+H   GDE++HLVRWV+SVVREEWTAEVFDV LL+ P+IEEEMVEMLQI ++CVVR+
Sbjct  250  RSPLHAKGGDEVVHLVRWVNSVVREEWTAEVFDVDLLRYPNIEEEMVEMLQIGMACVVRV  309

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  197
            PDQRP++ EVV+M+E + R  + ENR   E+ +   +P+
Sbjct  310  PDQRPQIGEVVRMVEEIGRVINTENRSPTESRSEGSTPT  348



>ref|XP_006422104.1| hypothetical protein CICLE_v10004549mg [Citrus clementina]
 gb|ESR35344.1| hypothetical protein CICLE_v10004549mg [Citrus clementina]
Length=626

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ + CVSD+GL+A+MS + PP  RAAGYRAPEV DTRKA   SDV+SFGVLLLELLTG
Sbjct  441  NSQGHVCVSDIGLAALMSPMPPPAMRAAGYRAPEVTDTRKATQASDVFSFGVLLLELLTG  500

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQ+ ++CVVRM
Sbjct  501  KSPIHATGGDEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQVGMACVVRM  560

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P++RPKM +V+KM+E ++R
Sbjct  561  PEERPKMADVLKMVEDIQR  579



>gb|KHN23405.1| Putative inactive receptor kinase [Glycine soja]
Length=633

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  463  NSQGYGCISDIGLATLMSPIPMPAMRATGYRAPEVTDTRKATHASDVYSFGVLLLELLTG  522

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+++T G++++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMV MLQI ++C  R+
Sbjct  523  KSPINSTEGEQVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVVMLQIGMACAARI  582

Query  313  PDQRPKMPEVVKMIEGVRR  257
            PDQRPKMP+VV+MIE +RR
Sbjct  583  PDQRPKMPDVVRMIEEIRR  601



>ref|XP_008376682.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score =   221 bits (562),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV DVGL  +MS + PP  R  GYRAPEV DTRK+   SDVYSFGVL+LELLTG
Sbjct  458  NSQGYGCVCDVGLPTLMSPIPPPAVRTGGYRAPEVTDTRKSTPASDVYSFGVLILELLTG  517

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT G+E+IHLVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEMLQI +SCV RM
Sbjct  518  KSPIHTTDGEEVIHLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEMLQIGMSCVARM  577

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKM +VVK +E +R+
Sbjct  578  PEQRPKMQDVVKRVEEIRQ  596



>gb|AES72427.2| LRR receptor-like kinase [Medicago truncatula]
Length=616

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS  YGCVSD GL+ +MSS+  P  RA+GYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  457  NSHGYGCVSDTGLAVLMSSVPSPGTRASGYRAPEVTDTRKAVHSSDVYSFGVLLLELLTG  516

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+++  G++ IHLVRWV+SVVREEWTAEVFDV+LL+  +IEEEMVEMLQI ++C  RM
Sbjct  517  KSPIYSLEGEQNIHLVRWVNSVVREEWTAEVFDVELLRYSNIEEEMVEMLQIGMACAARM  576

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  191
            PDQRPKM EVV+M+EG+R     ENR S     S +S  ++
Sbjct  577  PDQRPKMSEVVRMVEGIRP----ENRPSSTESRSEVSTPTV  613



>emb|CDY10964.1| BnaA03g46230D [Brassica napus]
Length=145

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  625  MSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHTTSGDEIIHLV  446
            MS+LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTGKSP+HTT+GDEIIHLV
Sbjct  1    MSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLV  60

Query  445  RWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPKMPEVVKMIEG  266
            RWVHSVVREEWTAEVFDV+LL+  +IEEEMVEMLQIA+SCVV+ PDQRPKM ++V+++E 
Sbjct  61   RWVHSVVREEWTAEVFDVELLRYTNIEEEMVEMLQIAMSCVVKAPDQRPKMSDLVRLVES  120

Query  265  V-RRNDHLENR  236
            V  R   LE +
Sbjct  121  VGNRRASLETK  131



>ref|XP_003526687.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=633

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  463  NSQGYGCISDIGLATLMSPIPMPAMRATGYRAPEVTDTRKATHASDVYSFGVLLLELLTG  522

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+++T G++++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMV MLQI ++C  R+
Sbjct  523  KSPINSTEGEQVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVVMLQIGMACAARI  582

Query  313  PDQRPKMPEVVKMIEGVRR  257
            PDQRPKMP++V+MIE +RR
Sbjct  583  PDQRPKMPDLVRMIEEIRR  601



>gb|EYU25187.1| hypothetical protein MIMGU_mgv1a002923mg [Erythranthe guttata]
Length=625

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N + YGCVSD+GL+ +   ++PP+ R AGYRAPEV DTRK +  SDVYSFGV LLELLTG
Sbjct  458  NPQNYGCVSDLGLATLTCPVSPPLMRTAGYRAPEVTDTRKVSQASDVYSFGVFLLELLTG  517

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPV  T G+E+IHLVRWVHSVVREEWT EVFDV+LL+ P+IEEEMV MLQI LSCV RM
Sbjct  518  KSPVQATGGEEVIHLVRWVHSVVREEWTGEVFDVELLRYPNIEEEMVAMLQIGLSCVARM  577

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPK+ +VVKM+EG+R 
Sbjct  578  PEQRPKIGDVVKMVEGIRN  596



>ref|XP_009413825.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=632

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 129/154 (84%), Gaps = 5/154 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N + YGCVSD+GL ++++ + P ++R AGYRAPEVVDTRKA+ PSDVYSFGVL+LELLTG
Sbjct  457  NDQHYGCVSDLGLPSLINPMLPRLSRTAGYRAPEVVDTRKASQPSDVYSFGVLILELLTG  516

Query  493  KSPVHTTSG----DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSC  326
            KSP+  T G    DE++HLVRWVHSV+REEWTAEVFDV+LL+ P+IEEEMVEMLQIA++C
Sbjct  517  KSPIQITGGGGGGDEVVHLVRWVHSVLREEWTAEVFDVELLRYPNIEEEMVEMLQIAMNC  576

Query  325  VVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  224
            V R P++RPK+PEVV MIEGVRR D   NR S E
Sbjct  577  VARKPERRPKIPEVVGMIEGVRRFDS-GNRSSTE  609



>ref|XP_010097875.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB72472.1| putative inactive receptor kinase [Morus notabilis]
Length=640

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 129/157 (82%), Gaps = 1/157 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV+D GL  +M+S+ PPV RAAGYRAPEV DTRKA H +DVYSFGVLLLELLTG
Sbjct  464  NSQGYGCVADTGLVTLMNSMPPPVVRAAGYRAPEVTDTRKATHAADVYSFGVLLLELLTG  523

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPVH T  +E++HLVRWV++VVREEWTAEVFDV+LL+ P+IEEEMVEMLQ+ +SCV R+
Sbjct  524  KSPVHATGTEEVVHLVRWVNAVVREEWTAEVFDVQLLRYPNIEEEMVEMLQLGMSCVARI  583

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
            P++RPK+ +VVK +E VR+ +   NR S +   S +S
Sbjct  584  PEKRPKINDVVKSLEEVRQFNS-GNRPSSDVTKSEIS  619



>ref|XP_009399835.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399836.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSD+GL +I++ +AP V R  GYRAPEV DT+KA+  SDVYSFGV++LELLTG
Sbjct  466  NNQQYGCVSDLGLPSIINPMAPLVPRTVGYRAPEVTDTKKASQASDVYSFGVVMLELLTG  525

Query  493  KSPVHTT-SGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSPV    SGDE+IHLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++CV R
Sbjct  526  KSPVPIVGSGDEVIHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMNCVAR  585

Query  316  MPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  188
            +P++RPKM +VV+MIEGVRR D   NR S E  +   +P+ ++
Sbjct  586  VPERRPKMAQVVRMIEGVRRFDS-GNRPSTEARSEGSTPTPVQ  627



>ref|XP_009399834.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=666

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSD+GL +I++ +AP V R  GYRAPEV DT+KA+  SDVYSFGV++LELLTG
Sbjct  466  NNQQYGCVSDLGLPSIINPMAPLVPRTVGYRAPEVTDTKKASQASDVYSFGVVMLELLTG  525

Query  493  KSPVHTT-SGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSPV    SGDE+IHLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++CV R
Sbjct  526  KSPVPIVGSGDEVIHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMNCVAR  585

Query  316  MPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  188
            +P++RPKM +VV+MIEGVRR D   NR S E  +   +P+ ++
Sbjct  586  VPERRPKMAQVVRMIEGVRRFDS-GNRPSTEARSEGSTPTPVQ  627



>ref|XP_008380496.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008380504.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008362797.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008362798.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=624

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV DVGL  +M    PP AR  GYRAPEV DTRK++  SDVYSFGVLLLELLTG
Sbjct  453  NSQGYGCVCDVGLPTLMGPTPPPAARTGGYRAPEVKDTRKSSPASDVYSFGVLLLELLTG  512

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HT  G+E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI +SCV RM
Sbjct  513  KSPIHTIXGEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARM  572

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRP MP++VK +E +R+
Sbjct  573  PEQRPNMPDLVKRVEEIRQ  591



>ref|XP_009352112.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=623

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV D GL  +M  + PP AR  GYRAPEV DTRK++  SDVYSFGVLLLELLTG
Sbjct  453  NSQGYGCVCDAGLPTLMGPMPPPAARTGGYRAPEVKDTRKSSPASDVYSFGVLLLELLTG  512

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HT  G+E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI +SCV RM
Sbjct  513  KSPIHTIGGEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARM  572

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRP MP++VK +E +R+
Sbjct  573  PEQRPNMPDLVKRVEEIRQ  591



>ref|XP_003602176.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
Length=1088

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = -2

Query  673   NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
             NS+ YGCVSD+GL  +MSS+    ARA GYRAPEV+DTRKA H SDVYSFGVLLLELLTG
Sbjct  932   NSQGYGCVSDIGLVTLMSSIPSQGARATGYRAPEVIDTRKATHSSDVYSFGVLLLELLTG  991

Query  493   KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
             K PV++T G++ +HLVRWV SVVREEWTAEVFD +LL+   IEEEMVEMLQI ++C  RM
Sbjct  992   KPPVYSTEGEQAVHLVRWVKSVVREEWTAEVFDTELLRYSSIEEEMVEMLQIGMACAARM  1051

Query  313   PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  191
             PDQRPKM EVV+M+EG+R     ENR S     S++S  ++
Sbjct  1052  PDQRPKMAEVVRMMEGIRH----ENRPSSTESGSQVSTPTV  1088


 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS  YGCVSD GL+ +MSS+  P  RA+GYRAPEV DTRKA H SDVYSFGVLLLELLTG
Sbjct  492  NSHGYGCVSDTGLAVLMSSVPSPGTRASGYRAPEVTDTRKAVHSSDVYSFGVLLLELLTG  551

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+++  G++ IHLVRWV+SVVREEWTAEVFDV+LL+  +IEEEMVEMLQI ++C  RM
Sbjct  552  KSPIYSLEGEQNIHLVRWVNSVVREEWTAEVFDVELLRYSNIEEEMVEMLQIGMACAARM  611

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  191
            PDQRPKM EVV+M+EG+R     ENR S     S +S  ++
Sbjct  612  PDQRPKMSEVVRMVEGIRP----ENRPSSTESRSEVSTPTV  648



>ref|XP_009375580.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009375581.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=624

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV D GL  +M  + PP AR  GYRAPEV DTRK++  SDVYSFGVLLLELLTG
Sbjct  453  NSQGYGCVCDAGLPTLMGPMPPPAARTGGYRAPEVKDTRKSSPASDVYSFGVLLLELLTG  512

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HT  G+E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI +SCV RM
Sbjct  513  KSPIHTIGGEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARM  572

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRP MP++VK +E +R+
Sbjct  573  PEQRPNMPDLVKRVEEIRQ  591



>ref|XP_004308019.1| PREDICTED: probable inactive receptor kinase At4g23740 [Fragaria 
vesca subsp. vesca]
Length=699

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +  GCVSDVGL  +MS + PP  R  GYRAPEV DTRK+   SDVYSFGVLLLELLTG
Sbjct  460  NPQGSGCVSDVGLPTLMSPMPPPAVRNGGYRAPEVTDTRKSTPASDVYSFGVLLLELLTG  519

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT G+E+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI +SCV RM
Sbjct  520  KSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARM  579

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKM +VVK +E +R+
Sbjct  580  PEQRPKMMDVVKKVEEIRQ  598



>gb|KHN08297.1| Putative inactive receptor kinase [Glycine soja]
Length=610

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SD+GL+ +M+    P  RA GYRAPE  DTRK    SDVYSFGVLLLELLTG
Sbjct  443  NSQGYGCLSDIGLATLMN----PALRATGYRAPEATDTRKTLPASDVYSFGVLLLELLTG  498

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            +SP+H   GDE++HLVRWV+SVVREEWTAEVFDV L + P+IEEEMVEMLQI ++CVVR 
Sbjct  499  RSPLHAKGGDEVVHLVRWVNSVVREEWTAEVFDVDLQRYPNIEEEMVEMLQIGMACVVRT  558

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPK+ EVV+M+E +RR  + ENR S E+ +   +P
Sbjct  559  PDQRPKIGEVVRMVEEIRRLINTENRSSTESRSEGSTP  596



>ref|XP_010445167.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=739

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++ GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTG
Sbjct  474  NSERSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTG  533

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEMLQIA+SCVV+ 
Sbjct  534  KSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEMLQIAMSCVVKA  593

Query  313  PDQRPKM  293
             DQRPK+
Sbjct  594  ADQRPKI  600


 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = -2

Query  592  AGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEW  413
            AGYRAPEV DTRK++  SDVYSFGV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEW
Sbjct  602  AGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEW  661

Query  412  TAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPKMPEVVKMIEGV---RRNDHLE  242
            TAEVFD++LL+  +IEEEMVEMLQIA+SCVV+  DQRPKM ++V++IE V   R +   E
Sbjct  662  TAEVFDIELLRYANIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSIEPE  721

Query  241  NRRSCENGASRLS-PSSI  191
            ++   EN AS  S PS I
Sbjct  722  SKPKSENEASEGSTPSEI  739



>ref|XP_007137558.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 ref|XP_007137559.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 ref|XP_007137560.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09552.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09553.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09554.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
Length=626

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N + YGC+SD+GL+ +MS +  P  R  GYRAPE+ DTRKA   SDVYSFGVLLLELLTG
Sbjct  456  NVQGYGCISDIGLATLMSPVPVPAMRTTGYRAPEITDTRKATQASDVYSFGVLLLELLTG  515

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+++T G++++HLVRWV+SVVREEWTAEVFDV+LL+  +IEEEMV MLQI ++C VR+
Sbjct  516  KSPINSTEGEQVVHLVRWVNSVVREEWTAEVFDVELLRYANIEEEMVGMLQIGMACAVRI  575

Query  313  PDQRPKMPEVVKMIEGVRR  257
            PDQRPKMP+VVKM+E +RR
Sbjct  576  PDQRPKMPDVVKMVEEIRR  594



>ref|XP_011084477.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740 [Sesamum indicum]
Length=631

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSKQYGCVSD+GL+ +M+ +AP + R  GYRAPEV DTRK +  SD+YSFGV++LELLTG
Sbjct  459  NSKQYGCVSDLGLATLMNPIAPRLTRTPGYRAPEVTDTRKPSQASDIYSFGVVILELLTG  518

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPVH +  +E+IHLVRWV SVVREEWT EVFDV+LL+ P+IEEEMV MLQI +SCV RM
Sbjct  519  KSPVHASGREEVIHLVRWVQSVVREEWTGEVFDVELLRYPNIEEEMVAMLQIGMSCVARM  578

Query  313  PDQRPKMPEVVKMIEGVR  260
            P QRPK+ +VVKM+E +R
Sbjct  579  PGQRPKIGDVVKMLEEIR  596



>ref|XP_006596280.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006596281.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
Length=623

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 4/158 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SD+GL+ +M+    P  RA GYRAPE  DTRK    SDVYSFGVLLLELLTG
Sbjct  456  NSQGYGCLSDIGLATLMN----PALRATGYRAPEATDTRKTLPASDVYSFGVLLLELLTG  511

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            +SP+H   GDE++ LVRWV+SVVREEWTAEVFDV L + P+IEEEMVEMLQI ++CVVR 
Sbjct  512  RSPLHAKGGDEVVQLVRWVNSVVREEWTAEVFDVDLQRYPNIEEEMVEMLQIGMACVVRT  571

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPK+ EVV+M+E +RR  + ENR S E+ +   +P
Sbjct  572  PDQRPKIGEVVRMVEEIRRLINTENRSSTESRSEGSTP  609



>ref|XP_010035197.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW46492.1| hypothetical protein EUGRSUZ_K00318 [Eucalyptus grandis]
Length=633

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ +GCVSDV L+ +M+ +  P+ R +GYRAPE+ D+RK    SDVY FGVLLLELLTG
Sbjct  461  NSEGFGCVSDVALAPLMNQIPLPLMRISGYRAPEITDSRKPTQASDVYGFGVLLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H TSGDE++HLVRWV SVVREEWTAEVFD+ LL+ P+IEEEMVEMLQI ++CV RM
Sbjct  521  KSPMHATSGDEMVHLVRWVSSVVREEWTAEVFDMVLLRFPNIEEEMVEMLQIGMACVARM  580

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRP+MP+V++ +E +RR
Sbjct  581  PEQRPRMPDVLRKVEEIRR  599



>ref|XP_007141021.1| hypothetical protein PHAVU_008G160700g [Phaseolus vulgaris]
 ref|XP_007141022.1| hypothetical protein PHAVU_008G160700g [Phaseolus vulgaris]
 gb|ESW13015.1| hypothetical protein PHAVU_008G160700g [Phaseolus vulgaris]
 gb|ESW13016.1| hypothetical protein PHAVU_008G160700g [Phaseolus vulgaris]
Length=623

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 128/164 (78%), Gaps = 7/164 (4%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N + YGC+SD+GL+ +M+    P  R  GYRAPE  DTRK+   SDVYSFGVLLLELLTG
Sbjct  457  NPRGYGCLSDIGLATLMN----PAMRTTGYRAPEATDTRKSVPASDVYSFGVLLLELLTG  512

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            + P+H   G+E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI ++CVVR 
Sbjct  513  RFPLHAKGGEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMACVVRT  572

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGA--SRLSPSSIE  188
            PDQRPK+ EVV+M+E +R+ +  ENR S E+ +  S  +P SIE
Sbjct  573  PDQRPKIGEVVRMVEEIRKVN-TENRSSTESRSEGSTPTPHSIE  615



>ref|XP_004145918.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 ref|XP_004160365.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
Length=622

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 3/142 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS  YGCV+D G++A+M+ +APP  R+AGYRAPE+ D+RKA+  SD YSFGV+LLELLTG
Sbjct  440  NSHGYGCVTDAGVAALMNLMAPPATRSAGYRAPELKDSRKASQASDTYSFGVVLLELLTG  499

Query  493  KSPVHT---TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCV  323
            K P+HT     GD+IIHLVRWV++VVREEWTAEVFDV+LL+ P+IEEEM+E LQIALSCV
Sbjct  500  KFPLHTKGGNGGDQIIHLVRWVNAVVREEWTAEVFDVELLRYPNIEEEMLETLQIALSCV  559

Query  322  VRMPDQRPKMPEVVKMIEGVRR  257
             R+PD RP M +V   +EGVRR
Sbjct  560  GRVPDDRPAMADVAARLEGVRR  581



>gb|KGN49888.1| hypothetical protein Csa_5G139660 [Cucumis sativus]
Length=649

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 3/142 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS  YGCV+D G++A+M+ +APP  R+AGYRAPE+ D+RKA+  SD YSFGV+LLELLTG
Sbjct  467  NSHGYGCVTDAGVAALMNLMAPPATRSAGYRAPELKDSRKASQASDTYSFGVVLLELLTG  526

Query  493  KSPVHT---TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCV  323
            K P+HT     GD+IIHLVRWV++VVREEWTAEVFDV+LL+ P+IEEEM+E LQIALSCV
Sbjct  527  KFPLHTKGGNGGDQIIHLVRWVNAVVREEWTAEVFDVELLRYPNIEEEMLETLQIALSCV  586

Query  322  VRMPDQRPKMPEVVKMIEGVRR  257
             R+PD RP M +V   +EGVRR
Sbjct  587  GRVPDDRPAMADVAARLEGVRR  608



>ref|XP_008437572.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=650

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 3/142 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS  YGCVSD G++A+M+ + PP  R+AGYRAPE+ D+RKA+  SD YSFGV+LLELLTG
Sbjct  467  NSHGYGCVSDAGVAALMNLMTPPATRSAGYRAPELKDSRKASQASDTYSFGVVLLELLTG  526

Query  493  KSPVHT---TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCV  323
            K P+HT     GD+IIHLVRWV++VVREEWTAEVFDV+LL+ P+IEEEM+E LQIALSCV
Sbjct  527  KFPLHTKGGNGGDQIIHLVRWVNAVVREEWTAEVFDVELLRYPNIEEEMLETLQIALSCV  586

Query  322  VRMPDQRPKMPEVVKMIEGVRR  257
             R+PD RP M +V   +EGVRR
Sbjct  587  GRVPDDRPAMADVAARLEGVRR  608



>ref|XP_009357339.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=627

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV DVGL  +MS + PP  R  GYRAPEV DTRK+   SD+YSFGVL+LELLTG
Sbjct  456  NSQGYGCVCDVGLPPLMSPMPPPAVRTGGYRAPEVTDTRKSTPASDIYSFGVLILELLTG  515

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HT+ G+E++HLVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEMLQI +SCV RM
Sbjct  516  KSPIHTSGGEEVVHLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEMLQIGMSCVARM  575

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKM +VVK +E +R+
Sbjct  576  PEQRPKMQDVVKRVEEIRQ  594



>ref|XP_009368693.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009368694.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=630

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGCV DVGL  +MS + PP  R  GYRAPEV DTRK+   SD+YSFGVL+LELLTG
Sbjct  459  NSQGYGCVCDVGLPPLMSPMPPPAVRTGGYRAPEVTDTRKSTPASDIYSFGVLILELLTG  518

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+HT+ G+E++HLVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEMLQI +SCV RM
Sbjct  519  KSPIHTSGGEEVVHLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEMLQIGMSCVARM  578

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKM +VVK +E +R+
Sbjct  579  PEQRPKMQDVVKRVEEIRQ  597



>ref|XP_004149452.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 ref|XP_004164694.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN57874.1| hypothetical protein Csa_3G358620 [Cucumis sativus]
Length=630

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSK YGCVSDVGL+ +M+S+  P  R  GYRAPE+ DTR+A+  +DVYSFGV+LLELLTG
Sbjct  461  NSKGYGCVSDVGLAGLMNSIPLPATRTPGYRAPELTDTRRASEAADVYSFGVVLLELLTG  520

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H    +E+++LVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI LSCV +M
Sbjct  521  KSPIHVEGCNEVVNLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGLSCVAKM  580

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKM +++  IE VR+
Sbjct  581  PEQRPKMIDLMLRIEQVRQ  599



>ref|NP_001042446.1| Os01g0223600 [Oryza sativa Japonica Group]
 dbj|BAF04360.1| Os01g0223600, partial [Oryza sativa Japonica Group]
Length=492

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSD+GL+++M+ +    +R+ GY APEV D+RKA+  SDVYSFGV +LELLTG
Sbjct  325  NNQQYGCVSDLGLASLMNPITAR-SRSLGYCAPEVTDSRKASQCSDVYSFGVFILELLTG  383

Query  493  KSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            +SPV  T  G+E++HLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++CV R
Sbjct  384  RSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMACVSR  443

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
             P++RPKM +VV+M+E VRR D
Sbjct  444  TPERRPKMSDVVRMLEDVRRTD  465



>ref|XP_004498388.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cicer 
arietinum]
Length=627

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 122/159 (77%), Gaps = 3/159 (2%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+ YGC+SD+GL+ + S + PP  R  GY APEV D RKA   SDVYSFGVLLLELLTG
Sbjct  459  NSQGYGCISDIGLTTMTSPITPPTLRTTGYLAPEVTDARKATPASDVYSFGVLLLELLTG  518

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+     +E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI ++CVV +
Sbjct  519  KSPL--LGSEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMACVVMI  576

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  197
             DQRP M EVVKM+EG+ R +   NR S E+ +   +P+
Sbjct  577  QDQRPNMDEVVKMVEGISRVNS-GNRPSTESRSENSTPT  614



>ref|XP_008439323.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008439324.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=631

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSK YGCVSDVGL+ +M+S+  P  R  GYRAPE+ DTR+ +  +DVYSFGV+LLELLTG
Sbjct  462  NSKGYGCVSDVGLAGLMNSIPLPATRTPGYRAPELTDTRRVSEAADVYSFGVVLLELLTG  521

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H    +E+++LVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEMLQI LSCV +M
Sbjct  522  KSPIHVEGCNEVVNLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGLSCVAKM  581

Query  313  PDQRPKMPEVVKMIEGVRR  257
            P+QRPKM ++   IE VR+
Sbjct  582  PEQRPKMIDLTSRIEQVRQ  600



>ref|XP_006645650.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Oryza 
brachyantha]
Length=655

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGCVSD+GL+++M+ +    +R+ GY APEV D+RKA+  SDVYSFGV +LELLTG
Sbjct  488  NSQQYGCVSDLGLASLMNPITA-RSRSLGYCAPEVTDSRKASQCSDVYSFGVFVLELLTG  546

Query  493  KSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            +SPV  T  G+E++HLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++CV R
Sbjct  547  RSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMTCVSR  606

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
             P++RPKMP+VV+MIE VRR D
Sbjct  607  TPERRPKMPDVVRMIEEVRRID  628



>gb|KHN24722.1| Putative inactive receptor kinase, partial [Glycine soja]
Length=327

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 122/157 (78%), Gaps = 2/157 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK +H SDVYSFGVLLLE+LTG
Sbjct  168  NQDNDGCISDFGLAPLMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTG  226

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  227  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  286

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
            PD RP M E V+MIE +R++D  ENR S E   S+ S
Sbjct  287  PDMRPSMDEAVRMIEEIRQSDS-ENRPSSEENKSKDS  322



>gb|EYU36892.1| hypothetical protein MIMGU_mgv1a0177021mg, partial [Erythranthe 
guttata]
Length=208

 Score =   188 bits (478),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GCVSD GL+ +M+  A   +R+AGYRAPEVV+TRK  H SDVYSFGV+LLE+LTG
Sbjct  49   NQDLEGCVSDFGLAPLMNHPAT-TSRSAGYRAPEVVETRKHTHKSDVYSFGVILLEMLTG  107

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K P  + + D+II L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV + 
Sbjct  108  KQPTSSPARDDIIDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVAKA  167

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
            PD RP M EVV+MIE VR++D  ENR S +   S+ S
Sbjct  168  PDMRPNMDEVVRMIEEVRQSDS-ENRPSSDENKSKDS  203



>emb|CBI34446.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   192 bits (488),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 116/158 (73%), Gaps = 24/158 (15%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++ YGCVSD+GL+ +MS LAPP++RAA                       V+LLELLTG
Sbjct  190  NARGYGCVSDLGLTTVMSPLAPPISRAA-----------------------VVLLELLTG  226

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T GDE+IHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA+ CV+RM
Sbjct  227  KSPIHATGGDEVIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMGCVIRM  286

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            PDQRPKMP+VV++IE VR  D  +NR S E  +   +P
Sbjct  287  PDQRPKMPDVVRLIENVRHTD-TDNRSSFETRSEGSTP  323



>gb|KEH40435.1| LRR receptor-like kinase [Medicago truncatula]
Length=584

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 128/159 (81%), Gaps = 5/159 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NSK YGC+SD+GL+ +++S   P  RAAGY APEV +TRK+   SDVYSFGVLLLELLTG
Sbjct  424  NSKGYGCISDIGLATMITSPISP--RAAGYLAPEVTETRKSTPASDVYSFGVLLLELLTG  481

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H   G+E++HLVRWV+SVVREEWT+EVFD+ LL+ P+IEEEMVEMLQI ++CVVR+
Sbjct  482  KSPLH--GGEEVVHLVRWVNSVVREEWTSEVFDLVLLRYPNIEEEMVEMLQIGMACVVRL  539

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  197
             D+RPKM EVV+++E +R+ +   NR S E+ +   +P+
Sbjct  540  HDERPKMDEVVRLVEEIRKVNS-GNRTSTESRSECSTPT  577



>dbj|BAA94519.1| putative receptor-like kinase [Oryza sativa Japonica Group]
 dbj|BAB07903.1| putative receptor-like kinase [Oryza sativa Japonica Group]
 gb|EEC70208.1| hypothetical protein OsI_00955 [Oryza sativa Indica Group]
Length=641

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N++QYGCVSD+GL+++M+ +    +R+ GY APEV D+RKA+  SDVYSFGV +LELLTG
Sbjct  474  NNQQYGCVSDLGLASLMNPITAR-SRSLGYCAPEVTDSRKASQCSDVYSFGVFILELLTG  532

Query  493  KSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            +SPV  T  G+E++HLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEMLQIA++CV R
Sbjct  533  RSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMACVSR  592

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
             P++RPKM +VV+M+E VRR D
Sbjct  593  TPERRPKMSDVVRMLEDVRRTD  614



>gb|EMT08914.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=448

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 117/142 (82%), Gaps = 2/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGC+SD+GL+ +M+ +    +R+ GY APE+ DTRK+   SDVYSFGV +LELLTG
Sbjct  281  NSQQYGCISDLGLAPLMNPITAR-SRSLGYCAPEITDTRKSTQCSDVYSFGVFVLELLTG  339

Query  493  KSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSPV  T G +E++HLVRWV SVVREEWTAEVFD +L++ P+IEEEMVEMLQIA++CV R
Sbjct  340  KSPVQVTGGGNEVVHLVRWVQSVVREEWTAEVFDGELMRYPNIEEEMVEMLQIAMACVSR  399

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
             P++RPKM ++VKMIE V RND
Sbjct  400  NPERRPKMLDMVKMIEEVGRND  421



>gb|EPS62971.1| hypothetical protein M569_11816, partial [Genlisea aurea]
Length=566

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 115/137 (84%), Gaps = 2/137 (1%)
 Frame = -2

Query  664  QYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSP  485
            + GC+SD+GL+ +M SL+P  AR+AG+RAPE+ DTR+A  PSDVYSFGV+LLELLT KSP
Sbjct  430  KLGCISDIGLATVMPSLSPSAARSAGHRAPEIADTRRATQPSDVYSFGVILLELLTAKSP  489

Query  484  V-HTTSGD-EIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMP  311
            V H   GD E++HLVRWVH+VV+EEWTAEVFDV+LL + ++EEE+VE LQIAL+CV   P
Sbjct  490  VVHAAGGDDEVVHLVRWVHAVVQEEWTAEVFDVELLGMGNVEEELVETLQIALACVATAP  549

Query  310  DQRPKMPEVVKMIEGVR  260
            +QRPKM EVV+MIE VR
Sbjct  550  EQRPKMAEVVRMIEDVR  566



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 123/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+++M+  A P +RAAGYRAPEV++TRK +H SDVYSFGVLLLE+LTG
Sbjct  491  NQDNDGCISDFGLASLMNVPANP-SRAAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTG  549

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  550  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  609

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVVKMIE +R++D  ENR S E   S+
Sbjct  610  PDMRPNMDEVVKMIEEIRQSDS-ENRPSSEENKSK  643



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 123/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+++M+  A P +RAAGYRAPEV++TRK +H SDVYSFGVLLLE+LTG
Sbjct  501  NQDNDGCISDFGLASLMNVPANP-SRAAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTG  559

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  560  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  619

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVVKMIE +R++D  ENR S E   S+
Sbjct  620  PDMRPNMDEVVKMIEEIRQSDS-ENRPSSEENKSK  653



>gb|KHN40997.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK  H SDVYSFG+LLLE+LTG
Sbjct  93   NHDNDGCISDFGLTPLMNVPATP-SRAAGYRAPEVIETRKHTHKSDVYSFGILLLEMLTG  151

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  152  KAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKV  211

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  212  PDMRPSMDEVVRMIEEIRLSDS-ENRPSSEENRSK  245



>gb|KHN30614.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  + P +RAAGYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  93   NQDNDGCISDFGLTPLMNVPSTP-SRAAGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  151

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  152  KAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKV  211

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  212  PDMRPSMEEVVRMIEEIRLSDS-ENRPSSEENRSK  245



>emb|CDP04037.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GCVSD+GL+ +M+      +R AGYRAPEV++TRK  H SDVYSFGVLLLE+LTGK P+ 
Sbjct  98   GCVSDLGLAPLMN-FPATRSRQAGYRAPEVMETRKHTHKSDVYSFGVLLLEMLTGKQPIQ  156

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  157  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVAKVPDMRP  216

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
             M EVV+MIE VR++D  ENR S E   S+ S
Sbjct  217  NMDEVVRMIEEVRQSDS-ENRPSSEENKSKDS  247



>ref|XP_004500388.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=647

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+A+M+  A P +RAAGYRAPEV++TRK +H SDVYSFGVLLLE+LTG
Sbjct  488  NQDNDGCISDFGLAALMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTG  546

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  547  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  606

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  607  PDMRPSMDEVVRMIEEIRLSDS-ENRPSSEENKSK  640



>ref|XP_003565740.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brachypodium 
distachyon]
Length=637

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGC+SD+GL+++M+ +    +R+ GY APE+ DTRK+   SDVYSFGV +LELLTG
Sbjct  470  NSQQYGCISDLGLASLMNPITA-RSRSLGYCAPEITDTRKSTQCSDVYSFGVFILELLTG  528

Query  493  KSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSPV  T  G+E++HLVRWV SVVREEWTAEVFD +L++ P+IEEEMVEMLQIA++CV R
Sbjct  529  KSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDGELMRYPNIEEEMVEMLQIAMACVSR  588

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
             P++RPKM ++V+M+E V RND
Sbjct  589  TPERRPKMSDMVRMLEEVGRND  610



>ref|XP_007146903.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
 gb|ESW18897.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
Length=657

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 123/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+++M+  A P +RAAGYRAPEVV+TRK +H SDVYSFGVLLLE+LTG
Sbjct  498  NQDNDGCISDFGLASLMNVPATP-SRAAGYRAPEVVETRKHSHKSDVYSFGVLLLEMLTG  556

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  557  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  616

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV++IE +R++D  ENR S E   S+
Sbjct  617  PDMRPSMDEVVRLIEEIRQSDS-ENRPSSEENKSK  650



>ref|XP_002454913.1| hypothetical protein SORBIDRAFT_03g001310 [Sorghum bicolor]
 gb|EES00033.1| hypothetical protein SORBIDRAFT_03g001310 [Sorghum bicolor]
Length=560

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N  +YGC+SD+GL+ +M+ +    +R+ GY APEV DTRKA+  SDVYSFGV +LELLTG
Sbjct  389  NKHEYGCISDLGLALLMNPITAR-SRSLGYCAPEVADTRKASQSSDVYSFGVFILELLTG  447

Query  493  KSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSPV  T  G+E++HLVRWV SVVREEWTAEVFD +LL+ P+IEEEMVEMLQIA++CV R
Sbjct  448  KSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEEMVEMLQIAMACVSR  507

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
             P++RPKM +VV+ IE VRR+D
Sbjct  508  TPERRPKMADVVRTIEEVRRSD  529



>dbj|BAJ94608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 117/142 (82%), Gaps = 2/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS+QYGC++D+GL+ +M+ +    +R+ GY APEV DTRK+   SDVYSFGV +LELLTG
Sbjct  470  NSQQYGCIADLGLAPLMNPITAR-SRSLGYCAPEVTDTRKSTQSSDVYSFGVFVLELLTG  528

Query  493  KSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSPV  T G +E++HLVRWV SVVREEWTAEVFD +L++ P+IEEEMVEMLQIA++CV R
Sbjct  529  KSPVQVTGGGNEVVHLVRWVQSVVREEWTAEVFDGELMRYPNIEEEMVEMLQIAMACVSR  588

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
             P++RPKM ++VKMIE V RND
Sbjct  589  NPERRPKMVDMVKMIEEVGRND  610



>emb|CDP13882.1| unnamed protein product [Coffea canephora]
Length=639

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +Q GC++D GL+ +M+SL     R  GY APEV++TRKA   SDVYSFGVLLLE+LTG
Sbjct  480  NKEQDGCITDFGLNPVMNSLGVKT-RGIGYHAPEVIETRKATQKSDVYSFGVLLLEMLTG  538

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H++  D++I L RWV SVVREEWTAEVFDV+L+K  ++EEEMV+MLQIALSCV + 
Sbjct  539  KSPIHSSGHDDVIDLPRWVRSVVREEWTAEVFDVELMKYQNVEEEMVQMLQIALSCVAKA  598

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
            PD RP M EVV+++E +R+++ LENR S E+  S+ S
Sbjct  599  PDMRPSMDEVVRLMEDIRQSE-LENRPSSEDNRSKGS  634



>ref|XP_003537367.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006591268.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=671

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK +H SDVYSFGVLLLE+LTG
Sbjct  512  NQDNDGCISDFGLAPLMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTG  570

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  571  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  630

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M E V+MIE +R++D  ENR S E   S+
Sbjct  631  PDMRPSMDEAVRMIEEIRQSDS-ENRPSSEENKSK  664



>ref|XP_006591269.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=670

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK +H SDVYSFGVLLLE+LTG
Sbjct  511  NQDNDGCISDFGLAPLMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTG  569

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  570  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  629

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M E V+MIE +R++D  ENR S E   S+
Sbjct  630  PDMRPSMDEAVRMIEEIRQSDS-ENRPSSEENKSK  663



>ref|XP_002533837.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF28551.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=635

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  476  NQDHDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  534

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ + S D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++
Sbjct  535  KAPLQSPSRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMACVAKV  594

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  595  PDMRPNMDEVVRMIEEIRQSDS-ENRPSSEENKSK  628



>gb|KHN18649.1| Putative inactive receptor kinase [Glycine soja]
Length=585

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSFGVLLLE+LTG
Sbjct  429  NQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSFGVLLLEMLTG  487

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  488  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  547

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  548  PDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  581



>ref|XP_004294716.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=630

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M+   P  +R+AGYRAPEV++TRK +H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  478  GCISDVGLTPLMN--VPATSRSAGYRAPEVIETRKHSHKSDVYSFGVVLLEMLTGKAPLQ  535

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  536  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKVPDMRP  595

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASRL  206
             M EVV+MIE +R++D  ENR S E+  S +
Sbjct  596  NMEEVVRMIEDIRQSDS-ENRPSSEDNKSNV  625



>gb|KJB52637.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
Length=620

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 118/169 (70%), Gaps = 17/169 (10%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            NS++YGCVSD+GL+A+MS +  PV RAAGYRAPEV DTRKA   SDVYSFGV LLELLTG
Sbjct  460  NSERYGCVSDIGLAAVMSPMPLPVMRAAGYRAPEVTDTRKATQASDVYSFGVFLLELLTG  519

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+H T G+EI              WTAEVFDV+LL+ P+IEEEMVEMLQIA+SCV R+
Sbjct  520  KSPIHATGGEEI--------------WTAEVFDVELLRYPNIEEEMVEMLQIAMSCVARV  565

Query  313  PDQRPKMPEVVKMIEGVRR---NDHLENRRSCENGASRLSPSSIEQECS  176
             +QRPKM  +VKM+E +RR    + L      E  AS   P ++ +  S
Sbjct  566  AEQRPKMAGLVKMVEEIRRVNNGNQLSFEAKSETSASTSIPHAVAETAS  614



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSFGVLLLE+LTGK+P+ 
Sbjct  481  GCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQ  539

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  540  SPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIGMACVAKVPDMRP  599

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE VR++D  ENR S E   S+
Sbjct  600  NMDEVVRMIEEVRQSDS-ENRPSSEENKSK  628



>ref|XP_006602052.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score =   191 bits (484),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSFGVLLLE+LTG
Sbjct  484  NQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSFGVLLLEMLTG  542

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  543  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  602

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  603  PDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  636



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSFGVLLLE+LTGK+P+ 
Sbjct  481  GCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQ  539

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  540  SPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIGMACVAKVPDMRP  599

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE VR++D  ENR S E   S+
Sbjct  600  NMDEVVRMIEEVRQSDS-ENRPSSEENKSK  628



>ref|XP_003553192.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006602051.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
Length=654

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSFGVLLLE+LTG
Sbjct  498  NQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSFGVLLLEMLTG  556

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  557  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  616

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  617  PDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  650



>ref|XP_006602049.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=668

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSFGVLLLE+LTG
Sbjct  512  NQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSFGVLLLEMLTG  570

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  571  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  630

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  631  PDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  664



>ref|XP_011084790.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084791.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084792.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084793.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084794.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084795.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084796.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084797.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084800.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=635

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N+   GCVSD GLS +M+ + P   R AGYRAPEV++TRK +  +DVYSFGV+LLE+LTG
Sbjct  476  NASLDGCVSDFGLSPMMNYI-PIKYRVAGYRAPEVIETRKVSQKADVYSFGVVLLEMLTG  534

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSP+  T  D+++ L RWV SVVREEWTAEVFDV+L+K  +IEEEMV+MLQIAL+CV ++
Sbjct  535  KSPIQYTGYDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEEEMVQMLQIALACVAKV  594

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R+++ LENR S E+  S+
Sbjct  595  PDMRPSMDEVVRMIEDIRQSE-LENRPSSEDNRSK  628



>ref|XP_006602050.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=667

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSFGVLLLE+LTG
Sbjct  511  NQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSFGVLLLEMLTG  569

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV +M
Sbjct  570  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKM  629

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  630  PDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  663



>ref|XP_009355011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009355020.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=623

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 3/145 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M+   P  AR+AGYRAPEV++TRK +H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  480  GCISDVGLTPLMN--VPATARSAGYRAPEVIETRKHSHKSDVYSFGVVLLEMLTGKAPLQ  537

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  538  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKVPDMRP  597

Query  298  KMPEVVKMIEGVRRNDHLENRRSCE  224
             M EVV+MIE +R++D  ENR+S E
Sbjct  598  TMEEVVRMIEEIRQSDS-ENRQSSE  621



>ref|XP_010094441.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB56022.1| putative inactive receptor kinase [Morus notabilis]
Length=634

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M++ A P +R+ GYRAPEV++TRK  H SDVYSFGVLLLE+LTGK+P+ 
Sbjct  480  GCISDFGLTPLMNAHATP-SRSVGYRAPEVIETRKYTHKSDVYSFGVLLLEMLTGKAPLQ  538

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWVHSVVREEWTAEVFD++L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  539  SPGRDDMVDLPRWVHSVVREEWTAEVFDIELMRYQNIEEEMVQMLQIAMACVTKVPDMRP  598

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M +VV+MIE +R++D  ENR S E   S+
Sbjct  599  SMEQVVRMIEEIRQSDS-ENRPSSEENKSK  627



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M+   P   R+AGYRAPEV++TRK +H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  481  GCISDVGLTPLMN--VPATTRSAGYRAPEVIETRKHSHKSDVYSFGVVLLEMLTGKAPLQ  538

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  539  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKVPDMRP  598

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  599  NMEEVVRMIEEIRQSDS-ENRPSSEENKSK  627



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M+   P   R+AGYRAPEV++TRK +H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  481  GCISDVGLTPLMN--VPATTRSAGYRAPEVIETRKHSHKSDVYSFGVVLLEMLTGKAPLQ  538

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  539  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKVPDMRP  598

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  599  NMEEVVRMIEEIRQSDS-ENRPSSEENKSK  627



>gb|KDP45679.1| hypothetical protein JCGZ_17286 [Jatropha curcas]
Length=634

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +  GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  475  NQEHDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  533

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++
Sbjct  534  KAPLQSPARDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMACVAKV  593

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  594  PDMRPNMDEVVRMIEEIRQSDS-ENRPSSEENKSK  627



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSFGVLLLE+LTGK+P+ 
Sbjct  518  GCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQ  576

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  577  SPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIGMACVAKVPDMRP  636

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE VR++D  ENR S E   S+
Sbjct  637  NMDEVVRMIEEVRQSDS-ENRPSSEENKSK  665



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSFGVLLLE+LTGK+P+ 
Sbjct  528  GCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQ  586

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  587  SPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIGMACVAKVPDMRP  646

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE VR++D  ENR S E   S+
Sbjct  647  NMDEVVRMIEEVRQSDS-ENRPSSEENKSK  675



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSFGVLLLE+LTGK+P+ 
Sbjct  518  GCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQ  576

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  577  SPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIGMACVAKVPDMRP  636

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE VR++D  ENR S E   S+
Sbjct  637  NMDEVVRMIEEVRQSDS-ENRPSSEENKSK  665



>ref|XP_008384658.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=634

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M+   P  AR+AGYRAPEV++TR+ +H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  481  GCISDVGLTPLMN--VPATARSAGYRAPEVIETRRHSHKSDVYSFGVVLLEMLTGKAPLQ  538

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  539  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKVPDMRP  598

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  599  SMEEVVRMIEEIRQSDS-ENRPSSEENKSK  627



>ref|XP_004967473.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Setaria 
italica]
Length=649

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 113/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N   +GC+SD+GL+ +M+ +    +R+ GY APEV DTRKA+  SDVYSFGV +LELLTG
Sbjct  479  NRHDFGCISDLGLAQLMNPITAR-SRSLGYCAPEVTDTRKASQASDVYSFGVFILELLTG  537

Query  493  KSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVR  317
            KSPV  T  G+E +HLVRWV SVVREEWTAEVFD +LL+ P+IEEEMVEMLQIA++CV R
Sbjct  538  KSPVQITGGGNEFVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEEMVEMLQIAMACVSR  597

Query  316  MPDQRPKMPEVVKMIEGVRRND  251
             P++RP+M +VV+ IE VRR D
Sbjct  598  TPERRPRMADVVRTIEEVRRGD  619



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 122/157 (78%), Gaps = 2/157 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N   +GC+SD GL+++MS  A P +R+AGYRAPEV++TRK    SDVYSFGVLLLE+LTG
Sbjct  480  NQDLHGCISDFGLTSLMSFPAVP-SRSAGYRAPEVIETRKFTQKSDVYSFGVLLLEMLTG  538

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            KSPV  +  ++++ L RWV SVVREEWTAEVFDV+L+K  ++EEE+V+MLQIA++CV R+
Sbjct  539  KSPVQLSGHEDVVDLPRWVQSVVREEWTAEVFDVELMKYQNVEEELVQMLQIAMTCVARL  598

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
            PD RP M EV +M+E +R +D  ENR S E+  S+ S
Sbjct  599  PDMRPTMEEVTRMMEEIRPSDS-ENRPSSEDNRSKGS  634



>ref|XP_007017100.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY34719.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=671

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD+GL+ +M+    P +R AGYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  512  NQDHDGCISDLGLTPLMNVPVTP-SRTAGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  570

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  571  KAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVAKV  630

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  631  PDMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  664



>gb|KDP21848.1| hypothetical protein JCGZ_00635 [Jatropha curcas]
Length=657

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            G +SD GL+ IMS  + P AR+AGYRAPEV++TRK+   SDVYSFGVLLLE+LTGK+PV 
Sbjct  506  GRISDFGLTPIMSYPSVP-ARSAGYRAPEVIETRKSTQKSDVYSFGVLLLEMLTGKAPVQ  564

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +T  DE++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA+SCV R+PD RP
Sbjct  565  STGQDEVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMSCVARVPDTRP  624

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGAS  212
             M EVV+MIE +R  D + N  S EN  S
Sbjct  625  TMNEVVRMIEEIRPTDSV-NHTSEENTES  652



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N  Q GC+SD GL  +M+    P +R+ GYRAPEV++TRK    SDVYSFGVLLLELLTG
Sbjct  517  NQDQDGCISDFGLVPLMNFPVTP-SRSVGYRAPEVIETRKPTQKSDVYSFGVLLLELLTG  575

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  576  KAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKV  635

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RPKM EVV+MIE +R++D  ENR S E   S+
Sbjct  636  PDMRPKMEEVVRMIEEIRQSDS-ENRPSSEENKSK  669



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +  GC+SD GL+++M   A P  RAAGYRAPEV +TRK  H SDVYSFGVLLLE+LTG
Sbjct  474  NQETDGCISDSGLTSLM---AMPTTRAAGYRAPEVTETRKQTHKSDVYSFGVLLLEMLTG  530

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ + S D+++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+MLQ+A++CV R+
Sbjct  531  KAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNIEEEMVQMLQVAMACVARL  590

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  221
            PD RP M +VV+MIE +R +D  +NR S E+
Sbjct  591  PDMRPDMDQVVRMIEEIRLSDS-DNRPSSED  620



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +  GC+SD GL+++M   A P  RAAGYRAPEV +TRK  H SDVYSFGVLLLE+LTG
Sbjct  498  NQETDGCISDSGLTSLM---AMPTTRAAGYRAPEVTETRKQTHKSDVYSFGVLLLEMLTG  554

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ + S D+++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+MLQ+A++CV R+
Sbjct  555  KAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNIEEEMVQMLQVAMACVARL  614

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  221
            PD RP M +VV+MIE +R +D  +NR S E+
Sbjct  615  PDMRPDMDQVVRMIEEIRLSDS-DNRPSSED  644



>gb|AFK38063.1| unknown [Lotus japonicus]
Length=144

 Score =   176 bits (446),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  601  ARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVR  422
            +R AGYRAPEV++TRK +H SDVYSFGVLLLE+LTGK+P+ +   D ++ L RWV SVVR
Sbjct  8    SRVAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDGMVDLPRWVQSVVR  67

Query  421  EEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLE  242
            EEWTAEVFDV+L+K  +IEEEMV+MLQIA++CV +MPD RP M EVV+MIE +R++D  E
Sbjct  68   EEWTAEVFDVELMKYQNIEEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDS-E  126

Query  241  NRRSCENGASRLS  203
            NR S E   S+ S
Sbjct  127  NRPSSEENKSKDS  139



>ref|XP_003519295.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006575457.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006575458.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=654

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK  H SDVYSFG+LLLE+LTG
Sbjct  494  NHDNDGCISDFGLTPLMNVPATP-SRAAGYRAPEVIETRKHTHKSDVYSFGILLLEMLTG  552

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  553  KAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKV  612

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  613  PDMRPSMDEVVRMIEEIRLSDS-ENRPSSEENRSK  646



>ref|XP_003544939.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=656

 Score =   188 bits (477),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  + P +RAAGYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  496  NQDNDGCISDFGLTPLMNVPSTP-SRAAGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  554

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  555  KAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKV  614

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  615  PDMRPSMEEVVRMIEEIRLSDS-ENRPSSEENRSK  648



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 122/152 (80%), Gaps = 3/152 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M+  A   AR+AGYRAPEV++TR+ +H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  481  GCISDVGLTPLMNVSA--TARSAGYRAPEVIETRRHSHKSDVYSFGVVLLEMLTGKAPLQ  538

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  539  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKVPDMRP  598

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
             M EVV+MIE +R++D  ENR S E   S+ S
Sbjct  599  SMEEVVRMIEEIRQSDS-ENRPSSEENKSKHS  629



>ref|XP_010931391.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931392.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931393.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=636

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 116/147 (79%), Gaps = 1/147 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GL+ +M++ A P     GYRAPEV++TRK+   SDVYSFGVLLLE+LTGK+P+ +
Sbjct  483  CVSDFGLAPLMNTHATPSRVVVGYRAPEVIETRKSTQRSDVYSFGVLLLEMLTGKAPLQS  542

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV R PDQRP+
Sbjct  543  PGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVARAPDQRPR  602

Query  295  MPEVVKMIEGVRRNDHLENRRSCENGA  215
            M EV++MIE VR +D  ENR+S E  A
Sbjct  603  MEEVIRMIEEVRHSDS-ENRQSSEEKA  628



>ref|XP_008456255.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008456256.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=630

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 116/149 (78%), Gaps = 4/149 (3%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GL+ +M+    P +R AGYRAPEV++ RK  H SDVYSFGVLLLE+LTGK+P+ +
Sbjct  479  CVSDFGLTPLMNV---PTSRTAGYRAPEVIEARKHTHKSDVYSFGVLLLEMLTGKAPLQS  535

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               DE++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP 
Sbjct  536  PGRDEMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMTCVAKLPDMRPN  595

Query  295  MPEVVKMIEGVRRNDHLENRRSCENGASR  209
            M EVV+MIE +R++D  ENR S E   S+
Sbjct  596  MDEVVRMIEEIRQSDS-ENRPSSEENKSK  623



>ref|XP_007142022.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 ref|XP_007142023.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14016.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14017.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
Length=655

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK +H SDVYSFGVLLLE+LTG
Sbjct  495  NQDNDGCISDFGLTPLMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTG  553

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  554  KAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKV  613

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EV +MIE +R +D  ENR S E   S+
Sbjct  614  PDMRPTMEEVARMIEEIRLSDS-ENRPSSEENRSK  647



>ref|XP_004139930.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 ref|XP_004154555.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN46766.1| hypothetical protein Csa_6G133750 [Cucumis sativus]
Length=630

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 116/149 (78%), Gaps = 4/149 (3%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GL+ +M+    P +R AGYRAPEV++ RK  H SDVYSFGVLLLE+LTGK+P+ +
Sbjct  479  CVSDFGLTPLMNV---PTSRTAGYRAPEVIEARKHTHKSDVYSFGVLLLEMLTGKAPLQS  535

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               DE++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP 
Sbjct  536  PGRDEMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMTCVAKLPDMRPN  595

Query  295  MPEVVKMIEGVRRNDHLENRRSCENGASR  209
            M EVV+MIE +R++D  ENR S E   S+
Sbjct  596  MDEVVRMIEEIRQSDS-ENRPSSEENKSK  623



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M S   P +R+AGYRAPEV++TRK    SDVYSFGVLLLELLTGK+PV 
Sbjct  494  GCISDVGLTPLMGSPTIP-SRSAGYRAPEVIETRKCTQKSDVYSFGVLLLELLTGKAPVQ  552

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
                DE++ L RWV SVVREEWTAEVFD +L+K  +IE+EMV+MLQIA++CV ++P+ RP
Sbjct  553  PPGHDEVVDLPRWVQSVVREEWTAEVFDAELIKFQNIEDEMVQMLQIAMTCVAKVPETRP  612

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSS  194
             M +VV+MIE ++++D   NR S E+  SR SP+S
Sbjct  613  DMNQVVQMIEDIQQSDS-GNRPSSEDNKSR-SPTS  645



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -2

Query  664  QYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSP  485
            Q GC+SD GL+++M+    P +R+ GYRAPEV++TRK    SDVYSFGVLLLELLTGK+P
Sbjct  486  QDGCISDFGLASLMNFPVIP-SRSVGYRAPEVIETRKPTQKSDVYSFGVLLLELLTGKAP  544

Query  484  VHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQ  305
            + +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD 
Sbjct  545  LQSPGHDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKVPDV  604

Query  304  RPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            RPKM EVV+MIE +R++D  ENR S E   S+
Sbjct  605  RPKMEEVVRMIEEIRQSDS-ENRPSSEENKSK  635



>gb|KJB20517.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20518.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20520.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20521.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=657

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +  GC+SD+GL+ +M+  A P +R+ GYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  498  NQEHDGCISDLGLTPLMNVPATP-SRSVGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  556

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  557  KAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVAKV  616

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             D RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  617  ADMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  650



>ref|XP_002528709.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33698.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=633

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            G VSD GL+ IMS  A P +R AGYRAPEV++TRK    SDVYSFGVLLLE+LTGK+PV 
Sbjct  481  GSVSDFGLTPIMSYPAVP-SRTAGYRAPEVIETRKPTQKSDVYSFGVLLLEMLTGKAPVQ  539

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +T  D+++ L RWV SVVREEWTAEVFD++LLK  +IEEEMV+MLQIA++CV R+PD RP
Sbjct  540  STGQDDVVDLPRWVQSVVREEWTAEVFDLELLKYQNIEEEMVQMLQIAMACVARVPDMRP  599

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R  D L +  S E   S 
Sbjct  600  TMDEVVRMIEEIRVPDSLNHPSSEEYKGSN  629



>ref|XP_011041763.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=510

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A   +R+AGYRAPEV++TRK  H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  356  GCISDFGLTPLMNVPAT-SSRSAGYRAPEVIETRKHTHKSDVYSFGVVLLEMLTGKAPIQ  414

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  415  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRP  474

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  475  NMEEVVRMIEEIRQSDS-ENRPSSEENKSK  503



>gb|KHG05843.1| hypothetical protein F383_32232 [Gossypium arboreum]
Length=659

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N +  GC+SD+GL+ +M+  A P +R  GYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  500  NQEHDGCISDLGLTPLMNVPATP-SRTVGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  558

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++
Sbjct  559  KAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVAKV  618

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             D RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  619  ADMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  652



>ref|XP_009590190.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009590191.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=645

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M S   P +R+AGYRAPEV++TRK    SDVYSFGVLLLELLTGK+PV 
Sbjct  491  GCISDVGLTPLMGSPTIP-SRSAGYRAPEVIETRKCTQKSDVYSFGVLLLELLTGKAPVQ  549

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
                DE++ L RWV SVVREEWTAEVFD +L+K  +I++EMV+MLQIA++CV ++P+ RP
Sbjct  550  PPGHDEVVDLPRWVQSVVREEWTAEVFDAELIKFQNIQDEMVQMLQIAMACVAKVPETRP  609

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSS  194
             M +VV+MIE ++++D   NR S E+  SR SP+S
Sbjct  610  DMNQVVQMIEDIQQSDS-GNRPSSEDNKSR-SPTS  642



>ref|XP_006842562.1| hypothetical protein AMTR_s00077p00144570 [Amborella trichopoda]
 gb|ERN04237.1| hypothetical protein AMTR_s00077p00144570 [Amborella trichopoda]
Length=219

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 116/157 (74%), Gaps = 7/157 (4%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAP-PVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
             VSD GL+ +MS  AP P  RA GYRAPE ++TR+A   SDVYSFGVLLLELLTGKSP  
Sbjct  59   LVSDFGLAPLMSPPAPGPHPRAPGYRAPETLETRRATQKSDVYSFGVLLLELLTGKSPAQ  118

Query  478  TT-----SGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
                     ++I  L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQ+A++CV R+
Sbjct  119  AHQAQAQGSEDIADLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQVAMACVARV  178

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
            PD RPKM EVVKM+E V+++D  ENR S E+  S+ S
Sbjct  179  PDLRPKMSEVVKMVEDVKQSDS-ENRPSSEDNRSKDS  214



>emb|CDP03386.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  CVSD GL+A+ S+ +PP  R AGYRAPEV++TR+    SDVYSFGVLLLELLTGK+
Sbjct  503  NQDACVSDYGLNALFSNSSPPNHRVAGYRAPEVLETRRVTFKSDVYSFGVLLLELLTGKA  562

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++LQI ++CV  +PD
Sbjct  563  PNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQLLQIGMACVATVPD  622

Query  307  QRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQE  182
            QRP M EVV+MIE + R +  +  R   +  S+ S S   QE
Sbjct  623  QRPAMQEVVRMIEDMNRGETDDGLRQSSDDPSKGSDSHTPQE  664



>ref|XP_004236305.1| PREDICTED: probable inactive receptor kinase At2g26730 [Solanum 
lycopersicum]
Length=659

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  CVSD GL+ + S+ AP   R AGYRAPEV++TRK  + SDVYSFGVL+LELLTGK+
Sbjct  488  NQDACVSDYGLNPLFSTSAPVNHRVAGYRAPEVLETRKVTYKSDVYSFGVLMLELLTGKA  547

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++LQI ++CV  MPD
Sbjct  548  PNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQLLQIGMACVATMPD  607

Query  307  QRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQE  182
            QRP M EVV+MIE + R D  +  R   +  S+ S     QE
Sbjct  608  QRPAMTEVVRMIEEMNRGDTDDGLRQSSDDPSKGSEGQTPQE  649



>ref|XP_008673504.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Zea mays]
 ref|XP_008673505.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Zea mays]
Length=665

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 9/145 (6%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVA---RAAGYRAPEVVDTRKAAHPSDVYSFGVLLLEL  503
            N   YGC+SD+GL+     LA P+A   R+ GY APEV DTRKA+  SDVYS GVL+LEL
Sbjct  492  NRDGYGCISDLGLA----QLANPIAARSRSLGYCAPEVADTRKASQASDVYSLGVLVLEL  547

Query  502  LTGKSPVHTTSG--DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALS  329
            LTG+SPV  + G   E++HLVRWV SVVREEWTAEVFD  LL++PDIEEEMVEMLQIA++
Sbjct  548  LTGRSPVQVSGGRGSEVVHLVRWVQSVVREEWTAEVFDGALLRVPDIEEEMVEMLQIAMA  607

Query  328  CVVRMPDQRPKMPEVVKMIEGVRRN  254
            CV R PD+RPK+ +VV+ +E VRR+
Sbjct  608  CVSRTPDRRPKVADVVRTVEEVRRS  632



>ref|XP_008673506.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X4 [Zea mays]
Length=657

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 9/145 (6%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVA---RAAGYRAPEVVDTRKAAHPSDVYSFGVLLLEL  503
            N   YGC+SD+GL+     LA P+A   R+ GY APEV DTRKA+  SDVYS GVL+LEL
Sbjct  484  NRDGYGCISDLGLA----QLANPIAARSRSLGYCAPEVADTRKASQASDVYSLGVLVLEL  539

Query  502  LTGKSPVHTTSG--DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALS  329
            LTG+SPV  + G   E++HLVRWV SVVREEWTAEVFD  LL++PDIEEEMVEMLQIA++
Sbjct  540  LTGRSPVQVSGGRGSEVVHLVRWVQSVVREEWTAEVFDGALLRVPDIEEEMVEMLQIAMA  599

Query  328  CVVRMPDQRPKMPEVVKMIEGVRRN  254
            CV R PD+RPK+ +VV+ +E VRR+
Sbjct  600  CVSRTPDRRPKVADVVRTVEEVRRS  624



>gb|ABK93951.1| unknown [Populus trichocarpa]
Length=351

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M+     + R  GYRAPEV++TRKA+  SDVYSFGVLLLE+LTGK+P+ 
Sbjct  201  GCISDVGLAPLMN-FPTTMYRTIGYRAPEVIETRKASQKSDVYSFGVLLLEMLTGKAPLQ  259

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
                D ++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIAL+CV + PD RP
Sbjct  260  VPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQNIEEEMVQMLQIALACVAKAPDMRP  319

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  200
            KM EVV+MIE ++ +D  +NR S +  ++  +P
Sbjct  320  KMDEVVRMIEEIQHSDS-KNRSSSDAESNVQTP  351



>ref|XP_011041759.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041760.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041761.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041762.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=636

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A   +R+AGYRAPEV++TRK  H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  482  GCISDFGLTPLMNVPATS-SRSAGYRAPEVIETRKHTHKSDVYSFGVVLLEMLTGKAPIQ  540

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  541  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRP  600

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  601  NMEEVVRMIEEIRQSDS-ENRPSSEENKSK  629



>gb|ACN57520.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57521.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57522.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57523.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57524.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57525.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57526.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57527.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57528.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57529.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57530.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57531.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57532.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57534.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57536.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57539.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  CVSD GL+ + S+ +PP  R AGY APEV++TRK    SDVYSFGVLLLELLTGKS
Sbjct  28   NQDTCVSDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKS  86

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++LQIA++CV  +PD
Sbjct  87   PNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMTCVSTVPD  146

Query  307  QRPKMPEVVKMIEGVRRND  251
            QRP M EV++MIE V R++
Sbjct  147  QRPVMQEVLRMIEDVNRSE  165



>ref|XP_002325632.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEF00014.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=636

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A   +R+AGYRAPEV++TRK  H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  482  GCISDFGLTPLMNVPATS-SRSAGYRAPEVIETRKHTHKSDVYSFGVVLLEMLTGKAPIQ  540

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  541  SPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRP  600

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  601  NMEEVVRMIEEIRQSDS-ENRPSSEENKSK  629



>gb|ACN57540.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57544.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  C+SD GL+ + S+ +PP  R AGY APEV++TRK    SDVYSFGVLLLELLTGKS
Sbjct  28   NQDTCISDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKS  86

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++LQIA++CV  +PD
Sbjct  87   PNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMTCVSTVPD  146

Query  307  QRPKMPEVVKMIEGVRRND  251
            QRP M EV++MIE V R++
Sbjct  147  QRPVMQEVLRMIEDVNRSE  165



>ref|XP_009597502.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nicotiana 
tomentosiformis]
Length=659

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVA--RAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELL  500
            N++ Y CVSD GL+ + S  A PV   R AGYRAPEV++TRK    SDVYSFGVL+LELL
Sbjct  486  NNQDYACVSDYGLNPLFSITATPVNNHRVAGYRAPEVLETRKVTFKSDVYSFGVLILELL  545

Query  499  TGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVV  320
            TGK+P   + GDE I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++LQI ++CV 
Sbjct  546  TGKAPNQASLGDEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQLLQIGMACVA  605

Query  319  RMPDQRPKMPEVVKMIEGVRRNDHL  245
             +PDQRP M EVV+MIE + R+D L
Sbjct  606  IVPDQRPSMAEVVRMIEEMNRDDGL  630



>gb|ACN57533.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57535.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57537.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57538.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57541.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57542.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57543.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57545.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57546.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57548.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  C+SD GL+ + S+ +PP  R AGY APEV++TRK    SDVYSFGVLLLELLTGKS
Sbjct  28   NQDTCISDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKS  86

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++LQIA++CV  +PD
Sbjct  87   PNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMTCVSTVPD  146

Query  307  QRPKMPEVVKMIEGVRRND  251
            QRP M EV++MIE V R++
Sbjct  147  QRPVMQEVLRMIEDVNRSE  165



>ref|XP_009406050.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406051.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406052.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVS+ GL+ +MSS A P +R  GYRAPEV++ RK+   SDVYSFGV LLELLTGKSP  +
Sbjct  479  CVSEFGLAPLMSSAATP-SRVVGYRAPEVIEHRKSTQKSDVYSFGVFLLELLTGKSPFQS  537

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D+++ L RWV SVVREEWTAEVFDV+L++ P+IEE+MV+MLQ+A+ CVVR+ +QRPK
Sbjct  538  PGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYPNIEEDMVQMLQVAMQCVVRVAEQRPK  597

Query  295  MPEVVKMIEGVRRNDHLENRRSCEN  221
            M +VV+MIE V+R++  ENR S E+
Sbjct  598  MEDVVRMIEDVQRSNS-ENRPSSED  621



>ref|XP_009767272.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nicotiana 
sylvestris]
Length=659

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVA--RAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELL  500
            N++ Y CVSD GL+ + S+ A PV   R AGYRAPEV++TRK    SDVYSFGVL+LELL
Sbjct  486  NNQDYACVSDYGLNLLFSTTATPVNNHRVAGYRAPEVLETRKVTFKSDVYSFGVLILELL  545

Query  499  TGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVV  320
            TGK+P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++LQI ++CV 
Sbjct  546  TGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQLLQIGMACVA  605

Query  319  RMPDQRPKMPEVVKMIEGVRRNDHL  245
             +PDQRP M EVV+MIE + R+D L
Sbjct  606  IVPDQRPTMAEVVRMIEEMNRDDGL  630



>tpg|DAA52804.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=782

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 9/145 (6%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVA---RAAGYRAPEVVDTRKAAHPSDVYSFGVLLLEL  503
            N   YGC+SD+GL+     LA P+A   R+ GY APEV DTRKA+  SDVYS GVL+LEL
Sbjct  609  NRDGYGCISDLGLA----QLANPIAARSRSLGYCAPEVADTRKASQASDVYSLGVLVLEL  664

Query  502  LTGKSPVHTTSG--DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALS  329
            LTG+SPV  + G   E++HLVRWV SVVREEWTAEVFD  LL++PDIEEEMVEMLQIA++
Sbjct  665  LTGRSPVQVSGGRGSEVVHLVRWVQSVVREEWTAEVFDGALLRVPDIEEEMVEMLQIAMA  724

Query  328  CVVRMPDQRPKMPEVVKMIEGVRRN  254
            CV R PD+RPK+ +VV+ +E VRR+
Sbjct  725  CVSRTPDRRPKVADVVRTVEEVRRS  749



>ref|XP_006351444.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Solanum 
tuberosum]
Length=659

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 114/162 (70%), Gaps = 0/162 (0%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  CVSD GL+ + S+ AP   R AGYRAPEV++TRK  + SDVYSFGVL+LELLTGK+
Sbjct  488  NQDACVSDYGLNPLFSTSAPVNHRVAGYRAPEVLETRKVTYKSDVYSFGVLMLELLTGKA  547

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++LQI ++CV  MPD
Sbjct  548  PNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQLLQIGMACVATMPD  607

Query  307  QRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQE  182
            QRP M EVVKMIE +   D  +  R   +  S+ S     QE
Sbjct  608  QRPAMTEVVKMIEEMNHGDTDDGLRQSSDDPSKGSEGQTPQE  649



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 117/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N     CVSD GL+ +M+  A P +R  GYRAPEV++TRK  H SDVYSFGVL+LE+LTG
Sbjct  493  NQDMEACVSDFGLAPVMNFPAAP-SRHPGYRAPEVIETRKHTHKSDVYSFGVLMLEMLTG  551

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV R+
Sbjct  552  KQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVGRV  611

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE VR++D  +NR S E   S+
Sbjct  612  PDMRPTMDEVVRMIEEVRQSDS-DNRPSSEENKSK  645



>ref|XP_009758202.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=652

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 117/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N     CVSD GL+ +M+  A P +R  GYRAPEV++TRK  H SDVYSFGVL+LE+LTG
Sbjct  493  NQDMEACVSDFGLAPVMNFPAAP-SRHPGYRAPEVIETRKHTHKSDVYSFGVLMLEMLTG  551

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV R+
Sbjct  552  KQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVGRV  611

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE VR++D  +NR S E   S+
Sbjct  612  PDMRPTMDEVVRMIEEVRQSDS-DNRPSSEENKSK  645



>ref|XP_011080640.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=640

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GL+ +M+S A   +R  GYRAPEV++TRK  H SDVYSFGV+LLE+LTGK P+ +
Sbjct  493  CVSDFGLAPLMNSPASS-SRHTGYRAPEVIETRKHTHKSDVYSFGVMLLEMLTGKQPIQS  551

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D+I+ L RWV SVVREEWTAEVFD++L++  +IEEEMV+MLQIA++CV ++PD RP 
Sbjct  552  PGRDDIVDLPRWVQSVVREEWTAEVFDIELMRFQNIEEEMVQMLQIAMACVAKVPDARPN  611

Query  295  MPEVVKMIEGVRRNDHLENRRSCENGASR  209
            M EVV+MIE VR +D  ENR S E   S+
Sbjct  612  MDEVVRMIEEVRPSDS-ENRPSSEENKSK  639



>ref|XP_008803002.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803003.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803004.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=635

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GL+ +M++ A P     GYRAPEV++TRK+   SDVYSFGVLLLE+LTGK+P+ +
Sbjct  483  CVSDFGLAPLMNTHATPSRIVVGYRAPEVIETRKSTQKSDVYSFGVLLLEMLTGKAPLQS  542

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV R PDQRP+
Sbjct  543  PGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVARAPDQRPR  602

Query  295  MPEVVKMIEGVRRNDHLENRRSCE  224
            M EV++MIE VR +D   NR S E
Sbjct  603  MEEVIRMIEEVRHSDS-GNRPSSE  625



>ref|XP_009798129.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798130.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798131.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=625

 Score =   182 bits (463),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GL+ IM+  A P  R  GYRAPEV++TRK +H SDVYSFGVLLLE+LTGK P+ +
Sbjct  482  CVSDFGLAPIMNFPAAP-TRYPGYRAPEVIETRKHSHKSDVYSFGVLLLEMLTGKQPMQS  540

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D+++ L RWV SV++EEWT+EVFDV L++  +IEEEMV+MLQIA++CV ++PD RP 
Sbjct  541  PGRDDMVDLPRWVQSVLKEEWTSEVFDVDLMRFQNIEEEMVQMLQIAMACVAKVPDMRPN  600

Query  295  MPEVVKMIEGVRRNDHLENRRSCE  224
            M EVVKMIE VR++D  ENR+S E
Sbjct  601  MEEVVKMIEEVRQSDS-ENRQSSE  623



>ref|XP_003616055.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES99013.1| receptor-like kinase [Medicago truncatula]
Length=651

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 118/155 (76%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N    GC+SD GL+ +M+  A P +R  GYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  492  NQDNDGCISDFGLTPLMNIPATP-SRTMGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  550

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++
Sbjct  551  KAPQQSPVRDDMVDLPRWVRSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKV  610

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  +NR S ++  S+
Sbjct  611  PDMRPNMEEVVRMIEEIRQSDS-DNRPSSDDNKSK  644



>ref|XP_002276162.3| PREDICTED: probable inactive receptor kinase At5g58300 [Vitis 
vinifera]
Length=666

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A   +R AGYRAPEV+++RK  H SDVYSFGVLLLE+LTGK+P+ 
Sbjct  512  GCISDFGLTPLMNFPATS-SRNAGYRAPEVIESRKHTHKSDVYSFGVLLLEMLTGKAPLQ  570

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFD++L++  +IEEEMV+MLQ+A++CV ++PD RP
Sbjct  571  SPGRDDMVDLPRWVQSVVREEWTAEVFDIELMRYQNIEEEMVQMLQLAMACVAKVPDMRP  630

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  631  SMDEVVRMIEEIRQSDS-ENRPSSEENKSK  659



>emb|CBI15804.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A   +R AGYRAPEV+++RK  H SDVYSFGVLLLE+LTGK+P+ 
Sbjct  502  GCISDFGLTPLMNFPATS-SRNAGYRAPEVIESRKHTHKSDVYSFGVLLLEMLTGKAPLQ  560

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFD++L++  +IEEEMV+MLQ+A++CV ++PD RP
Sbjct  561  SPGRDDMVDLPRWVQSVVREEWTAEVFDIELMRYQNIEEEMVQMLQLAMACVAKVPDMRP  620

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  621  SMDEVVRMIEEIRQSDS-ENRPSSEENKSK  649



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -2

Query  664  QYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSP  485
            Q GC+SD GL+ +M+ + P   R AGYRAPEV++TRK    SDVYSFGVLLLE+LT KSP
Sbjct  528  QDGCISDFGLTPLMNYI-PFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSP  586

Query  484  VHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQ  305
            +  +  DE++ L RWV SVVREEWTAEVFDV+LLK  +IEEEMV+MLQI L+CV ++PD 
Sbjct  587  IPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACVAKVPDM  646

Query  304  RPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            RP M EVV+MIE +R+ +  E R S E+  S+
Sbjct  647  RPSMGEVVRMIEDIRQPEG-ETRPSSEDNRSK  677



>ref|XP_002319979.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEE95902.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=635

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A   +R+AGYRAPEV++T K +H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  481  GCISDFGLTPLMNVPASS-SRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQ  539

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  540  SPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRP  599

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  600  NMEEVVRMIEEIRQSDS-ENRPSSEGNKSK  628



>ref|XP_011011771.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011772.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011773.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011774.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011775.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
Length=635

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+  A   +R+AGYRAPEV++T K +H SDVYSFGV+LLE+LTGK+P+ 
Sbjct  481  GCISDFGLTPLMNVPASS-SRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQ  539

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++PD RP
Sbjct  540  SPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRP  599

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R++D  ENR S E   S+
Sbjct  600  NMEEVVRMIEEIRQSDS-ENRPSSEGNKSK  628



>ref|XP_009410507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CV D GL+ +M+S A P     GYRAPEV++TRK    SDVYSFGVLLLE+LTGK+P+ +
Sbjct  482  CVCDYGLAPLMNSAATPSRIVVGYRAPEVIETRKYTQKSDVYSFGVLLLEMLTGKAPLQS  541

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D++  L RWV SVVREEWTAEVFDV+L++ P IEEEMV+MLQIA++CV + PDQRPK
Sbjct  542  PGRDDVADLPRWVQSVVREEWTAEVFDVELMRYPHIEEEMVQMLQIAMACVSKAPDQRPK  601

Query  295  MPEVVKMIEGVRRNDHLENRRSCE  224
            M EV++MIE ++ +D  ENR S E
Sbjct  602  MEEVIRMIEDIQHSDS-ENRPSSE  624



>gb|AEW08175.1| hypothetical protein 2_2125_01, partial [Pinus radiata]
 gb|AFG59896.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59897.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59898.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59899.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59900.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59901.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59902.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59903.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59904.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59905.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59906.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59907.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59908.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59909.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59910.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59911.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59912.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
 gb|AFG59913.1| hypothetical protein 2_2125_01, partial [Pinus taeda]
Length=142

 Score =   171 bits (432),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  601  ARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVR  422
            +R AGYRAPEV++ RK +  SDVYSFGVLLLELLTGK+P+  +  +E+I L RWV SVVR
Sbjct  6    SRIAGYRAPEVIEARKVSQKSDVYSFGVLLLELLTGKAPIQASVNEEVIDLPRWVQSVVR  65

Query  421  EEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  251
            EEWTAEVFDV+L++  +IEEEMV+MLQIA++CV RMPDQRPK+ EVV+MIE V++ D
Sbjct  66   EEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVGRMPDQRPKITEVVRMIEEVKQFD  122



>gb|ABR17070.1| unknown [Picea sitchensis]
Length=340

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GCVSD GL  + S+ A    R AGYRAPEV++TRK    SDVYSFGVLLLELLTGK+P  
Sbjct  169  GCVSDFGLVPLFSAAAA-ANRIAGYRAPEVIETRKVTQKSDVYSFGVLLLELLTGKAPNQ  227

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
             +  DE I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++LQIA++CV  +PDQRP
Sbjct  228  ASLNDEGIDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQLLQIAMACVAAVPDQRP  287

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASRLS  203
            +M +VVKMIE +R+ +  +  R   +  S+ S
Sbjct  288  RMQDVVKMIEDMRQFETDDGNRQSSDDKSKES  319



>gb|ACN57547.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57549.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57551.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  C SD GL+ + S+ +PP  R AGY APEV++TRK    SDVYSFGVLLLELLTGKS
Sbjct  28   NQDTCXSDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKS  86

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++LQIA++CV  +PD
Sbjct  87   PNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMTCVSTVPD  146

Query  307  QRPKMPEVVKMIEGVRRND  251
            QRP M EV++MIE V R++
Sbjct  147  QRPVMQEVLRMIEDVNRSE  165



>ref|XP_010323112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=627

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            C+SD GL+ IM+  A P +R  GYRAPEV+++RK +H SDVYSFGVLLLE+LTGK P+ +
Sbjct  484  CISDFGLAPIMNFPAAP-SRYPGYRAPEVIESRKHSHKSDVYSFGVLLLEMLTGKQPMQS  542

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D+++ L RWV SVVREEWT+EVFDV L++  +IEEEMV+MLQIA++CVV++PD RP 
Sbjct  543  PGRDDMVDLPRWVQSVVREEWTSEVFDVDLMRFQNIEEEMVQMLQIAMACVVKVPDMRPN  602

Query  295  MPEVVKMIEGVRRNDHLENRRSCE  224
            M EVV+MIE VR+++  ENR S E
Sbjct  603  MEEVVRMIEDVRQSNS-ENRHSSE  625



>ref|XP_006435961.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486131.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486132.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR49201.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=627

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +++       R  GYRAPEV +TRKA+  SDVYSFGVLLLE+LTGK+P+ 
Sbjct  477  GCISDVGLAHLIN-FPTTATRTIGYRAPEVTETRKASQKSDVYSFGVLLLEMLTGKAPLQ  535

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
             +  D+++ L RWV SVVREEWTAEVFDV+LLK  D+EEEMV+MLQIALSCV ++PD RP
Sbjct  536  HSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKYQDVEEEMVQMLQIALSCVAKVPDSRP  595

Query  298  KMPEVVKMIEGVRRNDHLENRRS  230
            KM +VV+MIE +++ + L+NR S
Sbjct  596  KMDDVVRMIEQIQQPE-LKNRAS  617



>ref|XP_006435960.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486130.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR49200.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=638

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +++       R  GYRAPEV +TRKA+  SDVYSFGVLLLE+LTGK+P+ 
Sbjct  488  GCISDVGLAHLIN-FPTTATRTIGYRAPEVTETRKASQKSDVYSFGVLLLEMLTGKAPLQ  546

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
             +  D+++ L RWV SVVREEWTAEVFDV+LLK  D+EEEMV+MLQIALSCV ++PD RP
Sbjct  547  HSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKYQDVEEEMVQMLQIALSCVAKVPDSRP  606

Query  298  KMPEVVKMIEGVRRNDHLENRRS  230
            KM +VV+MIE +++ + L+NR S
Sbjct  607  KMDDVVRMIEQIQQPE-LKNRAS  628



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +M     P +++AGYRAPEV++T+K    SDVYSFGVLLLELLTGK+PV 
Sbjct  499  GCISDVGLTPLMGFPTIP-SKSAGYRAPEVIETKKCTQKSDVYSFGVLLLELLTGKAPVQ  557

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
                DE++ L RWV SVVREEWTAEVFDV+L+K  +IE+EMV+MLQIA++CV  +P+ RP
Sbjct  558  PPGHDEVVDLPRWVQSVVREEWTAEVFDVELIKFQNIEDEMVQMLQIAMTCVANVPETRP  617

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSS  194
             M +VV+MIE +++ D   NR S E+  SR SP+S
Sbjct  618  DMSQVVQMIEDIQQIDS-GNRPSSEDNKSR-SPTS  650



>emb|CDY02808.1| BnaC02g10810D [Brassica napus]
Length=421

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GL+++M+    P+ R AGYRAPEV++TRK  H SDVYSFGVL+LE+LTGKSPV +
Sbjct  265  CVSDYGLTSLMAVPVTPM-RGAGYRAPEVIETRKHTHKSDVYSFGVLILEMLTGKSPVQS  323

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
             S ++++ L RWV SVVREEWT+EVFDV+L+K+ +IEEEMV+MLQIA++CV ++ + RP 
Sbjct  324  PSREDMVDLPRWVQSVVREEWTSEVFDVELMKVQNIEEEMVQMLQIAMACVAQVAEVRPS  383

Query  295  MPEVVKMIEGVRRNDHLENRRSCENGA  215
            M +VV+MIE +R +D  E R S ++ +
Sbjct  384  MDDVVRMIEEIRVSDSSETRPSSDDNS  410



>ref|XP_008788112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=636

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            C+SD GL+ +M++ A P     GYRAPEV++TRK    SDVYSFGVLLLE+LTGK+P+ +
Sbjct  483  CISDFGLAPLMNTHATPSRVVVGYRAPEVIETRKYTQKSDVYSFGVLLLEMLTGKAPLQS  542

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D++  L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV R PDQRP+
Sbjct  543  PGRDDVADLPRWVQSVVREEWTAEVFDVELMRYRNIEEEMVQMLQIAMACVARAPDQRPR  602

Query  295  MPEVVKMIEGVRRNDHLENRRSCE  224
            M EV++MI+ VR +D  ENR S E
Sbjct  603  MEEVIRMIDEVRHSDS-ENRASSE  625



>ref|XP_009614171.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nicotiana 
tomentosiformis]
Length=655

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  CVSD GL+ + S+  P   R AGYRAPEVV+TRKA   SDVYSFGVL+LELLTGKS
Sbjct  483  NQDACVSDYGLNPLFSNSTPLNHRVAGYRAPEVVETRKATFKSDVYSFGVLILELLTGKS  542

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++LQI ++CV  +PD
Sbjct  543  PNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQLLQIGMACVSIVPD  602

Query  307  QRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQECS  176
            QRP MPEVV+MI+ + R D     R   +  S+ S S    + S
Sbjct  603  QRPAMPEVVRMIDEMNRGDTDYGLRQSSDDPSKGSDSQTPPQVS  646



>ref|XP_004490727.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490728.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
Length=653

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTG  494
            N     C+SD GL+  M+  A P +RA GYRAPEV++TRK  H SDVYSFGVLLLE+LTG
Sbjct  494  NQDNDSCISDFGLTPFMNVPATP-SRAIGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTG  552

Query  493  KSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRM  314
            K+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQI ++CV ++
Sbjct  553  KAPQQSPVRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMACVAKV  612

Query  313  PDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            PD RP M EVV+MIE +R++D  +NR S +   S+
Sbjct  613  PDMRPNMEEVVRMIEEIRQSDS-DNRPSSDENKSK  646



>gb|KDO67579.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
 gb|KDO67580.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
Length=627

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SDVGL+ +++       R  GYRAPEV +TRKA+  SDVYSFGVLLLE+LTGK+P+ 
Sbjct  477  GCISDVGLAHLIN-FPTTATRTIGYRAPEVTETRKASQKSDVYSFGVLLLEMLTGKAPLQ  535

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
             +  D+++ L RWV SVVREEWTAEVFDV+LLK  D+EEEMV+MLQIALSCV ++PD RP
Sbjct  536  HSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKYQDVEEEMVQMLQIALSCVAKVPDSRP  595

Query  298  KMPEVVKMIEGVRRNDHLENRRS  230
            KM +VV+MIE +++ + L NR S
Sbjct  596  KMDDVVRMIEQIQQPE-LRNRAS  617



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVA--RAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSP  485
            GC+SD GLS +M   A P+A  R AGYRAPEV++TRK  H SD+YSFGVL+LE+LTGKSP
Sbjct  499  GCISDFGLSPLM---AVPIAPMRGAGYRAPEVIETRKHTHKSDIYSFGVLILEMLTGKSP  555

Query  484  VHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQ  305
            V + S D+++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+MLQIA++CV +MP+ 
Sbjct  556  VQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNIEEEMVQMLQIAMACVAQMPEV  615

Query  304  RPKMPEVVKMIEGVRRNDHLENRRSCENGA  215
            RP M ++V+MIE +R +D    R S ++ +
Sbjct  616  RPTMDDIVRMIEEIRVSDSETTRPSSDDNS  645



>emb|CDY58565.1| BnaC03g12450D [Brassica napus]
Length=653

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GLS +MS    P+ R AGYRAPEV+ TRK  H SDVYSFGVL+LE+LTGKSPV +
Sbjct  497  CVSDFGLSPLMSVPIAPM-RGAGYRAPEVIVTRKHTHKSDVYSFGVLILEMLTGKSPVQS  555

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
             S ++++ L RWV SVVREEWT+EVFDV+L+K  +IEEEMV+MLQIA++CV  +P+ RP 
Sbjct  556  ASREDMVDLPRWVQSVVREEWTSEVFDVELMKFQNIEEEMVQMLQIAMACVAHVPEVRPS  615

Query  295  MPEVVKMIEGVRRNDHLENRRSCENGA  215
            M EVV+MIE +R +D  E R S ++ +
Sbjct  616  MDEVVRMIEEIRVSDSSETRPSSDDNS  642



>ref|XP_009782917.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nicotiana 
sylvestris]
Length=655

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  CVSD GL+ + S+ +P   R AGYRAPEVV+TRK    SDVYSFGVL+LELLTGKS
Sbjct  483  NQDACVSDYGLNPLFSNSSPLNHRVAGYRAPEVVETRKVTFKSDVYSFGVLILELLTGKS  542

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++LQI ++CV  +PD
Sbjct  543  PNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQLLQIGMTCVSIVPD  602

Query  307  QRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQECS  176
            QRP MPEVV+MI+ + R D     R   +  S+ S S    + S
Sbjct  603  QRPAMPEVVRMIDEMNRGDTDYGLRQSSDDPSKGSASQTPPQVS  646



>ref|NP_001168844.1| uncharacterized LOC100382649 precursor [Zea mays]
 gb|ACN30844.1| unknown [Zea mays]
 gb|AFW80439.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=672

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 114/144 (79%), Gaps = 9/144 (6%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPV---ARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLEL  503
            N  + GCVSD GL+++M+    PV   +R+ GY APEV DTRKA+  SDVYSFGV +LEL
Sbjct  492  NKHERGCVSDHGLASLMN----PVTVRSRSLGYCAPEVADTRKASQSSDVYSFGVFVLEL  547

Query  502  LTGKSPVHTTSGD--EIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALS  329
            LTGKSPV  T G+  +++HLVRWV SVVREEWTAEVFD +LL+ P+IEEEMVEMLQ+A++
Sbjct  548  LTGKSPVQITGGNGGDVVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEEMVEMLQVAMA  607

Query  328  CVVRMPDQRPKMPEVVKMIEGVRR  257
            CV R P++RP+M +VV+ IE VRR
Sbjct  608  CVSRSPERRPRMADVVRTIEEVRR  631



>gb|ACN30771.1| unknown [Zea mays]
Length=639

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 114/144 (79%), Gaps = 9/144 (6%)
 Frame = -2

Query  673  NSKQYGCVSDVGLSAIMSSLAPPV---ARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLEL  503
            N  + GCVSD GL+++M+    PV   +R+ GY APEV DTRKA+  SDVYSFGV +LEL
Sbjct  459  NKHERGCVSDHGLASLMN----PVTVRSRSLGYCAPEVADTRKASQSSDVYSFGVFVLEL  514

Query  502  LTGKSPVHTTSGD--EIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALS  329
            LTGKSPV  T G+  +++HLVRWV SVVREEWTAEVFD +LL+ P+IEEEMVEMLQ+A++
Sbjct  515  LTGKSPVQITGGNGGDVVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEEMVEMLQVAMA  574

Query  328  CVVRMPDQRPKMPEVVKMIEGVRR  257
            CV R P++RP+M +VV+ IE VRR
Sbjct  575  CVSRSPERRPRMADVVRTIEEVRR  598



>ref|XP_008355739.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=639

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = -2

Query  661  YGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPV  482
            YG +SD GL+ +M+    P +R+ GYRAPEV++T+K+   SDVYSFGV+LLE+LTGK+PV
Sbjct  475  YGSISDFGLALLMNLTTIP-SRSVGYRAPEVIETKKSFQKSDVYSFGVMLLEMLTGKAPV  533

Query  481  HTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQR  302
             ++  D+++ L RWV SVVREEWTAEVFDV+L+K  +IEEE+V+MLQIA++CV R+PD R
Sbjct  534  QSSGRDDVVDLPRWVQSVVREEWTAEVFDVELMKYQNIEEELVQMLQIAMTCVARVPDMR  593

Query  301  PKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            P M EVV+MIE +R  D  ENR S ++  S+
Sbjct  594  PTMEEVVRMIEEIRPPDS-ENRPSSDDNKSK  623



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GC+SD GL+ +M+ ++    R AGYRAPEV++TRK    SDVYSFGVLLLE+LTGKSP+ 
Sbjct  480  GCISDFGLTPLMNYISYKY-RCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTGKSPLP  538

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
             +  DE++ L RWV SVVREEWTAEVFDV+LLK  +IEEEMV+MLQI L+CV ++PD RP
Sbjct  539  LSGQDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACVAKVPDMRP  598

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             M EVV+MIE +R+ +  E R S E+  S+
Sbjct  599  AMGEVVRMIEEIRQPEG-ETRPSSEDSRSK  627



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GCVSD GL+ +M+  +   +R AGYRAPEV++TRK  H SDVYSFGV+LLE+LTGK P+ 
Sbjct  482  GCVSDFGLAPLMNHPSTS-SRHAGYRAPEVMETRKHTHKSDVYSFGVILLEMLTGKQPIQ  540

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            + S ++I+ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  541  SPSREDIVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVAKVPDMRP  600

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             + EVV+MIE VR++D  ENR S +   S+
Sbjct  601  SIDEVVRMIEEVRQSDS-ENRPSSDENKSK  629



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVH  479
            GCVSD GL+ +M+  +   +R AGYRAPEV++TRK  H SDVYSFGV+LLE+LTGK P+ 
Sbjct  501  GCVSDFGLAPLMNHPSTS-SRHAGYRAPEVMETRKHTHKSDVYSFGVILLEMLTGKQPIQ  559

Query  478  TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRP  299
            + S ++I+ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV ++PD RP
Sbjct  560  SPSREDIVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQMLQIAMACVAKVPDMRP  619

Query  298  KMPEVVKMIEGVRRNDHLENRRSCENGASR  209
             + EVV+MIE VR++D  ENR S +   S+
Sbjct  620  SIDEVVRMIEEVRQSDS-ENRPSSDENKSK  648



>ref|XP_010922781.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922782.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922783.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922784.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922785.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922786.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=635

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GL+ +M+  A P     GYRAPEV++TRK+   SDVYSFGVLLLE+LTGK+P+ +
Sbjct  483  CVSDFGLAPLMNIHATPSRVVVGYRAPEVIETRKSTQKSDVYSFGVLLLEMLTGKAPLQS  542

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
               D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+MLQIA++CV R PDQRP 
Sbjct  543  PGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVARAPDQRPI  602

Query  295  MPEVVKMIEGVRRNDHLENRRSCE  224
            M +V++MIE VR +D  ENR S E
Sbjct  603  MEDVIRMIEEVRHSDS-ENRPSSE  625



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -2

Query  664  QYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSP  485
            Q GC+SD GL+ +M+ + P   R AGYRAPEV++TRK    SDVYSFGVLLLE+LT KSP
Sbjct  491  QDGCISDFGLTPLMNYI-PFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSP  549

Query  484  VHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQ  305
            +  +  DE++ L RWV SVVREEWTAEVFDV+LLK  +IEEEMV+MLQI L+CV ++PD 
Sbjct  550  IPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACVAKVPDM  609

Query  304  RPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            RP M +VV+MIE +R+    E R S E+  S+
Sbjct  610  RPSMGQVVRMIEEIRQPQG-ETRPSSEDSRSK  640



>ref|XP_009132067.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=650

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = -2

Query  655  CVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHT  476
            CVSD GLS +MS    P+ R AGYRAPEV+ TRK  H SDVYSFGVL+LE+LTGKSPV +
Sbjct  494  CVSDFGLSPLMSVPIAPM-RGAGYRAPEVIVTRKHTHKSDVYSFGVLILEMLTGKSPVQS  552

Query  475  TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPK  296
             S ++++ L RWV SVVREEWT+EVFDV+L+K  +IEEEMV+MLQIA++CV  +P+ RP 
Sbjct  553  PSREDMVDLPRWVQSVVREEWTSEVFDVELMKFQNIEEEMVQMLQIAMACVAHVPEVRPS  612

Query  295  MPEVVKMIEGVRRNDHLENRRSCENGA  215
            M EVV+MIE +R +D  E R S ++ +
Sbjct  613  MDEVVRMIEEIRVSDSSETRPSSDDNS  639



>gb|ACN57550.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   170 bits (431),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 1/139 (1%)
 Frame = -2

Query  667  KQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKS  488
             Q  C  D GL+ + S+ +PP  R AGY APEV++TRK    SDVYSFGVLLLELLTGKS
Sbjct  28   NQDTCXXDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKS  86

Query  487  PVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPD  308
            P   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++LQIA++CV  +PD
Sbjct  87   PNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMTCVSTVPD  146

Query  307  QRPKMPEVVKMIEGVRRND  251
            QRP M EV++MIE V R++
Sbjct  147  QRPVMQEVLRMIEDVNRSE  165



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -2

Query  664  QYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSP  485
            Q GC+SD GL+ +M+ + P   R AGYRAPEV++TRK    SDVYSFGVLLLE+LT KSP
Sbjct  562  QDGCISDFGLTPLMNYI-PFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSP  620

Query  484  VHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQ  305
            +  +  DE++ L RWV SVVREEWTAEVFDV+LLK  +IEEEMV+MLQI L+CV ++PD 
Sbjct  621  IPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACVAKVPDM  680

Query  304  RPKMPEVVKMIEGVRRNDHLENRRSCENGASR  209
            RP M +VV+MIE +R+    E R S E+  S+
Sbjct  681  RPSMGQVVRMIEEIRQPQG-ETRPSSEDSRSK  711



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = -2

Query  658  GCVSDVGLSAIMSSLAPPVA--RAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSP  485
             C+SD GL+ +M   A P+A  R AGYRAPEV++TRK  H +DVYSFGVL+LE+LTGKSP
Sbjct  497  ACISDFGLTPLM---AVPIAPMRGAGYRAPEVIETRKHTHKTDVYSFGVLILEMLTGKSP  553

Query  484  VHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQ  305
            + + S D+++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+MLQIA++CV +MPD 
Sbjct  554  IQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNIEEEMVQMLQIAMACVAQMPDV  613

Query  304  RPKMPEVVKMIEGVRRNDHLENRRSCENGA  215
            RP M +VV+MIE +R +D    R S ++ +
Sbjct  614  RPTMDDVVRMIEEIRVSDSETTRPSSDDNS  643



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420