BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001M06

Length=791
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362050.1|  PREDICTED: serine/arginine repetitive matrix...  72.4    5e-11   Solanum tuberosum [potatoes]
ref|XP_010326174.1|  PREDICTED: serine/arginine repetitive matrix...  69.3    6e-10   
ref|XP_004246955.1|  PREDICTED: serine/arginine repetitive matrix...  69.3    6e-10   Solanum lycopersicum
ref|XP_010326175.1|  PREDICTED: serine/arginine repetitive matrix...  68.2    1e-09   
ref|XP_008801616.1|  PREDICTED: serine/arginine repetitive matrix...  64.3    2e-08   Phoenix dactylifera
ref|XP_008801619.1|  PREDICTED: serine/arginine repetitive matrix...  64.3    2e-08   Phoenix dactylifera
ref|XP_009612859.1|  PREDICTED: serine/arginine repetitive matrix...  64.3    3e-08   Nicotiana tomentosiformis
ref|XP_010937571.1|  PREDICTED: serine/arginine repetitive matrix...  63.9    3e-08   Elaeis guineensis
ref|XP_010937572.1|  PREDICTED: serine/arginine repetitive matrix...  63.9    3e-08   
ref|XP_010920514.1|  PREDICTED: serine/arginine repetitive matrix...  63.9    4e-08   Elaeis guineensis
ref|XP_010920517.1|  PREDICTED: serine/arginine repetitive matrix...  63.5    5e-08   
ref|XP_008803113.1|  PREDICTED: serine/arginine repetitive matrix...  61.2    3e-07   Phoenix dactylifera
ref|XP_008803112.1|  PREDICTED: serine/arginine repetitive matrix...  61.2    3e-07   Phoenix dactylifera
ref|XP_009789294.1|  PREDICTED: serine/arginine repetitive matrix...  59.3    1e-06   Nicotiana sylvestris
ref|XP_010256833.1|  PREDICTED: serine/arginine repetitive matrix...  57.8    4e-06   
ref|XP_010256831.1|  PREDICTED: serine/arginine repetitive matrix...  57.8    4e-06   Nelumbo nucifera [Indian lotus]
ref|XP_009419742.1|  PREDICTED: serine/arginine repetitive matrix...  56.6    9e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001159323.1|  hypothetical protein                             53.5    3e-05   
ref|XP_008681498.1|  PREDICTED: uncharacterized protein LOC100304...  54.7    4e-05   Zea mays [maize]
ref|XP_008681507.1|  PREDICTED: uncharacterized protein LOC100304...  54.7    4e-05   
ref|XP_008681486.1|  PREDICTED: uncharacterized protein LOC100304...  54.7    4e-05   Zea mays [maize]
ref|XP_008681504.1|  PREDICTED: uncharacterized protein LOC100304...  54.7    4e-05   
tpg|DAA44606.1|  TPA: hypothetical protein ZEAMMB73_474732            53.5    7e-05   
ref|XP_006649830.1|  PREDICTED: transcriptional regulator ATRX ho...  50.8    6e-04   
ref|XP_002280607.2|  PREDICTED: serine/arginine repetitive matrix...  50.8    7e-04   Vitis vinifera



>ref|XP_006362050.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Solanum tuberosum]
Length=882

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  363  KQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEF-HGREIEGTDSA-KKLEIELREKALE  190
            K K KS NAISSPSD ++  D + SD++  RKE  HGREIE ++S  K+LEIELREKALE
Sbjct  813  KLKSKSANAISSPSDTDRNPDNHASDDEHLRKEGQHGREIEESESLQKRLEIELREKALE  872

Query  189  SLRAKKSIGH  160
            SLRAKK + H
Sbjct  873  SLRAKKGVSH  882


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  789  HRGSHVAKKDRESLDLESPKADEKNLSRLNAIQGEDQPVEAKHLHETSRKVEDVEQIIYK  610
            HR SH  K+ +ES D ES KAD++NLS  N  +G++  VE++    +S+KVE  +    +
Sbjct  677  HRHSHSVKRLKESYDGESVKADKENLSHTNDTKGKELHVESEAPLTSSKKVEQNDLSSNE  736

Query  609  NSGSEECDKRRSRVKEKRKHKRSVRHE  529
             SG EE +KRR+++K+KRKHKRS R+E
Sbjct  737  GSGFEESEKRRAKIKDKRKHKRSDRYE  763



>ref|XP_010326174.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Solanum lycopersicum]
Length=897

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  363  KQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEF-HGREIEGTDSA-KKLEIELREKALE  190
            K+K KS NAISSPSD E+  +   SD++  R+E+ HG +IE ++S  K+LEIELREKALE
Sbjct  828  KRKSKSVNAISSPSDTERNPNNRASDDEHLREEYQHGCKIEESESLQKRLEIELREKALE  887

Query  189  SLRAKKSIGH  160
            SLRAKK + H
Sbjct  888  SLRAKKGVSH  897


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  789  HRGSHVAKKDRESLDLESPKADEKNLSRLNAIQGEDQPVEAKHLHETSRKVEDVEQIIYK  610
            HR SH  K+ +ES D ES KAD++NLS  N  +G++  VE++    +S+KVE  +    +
Sbjct  692  HRHSHSVKRLKESYDGESVKADKENLSHTNDTKGKELYVESEAPLTSSKKVEQNDLSSKE  751

Query  609  NSGSEECDKRRSRVKEKRKHKRSVRHE  529
             SG EE +KRR+++K+KRKHKRS R+E
Sbjct  752  GSGFEESEKRRAKIKDKRKHKRSDRYE  778



>ref|XP_004246955.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Solanum lycopersicum]
Length=921

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  363  KQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEF-HGREIEGTDSA-KKLEIELREKALE  190
            K+K KS NAISSPSD E+  +   SD++  R+E+ HG +IE ++S  K+LEIELREKALE
Sbjct  852  KRKSKSVNAISSPSDTERNPNNRASDDEHLREEYQHGCKIEESESLQKRLEIELREKALE  911

Query  189  SLRAKKSIGH  160
            SLRAKK + H
Sbjct  912  SLRAKKGVSH  921


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  789  HRGSHVAKKDRESLDLESPKADEKNLSRLNAIQGEDQPVEAKHLHETSRKVEDVEQIIYK  610
            HR SH  K+ +ES D ES KAD++NLS  N  +G++  VE++    +S+KVE  +    +
Sbjct  716  HRHSHSVKRLKESYDGESVKADKENLSHTNDTKGKELYVESEAPLTSSKKVEQNDLSSKE  775

Query  609  NSGSEECDKRRSRVKEKRKHKRSVRHE  529
             SG EE +KRR+++K+KRKHKRS R+E
Sbjct  776  GSGFEESEKRRAKIKDKRKHKRSDRYE  802



>ref|XP_010326175.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Solanum lycopersicum]
Length=621

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  363  KQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEF-HGREIEGTDSA-KKLEIELREKALE  190
            K+K KS NAISSPSD E+  +   SD++  R+E+ HG +IE ++S  K+LEIELREKALE
Sbjct  552  KRKSKSVNAISSPSDTERNPNNRASDDEHLREEYQHGCKIEESESLQKRLEIELREKALE  611

Query  189  SLRAKKSIGH  160
            SLRAKK + H
Sbjct  612  SLRAKKGVSH  621


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -3

Query  789  HRGSHVAKKDRESLDLESPKADEKNLSRLNAIQGEDQPVEAKHLHETSRKVEDVEQIIYK  610
            HR SH  K+ +ES D ES KAD++NLS  N  +G++  VE++    +S+KVE  +    +
Sbjct  416  HRHSHSVKRLKESYDGESVKADKENLSHTNDTKGKELYVESEAPLTSSKKVEQNDLSSKE  475

Query  609  NSGSEECDKRRSRVKEKRKHKRSVRHE  529
             SG EE +KRR+++K+KRKHKRS R+E
Sbjct  476  GSGFEESEKRRAKIKDKRKHKRSDRYE  502



>ref|XP_008801616.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801617.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801618.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
Length=874

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDLA-RKEFHGREIEGTDS-AKKLEIELREK  199
            AGK K+KS + ++ PSD EK  ND + S++D A  K  H  +IE T+S  KKLEIELREK
Sbjct  802  AGKHKVKSVDTVTPPSDLEKIYNDADGSNDDGAIGKHPHQGDIEETESEQKKLEIELREK  861

Query  198  ALESLRAKKSIGH  160
            ALESLRAKK+I H
Sbjct  862  ALESLRAKKAISH  874



>ref|XP_008801619.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Phoenix dactylifera]
Length=868

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDLA-RKEFHGREIEGTDS-AKKLEIELREK  199
            AGK K+KS + ++ PSD EK  ND + S++D A  K  H  +IE T+S  KKLEIELREK
Sbjct  796  AGKHKVKSVDTVTPPSDLEKIYNDADGSNDDGAIGKHPHQGDIEETESEQKKLEIELREK  855

Query  198  ALESLRAKKSIGH  160
            ALESLRAKK+I H
Sbjct  856  ALESLRAKKAISH  868



>ref|XP_009612859.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Nicotiana 
tomentosiformis]
Length=873

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -3

Query  789  HRGSHVAKKDRESLDLESPKADEKNLSRLNAIQGEDQPVEAKHLHETSRKVEDVEQIIYK  610
            HR SH  K++RES   ES KA+++NLS  N I+G++  +E++    +SRK E  +Q    
Sbjct  674  HRHSHSVKRERESYAGESFKAEKENLSHANYIKGKEL-LESETPLTSSRKAEQNDQSGDD  732

Query  609  NSGSEECDKRRSRVKEKRKHKRSVRHE  529
             SGSEE +KRR++VKEKRKHKRS ++E
Sbjct  733  GSGSEESEKRRAKVKEKRKHKRSGKYE  759


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 5/71 (7%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSA-KKLEIELREKAL  193
            A K KLKS NA+SSPSD E+  D + S ++  RK     ++E ++S  K+LEIELREKAL
Sbjct  807  AQKLKLKSANAMSSPSDTERNPDCHASYDEHLRKG----DVEESESVQKRLEIELREKAL  862

Query  192  ESLRAKKSIGH  160
            ESLRAKK I H
Sbjct  863  ESLRAKKGISH  873



>ref|XP_010937571.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Elaeis guineensis]
Length=911

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDLA-RKEFHGREIEGTDSAKK-LEIELREK  199
             GK K+KS + ++ PSD EK  ND + SD D A RK  H  + E T+S +K LEIELREK
Sbjct  839  VGKLKVKSVDTVTPPSDLEKNHNDADESDGDAAIRKGSHLSDTEETESERKQLEIELREK  898

Query  198  ALESLRAKKSIGH  160
            ALESLRAKKSI H
Sbjct  899  ALESLRAKKSINH  911



>ref|XP_010937572.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Elaeis guineensis]
Length=876

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDLA-RKEFHGREIEGTDSAKK-LEIELREK  199
             GK K+KS + ++ PSD EK  ND + SD D A RK  H  + E T+S +K LEIELREK
Sbjct  804  VGKLKVKSVDTVTPPSDLEKNHNDADESDGDAAIRKGSHLSDTEETESERKQLEIELREK  863

Query  198  ALESLRAKKSIGH  160
            ALESLRAKKSI H
Sbjct  864  ALESLRAKKSINH  876



>ref|XP_010920514.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010920515.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Elaeis guineensis]
Length=876

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDLA-RKEFHGREIEGTDS-AKKLEIELREK  199
            AGK+K+KS + ++ PSD EK  +D + SD D A RK  H  + E T+S  KKLEIELREK
Sbjct  804  AGKRKVKSVDTVTPPSDLEKNYHDADESDGDGAIRKHPHPGDAEETESEQKKLEIELREK  863

Query  198  ALESLRAKKSIGH  160
            ALESLRAKK+I H
Sbjct  864  ALESLRAKKAINH  876



>ref|XP_010920517.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Elaeis guineensis]
Length=774

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDLA-RKEFHGREIEGTDS-AKKLEIELREK  199
            AGK+K+KS + ++ PSD EK  +D + SD D A RK  H  + E T+S  KKLEIELREK
Sbjct  702  AGKRKVKSVDTVTPPSDLEKNYHDADESDGDGAIRKHPHPGDAEETESEQKKLEIELREK  761

Query  198  ALESLRAKKSIGH  160
            ALESLRAKK+I H
Sbjct  762  ALESLRAKKAINH  774



>ref|XP_008803113.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Phoenix dactylifera]
Length=875

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 49/73 (67%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDLA-RKEFHGREIEGTD-SAKKLEIELREK  199
            AGK K+KS + ++ PSD EK  ND + SD D A RK  H    E T    KKLEIELREK
Sbjct  803  AGKLKVKSIDTVTPPSDLEKNHNDADESDGDAAIRKGPHLSYTEETLLEQKKLEIELREK  862

Query  198  ALESLRAKKSIGH  160
            ALESLRAKK+I H
Sbjct  863  ALESLRAKKAINH  875



>ref|XP_008803112.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Phoenix dactylifera]
Length=896

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 49/73 (67%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDLA-RKEFHGREIEGTD-SAKKLEIELREK  199
            AGK K+KS + ++ PSD EK  ND + SD D A RK  H    E T    KKLEIELREK
Sbjct  824  AGKLKVKSIDTVTPPSDLEKNHNDADESDGDAAIRKGPHLSYTEETLLEQKKLEIELREK  883

Query  198  ALESLRAKKSIGH  160
            ALESLRAKK+I H
Sbjct  884  ALESLRAKKAINH  896



>ref|XP_009789294.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Nicotiana 
sylvestris]
Length=873

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 5/71 (7%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSA-KKLEIELREKAL  193
            A K K KS NA+SSPSD E+  D + S ++  RK     ++E ++S  K+LEIELREKAL
Sbjct  807  AQKLKSKSANAMSSPSDTERNPDCHASYDEHLRKG----DVEESESMQKRLEIELREKAL  862

Query  192  ESLRAKKSIGH  160
            ESLRAKK I H
Sbjct  863  ESLRAKKGISH  873


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = -3

Query  771  AKKDRESLDLESPKADEKNLSRLNAIQGEDQPVEAKHLHETSRKVEDVEQIIYKNSGSEE  592
             K++RES   ES KA+++ LS  N I+G++  +E++    +SRKVE  +Q   + S SEE
Sbjct  680  VKRERESYAGESFKAEKEYLSHANYIKGKEL-LESETPLTSSRKVEQNDQSGDEGSASEE  738

Query  591  CDKRRSRVKEKRKHKRS  541
             +KRR++VKEKRKHKRS
Sbjct  739  SEKRRAKVKEKRKHKRS  755



>ref|XP_010256833.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=919

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDL-ARKEFHGREIEGTDS-AKKLEIELREK  199
            A K K KS + ++ PSD EK  NDGN SD++   R+E H    + T+S  KKLEIELR+K
Sbjct  847  AAKLKAKSMDTVTPPSDFEKNRNDGNDSDDEADLRRESHPCGADDTESEQKKLEIELRKK  906

Query  198  ALESLRAKKSIGH  160
            ALESLRAKK I +
Sbjct  907  ALESLRAKKGINN  919



>ref|XP_010256831.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=925

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 3/73 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKT-NDGNVSDEDL-ARKEFHGREIEGTDS-AKKLEIELREK  199
            A K K KS + ++ PSD EK  NDGN SD++   R+E H    + T+S  KKLEIELR+K
Sbjct  853  AAKLKAKSMDTVTPPSDFEKNRNDGNDSDDEADLRRESHPCGADDTESEQKKLEIELRKK  912

Query  198  ALESLRAKKSIGH  160
            ALESLRAKK I +
Sbjct  913  ALESLRAKKGINN  925



>ref|XP_009419742.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=838

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSA-KKLEIELREKAL  193
            A K K+KS + ++ P D EK + G    E   +      + EGT+S  K+LEIELREKAL
Sbjct  768  AEKLKVKSIDTVTPPPDFEKYDYGKSDGEASIKTTSRLADAEGTESEEKRLEIELREKAL  827

Query  192  ESLRAKKSIGH  160
            ESLRAKK IGH
Sbjct  828  ESLRAKKGIGH  838



>ref|NP_001159323.1| hypothetical protein [Zea mays]
 gb|ACN25796.1| unknown [Zea mays]
Length=191

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSAKKLEIELREKALE  190
            A K+KLK+ + ++ PSD+EK  D + SD D+ RK       E +D  KKLEIELREKALE
Sbjct  125  ASKRKLKNTDTVTMPSDSEKDRDSD-SDGDV-RKRVSNAGREESD-QKKLEIELREKALE  181

Query  189  SLRAKKSIGH  160
            SLRAKK+I +
Sbjct  182  SLRAKKAINN  191



>ref|XP_008681498.1| PREDICTED: uncharacterized protein LOC100304415 isoform X2 [Zea 
mays]
 tpg|DAA44608.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=901

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSAKKLEIELREKALE  190
            A K+KLK+ + ++ PSD+EK  D + SD D+ RK       E +D  KKLEIELREKALE
Sbjct  835  ASKRKLKNTDTVTMPSDSEKDRDSD-SDGDV-RKRVSNAGREESD-QKKLEIELREKALE  891

Query  189  SLRAKKSIGH  160
            SLRAKK+I +
Sbjct  892  SLRAKKAINN  901



>ref|XP_008681507.1| PREDICTED: uncharacterized protein LOC100304415 isoform X4 [Zea 
mays]
 tpg|DAA44609.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=895

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSAKKLEIELREKALE  190
            A K+KLK+ + ++ PSD+EK  D + SD D+ RK       E +D  KKLEIELREKALE
Sbjct  829  ASKRKLKNTDTVTMPSDSEKDRDSD-SDGDV-RKRVSNAGREESD-QKKLEIELREKALE  885

Query  189  SLRAKKSIGH  160
            SLRAKK+I +
Sbjct  886  SLRAKKAINN  895



>ref|XP_008681486.1| PREDICTED: uncharacterized protein LOC100304415 isoform X1 [Zea 
mays]
Length=906

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSAKKLEIELREKALE  190
            A K+KLK+ + ++ PSD+EK  D + SD D+ RK       E +D  KKLEIELREKALE
Sbjct  840  ASKRKLKNTDTVTMPSDSEKDRDSD-SDGDV-RKRVSNAGREESD-QKKLEIELREKALE  896

Query  189  SLRAKKSIGH  160
            SLRAKK+I +
Sbjct  897  SLRAKKAINN  906



>ref|XP_008681504.1| PREDICTED: uncharacterized protein LOC100304415 isoform X3 [Zea 
mays]
Length=900

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSAKKLEIELREKALE  190
            A K+KLK+ + ++ PSD+EK  D + SD D+ RK       E +D  KKLEIELREKALE
Sbjct  834  ASKRKLKNTDTVTMPSDSEKDRDSD-SDGDV-RKRVSNAGREESD-QKKLEIELREKALE  890

Query  189  SLRAKKSIGH  160
            SLRAKK+I +
Sbjct  891  SLRAKKAINN  900



>tpg|DAA44606.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=340

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSAKKLEIELREKALE  190
            A K+KLK+ + ++ PSD+EK  D + SD D+ RK       E +D  KKLEIELREKALE
Sbjct  274  ASKRKLKNTDTVTMPSDSEKDRDSD-SDGDV-RKRVSNAGREESD-QKKLEIELREKALE  330

Query  189  SLRAKKSI  166
            SLRAKK+I
Sbjct  331  SLRAKKAI  338



>ref|XP_006649830.1| PREDICTED: transcriptional regulator ATRX homolog isoform X1 
[Oryza brachyantha]
Length=388

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = -3

Query  369  AGKQKLKSDNAISSPSDAEKTNDGNVSDEDLARKEFHGREIEGTDSAKKLEIELREKALE  190
            A K KLK    +   SDAEK +D + SD D+ +K  +  + E     +KLEIELREKALE
Sbjct  322  ASKLKLKHAETVDMDSDAEKDHDSD-SDADVRKKGLYTGKEES--DQQKLEIELREKALE  378

Query  189  SLRAKKSIGH  160
            SLRAKK+I H
Sbjct  379  SLRAKKAINH  388



>ref|XP_002280607.2| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Vitis vinifera]
Length=922

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = -3

Query  357  KLKSDNAISSPSDAEKT-NDGNVSD-EDLARKEFHGREIEGTDSA-KKLEIELREKALES  187
            K KS + ++ PSD +K  +D  VSD E  +R+E H  E E  +S  KKLEIELR+KALES
Sbjct  854  KGKSRDTVTPPSDFDKNQSDAYVSDGEHASRREPHSSESEEAESEQKKLEIELRKKALES  913

Query  186  LRAKKSIGH  160
            LRAK+ +GH
Sbjct  914  LRAKRGVGH  922



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570