BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF001L13

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03876.1|  unnamed protein product                                339   6e-115   Coffea canephora [robusta coffee]
ref|XP_006349931.1|  PREDICTED: 60S ribosomal protein L13a-4-like       339   6e-115   Solanum tuberosum [potatoes]
ref|XP_009596414.1|  PREDICTED: 60S ribosomal protein L13a-4            338   1e-114   Nicotiana tomentosiformis
ref|XP_009795999.1|  PREDICTED: 60S ribosomal protein L13a-4-like       338   1e-114   Nicotiana sylvestris
ref|NP_001275476.1|  60S ribosomal protein L13a-4-like                  338   1e-114   Solanum tuberosum [potatoes]
ref|XP_009622553.1|  PREDICTED: 60S ribosomal protein L13a-4-like       338   1e-114   Nicotiana tomentosiformis
gb|AHE13806.1|  ribosomal protein L13a                                  338   2e-114   Solanum torvum [berenjena cimarrona]
ref|XP_004252998.1|  PREDICTED: 60S ribosomal protein L13a-4            338   2e-114   Solanum lycopersicum
ref|XP_009789164.1|  PREDICTED: 60S ribosomal protein L13a-1            337   2e-114   Nicotiana sylvestris
ref|XP_004239861.1|  PREDICTED: 60S ribosomal protein L13a-4-like       337   3e-114   Solanum lycopersicum
ref|XP_010488596.1|  PREDICTED: 60S ribosomal protein L13a-2            336   7e-114   Camelina sativa [gold-of-pleasure]
ref|XP_011073788.1|  PREDICTED: 60S ribosomal protein L13a-4            336   7e-114   Sesamum indicum [beniseed]
ref|XP_009765513.1|  PREDICTED: 60S ribosomal protein L13a-4            336   1e-113   Nicotiana sylvestris
ref|XP_006298559.1|  hypothetical protein CARUB_v10014643mg             336   1e-113   Capsella rubella
ref|XP_010466918.1|  PREDICTED: 60S ribosomal protein L13a-2-like       335   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_002267491.1|  PREDICTED: 60S ribosomal protein L13a-4            334   3e-113   Vitis vinifera
ref|XP_009625303.1|  PREDICTED: 60S ribosomal protein L13a-4-like       334   4e-113   Nicotiana tomentosiformis
gb|EYU32659.1|  hypothetical protein MIMGU_mgv1a013922mg                334   5e-113   Erythranthe guttata [common monkey flower]
ref|XP_004247847.1|  PREDICTED: 60S ribosomal protein L13a-4            334   5e-113   Solanum lycopersicum
ref|NP_189127.1|  60S ribosomal protein L13a-2                          334   6e-113   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31410.1|  hypothetical protein MIMGU_mgv1a013934mg                333   8e-113   Erythranthe guttata [common monkey flower]
gb|AAL87341.1|  putative 60S ribosomal protein                          333   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010277234.1|  PREDICTED: 60S ribosomal protein L13a-4            333   1e-112   Nelumbo nucifera [Indian lotus]
ref|XP_010279449.1|  PREDICTED: 60S ribosomal protein L13a-4-like       333   2e-112   Nelumbo nucifera [Indian lotus]
ref|XP_002883564.1|  60S ribosomal protein L13A                         332   3e-112   Arabidopsis lyrata subsp. lyrata
ref|XP_009136093.1|  PREDICTED: 60S ribosomal protein L13a-2            332   3e-112   Brassica rapa
ref|XP_011091425.1|  PREDICTED: 60S ribosomal protein L13a-4-like       332   4e-112   Sesamum indicum [beniseed]
ref|XP_010920859.1|  PREDICTED: 60S ribosomal protein L13a-4-like       332   5e-112   Elaeis guineensis
gb|ADR71263.1|  60S ribosomal protein L13aA                             331   6e-112   Hevea brasiliensis [jebe]
ref|XP_010440660.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    331   8e-112   Camelina sativa [gold-of-pleasure]
ref|XP_007223449.1|  hypothetical protein PRUPE_ppa011551mg             331   9e-112   Prunus persica
gb|KHG07795.1|  60S ribosomal L13a-4 -like protein                      330   1e-111   Gossypium arboreum [tree cotton]
ref|XP_010439646.1|  PREDICTED: 60S ribosomal protein L13a-4            330   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010524687.1|  PREDICTED: 60S ribosomal protein L13a-1            330   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_010069656.1|  PREDICTED: 60S ribosomal protein L13a-2            330   2e-111   Eucalyptus grandis [rose gum]
gb|ACJ02350.1|  60S ribosomal protein L13A                              330   2e-111   Vernicia fordii [tung oil tree]
ref|XP_010937848.1|  PREDICTED: 60S ribosomal protein L13a-4            330   2e-111   Elaeis guineensis
ref|XP_010552053.1|  PREDICTED: 60S ribosomal protein L13a-2-like       330   3e-111   Tarenaya hassleriana [spider flower]
ref|XP_002865669.1|  60S ribosomal protein L13A                         330   3e-111   
ref|XP_002518107.1|  60S ribosomal protein L13a, putative               329   3e-111   Ricinus communis
ref|XP_009112682.1|  PREDICTED: 60S ribosomal protein L13a-2-like       329   4e-111   Brassica rapa
gb|KFK38165.1|  hypothetical protein AALP_AA3G077500                    329   4e-111   Arabis alpina [alpine rockcress]
gb|KDP39375.1|  hypothetical protein JCGZ_01132                         329   4e-111   Jatropha curcas
ref|NP_193053.1|  60S ribosomal protein L13a-3                          329   5e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52083.1|  BnaCnng21840D                                          328   7e-111   Brassica napus [oilseed rape]
ref|XP_010245584.1|  PREDICTED: 60S ribosomal protein L13a-4-like       328   7e-111   Nelumbo nucifera [Indian lotus]
ref|XP_006281111.1|  hypothetical protein CARUB_v10027141mg             328   7e-111   Capsella rubella
ref|XP_008789105.1|  PREDICTED: 60S ribosomal protein L13a-4-like       328   7e-111   Phoenix dactylifera
ref|XP_009392721.1|  PREDICTED: 60S ribosomal protein L13a-4-like       328   8e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010482144.1|  PREDICTED: 60S ribosomal protein L13a-4-like       328   8e-111   Camelina sativa [gold-of-pleasure]
ref|XP_007049776.1|  Ribosomal protein L13 family protein               328   8e-111   Theobroma cacao [chocolate]
ref|NP_187367.1|  60S ribosomal protein L13a-1                          328   9e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199687.1|  60S ribosomal protein L13a-4                          328   9e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407868.1|  hypothetical protein EUTSA_v10021532mg             328   9e-111   Eutrema salsugineum [saltwater cress]
gb|KJB30129.1|  hypothetical protein B456_005G130900                    328   1e-110   Gossypium raimondii
ref|XP_010069043.1|  PREDICTED: 60S ribosomal protein L13a-3            328   1e-110   Eucalyptus grandis [rose gum]
ref|XP_010464292.1|  PREDICTED: 60S ribosomal protein L13a-1-like       328   1e-110   Camelina sativa [gold-of-pleasure]
ref|XP_004154637.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    328   1e-110   
ref|XP_009404653.1|  PREDICTED: 60S ribosomal protein L13a-4-like       328   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009374600.1|  PREDICTED: 60S ribosomal protein L13a-4            328   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_004138959.1|  PREDICTED: 60S ribosomal protein L13a-4-like       328   1e-110   
ref|XP_009111853.1|  PREDICTED: 60S ribosomal protein L13a-4            328   1e-110   Brassica rapa
ref|XP_006298567.1|  hypothetical protein CARUB_v10014649mg             327   2e-110   Capsella rubella
ref|XP_002863167.1|  predicted protein                                  327   2e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_010448678.1|  PREDICTED: 60S ribosomal protein L13a-1            327   2e-110   Camelina sativa [gold-of-pleasure]
ref|XP_004154636.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    329   2e-110   
ref|XP_009102457.1|  PREDICTED: 60S ribosomal protein L13a-2-like       327   2e-110   Brassica rapa
ref|XP_004133995.1|  PREDICTED: 60S ribosomal protein L13a-2-like       327   2e-110   Cucumis sativus [cucumbers]
ref|XP_008356990.1|  PREDICTED: 60S ribosomal protein L13a-4            327   2e-110   Malus domestica [apple tree]
ref|XP_008793237.1|  PREDICTED: 60S ribosomal protein L13a-4            327   2e-110   Phoenix dactylifera
gb|KHG08426.1|  60S ribosomal L13a-4 -like protein                      327   2e-110   Gossypium arboreum [tree cotton]
ref|XP_009403869.1|  PREDICTED: 60S ribosomal protein L13a-4-like       327   2e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006418685.1|  hypothetical protein EUTSA_v10002667mg             327   3e-110   Eutrema salsugineum [saltwater cress]
emb|CDY33947.1|  BnaA02g30400D                                          327   3e-110   Brassica napus [oilseed rape]
ref|XP_006284504.1|  hypothetical protein CARUB_v10005705mg             327   3e-110   
ref|XP_009421391.1|  PREDICTED: 60S ribosomal protein L13a-4            327   4e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395114.1|  hypothetical protein EUTSA_v10004924mg             327   5e-110   Eutrema salsugineum [saltwater cress]
ref|XP_009129745.1|  PREDICTED: 60S ribosomal protein L13a-4-like       326   6e-110   Brassica rapa
ref|XP_007034382.1|  Ribosomal protein L13 family protein isoform 1     326   6e-110   
gb|KHG26825.1|  60S ribosomal L13a-4 -like protein                      326   7e-110   Gossypium arboreum [tree cotton]
gb|KHG16481.1|  60S ribosomal L13a-4 -like protein                      326   7e-110   Gossypium arboreum [tree cotton]
gb|KFK39801.1|  hypothetical protein AALP_AA3G289800                    326   7e-110   Arabis alpina [alpine rockcress]
gb|KFK39804.1|  hypothetical protein AALP_AA3G290300                    326   8e-110   Arabis alpina [alpine rockcress]
ref|XP_008348430.1|  PREDICTED: 60S ribosomal protein L13a-4            326   9e-110   Malus domestica [apple tree]
ref|XP_009405822.1|  PREDICTED: 60S ribosomal protein L13a-4-like       325   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268901.1|  PREDICTED: 60S ribosomal protein L13a-4            325   1e-109   Vitis vinifera
ref|XP_006840139.1|  hypothetical protein AMTR_s00089p00040540          325   1e-109   Amborella trichopoda
ref|XP_009151676.1|  PREDICTED: 60S ribosomal protein L13a-4            325   2e-109   Brassica rapa
gb|KJB72096.1|  hypothetical protein B456_011G159000                    325   2e-109   Gossypium raimondii
ref|XP_006420899.1|  hypothetical protein CICLE_v10005900mg             325   2e-109   Citrus clementina [clementine]
ref|XP_004288082.1|  PREDICTED: 60S ribosomal protein L13a-4            325   2e-109   Fragaria vesca subsp. vesca
ref|XP_010532891.1|  PREDICTED: 60S ribosomal protein L13a-2-like       324   3e-109   Tarenaya hassleriana [spider flower]
ref|XP_010110069.1|  60S ribosomal protein L13a-3                       324   3e-109   Morus notabilis
ref|XP_002521095.1|  60S ribosomal protein L13a, putative               324   5e-109   Ricinus communis
ref|XP_004297119.1|  PREDICTED: 60S ribosomal protein L13a-4-like       324   5e-109   Fragaria vesca subsp. vesca
ref|NP_001030654.1|  60S ribosomal protein L13a-1                       323   7e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KJB42469.1|  hypothetical protein B456_007G154600                    323   7e-109   Gossypium raimondii
ref|XP_011045655.1|  PREDICTED: 60S ribosomal protein L13a-2            323   1e-108   Populus euphratica
ref|XP_010937601.1|  PREDICTED: 60S ribosomal protein L13a-2-like       323   1e-108   Elaeis guineensis
ref|XP_006369799.1|  60S ribosomal protein L13a-2                       323   1e-108   Populus trichocarpa [western balsam poplar]
ref|XP_002882511.1|  structural constituent of ribosome                 322   2e-108   
gb|EPS58218.1|  hypothetical protein M569_16597                         322   2e-108   Genlisea aurea
gb|KJB10146.1|  hypothetical protein B456_001G186700                    322   2e-108   Gossypium raimondii
ref|XP_010023711.1|  PREDICTED: 60S ribosomal protein L13a-4-like       322   2e-108   Eucalyptus grandis [rose gum]
gb|AFK44939.1|  unknown                                                 322   2e-108   Lotus japonicus
ref|XP_008786013.1|  PREDICTED: 60S ribosomal protein L13a-4-like       322   3e-108   Phoenix dactylifera
ref|XP_010435310.1|  PREDICTED: 60S ribosomal protein L13a-3-like       322   3e-108   Camelina sativa [gold-of-pleasure]
gb|KHF97469.1|  60S ribosomal L13a-4 -like protein                      322   4e-108   Gossypium arboreum [tree cotton]
ref|XP_010923627.1|  PREDICTED: 60S ribosomal protein L13a-2-like       323   5e-108   Elaeis guineensis
ref|XP_006650608.1|  PREDICTED: 60S ribosomal protein L13a-4-like       320   1e-107   Oryza brachyantha
gb|KDO61166.1|  hypothetical protein CISIN_1g028623mg                   320   2e-107   Citrus sinensis [apfelsine]
ref|XP_010527234.1|  PREDICTED: 60S ribosomal protein L13a-2-like       320   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_002323772.1|  ribosomal protein L13a                             320   2e-107   Populus trichocarpa [western balsam poplar]
ref|XP_010513787.1|  PREDICTED: 60S ribosomal protein L13a-2-like       320   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006479280.1|  PREDICTED: 60S ribosomal protein L13a-4-like       319   3e-107   Citrus sinensis [apfelsine]
ref|NP_001130808.1|  uncharacterized protein LOC100191912               319   4e-107   
ref|XP_003559332.1|  PREDICTED: 60S ribosomal protein L13a-4            318   8e-107   Brachypodium distachyon [annual false brome]
gb|KHG00254.1|  60S ribosomal L13a-4 -like protein                      317   2e-106   Gossypium arboreum [tree cotton]
gb|ACF79169.1|  unknown                                                 317   3e-106   Zea mays [maize]
gb|KHN31417.1|  60S ribosomal protein L13a-4                            316   6e-106   Glycine soja [wild soybean]
ref|XP_002439183.1|  hypothetical protein SORBIDRAFT_09g001930          316   7e-106   Sorghum bicolor [broomcorn]
ref|XP_008805147.1|  PREDICTED: 60S ribosomal protein L13a-2-like       316   7e-106   Phoenix dactylifera
ref|XP_007200528.1|  hypothetical protein PRUPE_ppa011553mg             316   7e-106   Prunus persica
ref|XP_002466431.1|  hypothetical protein SORBIDRAFT_01g007690          316   8e-106   Sorghum bicolor [broomcorn]
ref|XP_011041875.1|  PREDICTED: 60S ribosomal protein L13a-1-like       316   8e-106   Populus euphratica
ref|NP_001051314.1|  Os03g0756000                                       315   9e-106   
ref|NP_001235102.1|  uncharacterized protein LOC100499978               315   1e-105   Glycine max [soybeans]
ref|NP_001281205.1|  60S ribosomal protein L13a                         315   1e-105   Zea mays [maize]
ref|XP_004981725.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    315   2e-105   Setaria italica
gb|KDP26388.1|  hypothetical protein JCGZ_17546                         315   2e-105   Jatropha curcas
ref|NP_001276138.1|  60S ribosomal protein L13a-4-like                  315   2e-105   
ref|XP_004499225.1|  PREDICTED: 60S ribosomal protein L13a-4-like       314   4e-105   Cicer arietinum [garbanzo]
ref|XP_006586250.1|  PREDICTED: 60S ribosomal protein L13a-4-like       314   4e-105   Glycine max [soybeans]
ref|XP_010547080.1|  PREDICTED: 60S ribosomal protein L13a-1            313   5e-105   Tarenaya hassleriana [spider flower]
ref|XP_010685006.1|  PREDICTED: 60S ribosomal protein L13a-2            313   6e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003616742.1|  60S ribosomal protein L13A                         313   6e-105   Medicago truncatula
pdb|3J61|O  Chain O, Localization Of The Large Subunit Ribosomal ...    313   8e-105   Triticum aestivum [Canadian hard winter wheat]
gb|ACG36118.1|  60S ribosomal protein L13a                              313   9e-105   Zea mays [maize]
ref|XP_011024678.1|  PREDICTED: 60S ribosomal protein L13a-4-like       313   1e-104   Populus euphratica
ref|XP_007140600.1|  hypothetical protein PHAVU_008G125900g             312   2e-104   Phaseolus vulgaris [French bean]
ref|XP_008235481.1|  PREDICTED: 60S ribosomal protein L13a-1-like       312   2e-104   Prunus mume [ume]
gb|AFK34830.1|  unknown                                                 312   2e-104   Medicago truncatula
gb|ACG33474.1|  60S ribosomal protein L13a                              311   3e-104   Zea mays [maize]
gb|AAR89618.1|  60S ribosomal protein L13a                              312   4e-104   Capsicum annuum
ref|XP_002301785.2|  ribosomal protein L13a                             311   6e-104   
ref|XP_006443602.1|  hypothetical protein CICLE_v10023466mg             317   7e-104   
gb|KCW58066.1|  hypothetical protein EUGRSUZ_H00799                     312   8e-104   Eucalyptus grandis [rose gum]
ref|XP_007147486.1|  hypothetical protein PHAVU_006G128500g             310   2e-103   Phaseolus vulgaris [French bean]
ref|NP_001058724.1|  Os07g0109500                                       310   2e-103   
ref|XP_003546257.1|  PREDICTED: 60S ribosomal protein L13a-4-like       310   2e-103   Glycine max [soybeans]
gb|KHN07182.1|  60S ribosomal protein L13a-1                            309   3e-103   Glycine soja [wild soybean]
gb|ABQ57364.1|  ribosomal protein L13A                                  308   5e-103   Lupinus luteus
ref|NP_001236202.1|  uncharacterized protein LOC100527190               308   7e-103   Glycine max [soybeans]
ref|XP_010228462.1|  PREDICTED: 60S ribosomal protein L13a-4-like       308   7e-103   Brachypodium distachyon [annual false brome]
ref|XP_009334926.1|  PREDICTED: 60S ribosomal protein L13a-1-like       307   2e-102   Pyrus x bretschneideri [bai li]
ref|XP_008365936.1|  PREDICTED: 60S ribosomal protein L13a-1            306   3e-102   
gb|EAZ38446.1|  hypothetical protein OsJ_22825                          306   5e-102   Oryza sativa Japonica Group [Japonica rice]
gb|ACG48503.1|  60S ribosomal protein L13a                              306   5e-102   Zea mays [maize]
gb|ACG37566.1|  60S ribosomal protein L13a                              304   4e-101   Zea mays [maize]
ref|XP_006657401.1|  PREDICTED: 60S ribosomal protein L13a-3-like       301   3e-100   Oryza brachyantha
gb|ACJ83838.1|  unknown                                                 301   6e-100   Medicago truncatula
sp|O49885.1|RL13A_LUPLU  RecName: Full=60S ribosomal protein L13a       300   8e-100   Lupinus luteus
ref|XP_003589380.1|  60S ribosomal protein L13a                         298   9e-99    Medicago truncatula
sp|O65055.1|RL13A_PICMA  RecName: Full=60S ribosomal protein L13a       295   6e-98    Picea mariana [black spruce]
ref|XP_004981724.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    296   2e-97    
dbj|BAK07924.1|  predicted protein                                      295   3e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS52180.1|  60S ribosomal protein L13a-4                            290   2e-95    Triticum urartu
gb|EMT05694.1|  60S ribosomal protein L13a-4                            288   1e-94    
ref|XP_001765352.1|  predicted protein                                  285   1e-93    
ref|XP_001774253.1|  predicted protein                                  285   1e-93    
ref|XP_001763759.1|  predicted protein                                  284   2e-93    
ref|XP_004955326.1|  PREDICTED: 60S ribosomal protein L13a-3-like       283   5e-93    Setaria italica
gb|KGN66498.1|  hypothetical protein Csa_1G615170                       283   7e-93    
gb|ABK22228.1|  unknown                                                 282   1e-92    Picea sitchensis
ref|XP_001765905.1|  predicted protein                                  281   2e-92    
ref|XP_001773626.1|  predicted protein                                  281   3e-92    
gb|AAX92709.1|  60S ribosomal protein L13a                              268   1e-87    Picea abies
ref|XP_002964465.1|  hypothetical protein SELMODRAFT_166650             268   3e-87    Selaginella moellendorffii
emb|CBI37325.3|  unnamed protein product                                265   7e-87    Vitis vinifera
gb|KHN23001.1|  60S ribosomal protein L13a-4                            263   4e-86    Glycine soja [wild soybean]
emb|CDO99456.1|  unnamed protein product                                262   8e-86    Coffea canephora [robusta coffee]
gb|KCW57253.1|  hypothetical protein EUGRSUZ_H00057                     262   3e-85    Eucalyptus grandis [rose gum]
ref|XP_006855707.1|  hypothetical protein AMTR_s00044p00144180          262   4e-85    Amborella trichopoda
ref|XP_007223448.1|  hypothetical protein PRUPE_ppa011551mg             262   5e-85    
gb|KJB72097.1|  hypothetical protein B456_011G159000                    259   5e-84    Gossypium raimondii
gb|AIC33046.1|  60S ribosomal protein L13a                              257   2e-83    Panax ginseng [Asiatic ginseng]
gb|KCW58067.1|  hypothetical protein EUGRSUZ_H00799                     257   2e-83    Eucalyptus grandis [rose gum]
emb|CBI17324.3|  unnamed protein product                                256   3e-83    Vitis vinifera
gb|KJB22645.1|  hypothetical protein B456_004G058600                    256   1e-82    Gossypium raimondii
gb|AFK39539.1|  unknown                                                 253   5e-82    Lotus japonicus
ref|XP_004168353.1|  PREDICTED: 60S ribosomal protein L13a-3-like       251   2e-81    
gb|KDO65929.1|  hypothetical protein CISIN_1g028649mg                   251   5e-81    Citrus sinensis [apfelsine]
gb|ACN36734.1|  unknown                                                 249   3e-80    Zea mays [maize]
ref|XP_010661466.1|  PREDICTED: 60S ribosomal protein L13a-2-like       247   2e-78    Vitis vinifera
ref|XP_008382629.1|  PREDICTED: 60S ribosomal protein L13a-1            237   1e-75    
ref|XP_002953387.1|  component of cytosolic 80S ribosome and 60S ...    231   1e-72    Volvox carteri f. nagariensis
ref|XP_001692909.1|  ribosomal protein L13a, component of cytosol...    228   9e-72    Chlamydomonas reinhardtii
ref|XP_005849945.1|  hypothetical protein CHLNCDRAFT_17540              224   4e-70    Chlorella variabilis
sp|P93099.1|RL13A_CYAPA  RecName: Full=60S ribosomal protein L13a       224   6e-70    Cyanophora paradoxa
ref|XP_001630812.1|  predicted protein                                  224   9e-70    Nematostella vectensis
ref|XP_005643971.1|  ribosomal protein L13a component of cytosoli...    223   2e-69    Coccomyxa subellipsoidea C-169
ref|XP_004349662.1|  ribosomal protein L13, putative                    218   1e-67    Acanthamoeba castellanii str. Neff
ref|XP_008067417.1|  PREDICTED: 60S ribosomal protein L13a              217   5e-67    Carlito syrichta
gb|AAZ38985.1|  60S ribosomal protein L13a                              216   5e-67    Oxyuranus scutellatus
gb|ETE70282.1|  60S ribosomal protein L13a                              216   1e-66    Ophiophagus hannah
ref|XP_004011713.1|  PREDICTED: 60S ribosomal protein L13a-like         215   2e-66    Ovis aries [domestic sheep]
ref|XP_006160205.1|  PREDICTED: 60S ribosomal protein L13a              215   3e-66    Tupaia chinensis
ref|XP_006905093.1|  PREDICTED: 60S ribosomal protein L13a isofor...    214   3e-66    Pteropus alecto
ref|XP_006905092.1|  PREDICTED: 60S ribosomal protein L13a isofor...    214   4e-66    Pteropus alecto
ref|XP_007431701.1|  PREDICTED: 60S ribosomal protein L13a-like         214   4e-66    Python bivittatus
ref|XP_004472671.1|  PREDICTED: 60S ribosomal protein L13a isoform 2    214   4e-66    Dasypus novemcinctus
ref|XP_002723961.2|  PREDICTED: 60S ribosomal protein L13a              214   4e-66    Oryctolagus cuniculus [domestic rabbit]
ref|NP_001070466.1|  60S ribosomal protein L13a                         214   5e-66    Bos taurus [bovine]
gb|ELR49590.1|  60S ribosomal protein L13a                              214   5e-66    Bos mutus
ref|XP_001491926.1|  PREDICTED: 60S ribosomal protein L13a              214   6e-66    Equus caballus [domestic horse]
gb|AAX48846.1|  L13a                                                    213   8e-66    Suberites domuncula
ref|XP_004694340.1|  PREDICTED: 60S ribosomal protein L13a isofor...    213   9e-66    Condylura cristata
ref|XP_003465562.1|  PREDICTED: 60S ribosomal protein L13a isofor...    213   1e-65    Cavia porcellus [guinea pig]
ref|XP_011372842.1|  PREDICTED: 60S ribosomal protein L13a              212   2e-65    Pteropus vampyrus
ref|XP_002762391.1|  PREDICTED: 60S ribosomal protein L13a isofor...    213   2e-65    Callithrix jacchus [common marmoset]
ref|XP_004619892.1|  PREDICTED: 60S ribosomal protein L13a isofor...    213   2e-65    Sorex araneus [Eurasian shrew]
ref|XP_004597042.1|  PREDICTED: 60S ribosomal protein L13a isofor...    213   2e-65    Ochotona princeps [southern American pika]
ref|XP_005879589.1|  PREDICTED: 60S ribosomal protein L13a              213   2e-65    
ref|XP_008843288.1|  PREDICTED: 60S ribosomal protein L13a              213   2e-65    Nannospalax galili
ref|NP_001125810.1|  60S ribosomal protein L13a                         213   2e-65    Pongo abelii [orang utan]
ref|XP_002507247.1|  predicted protein                                  212   2e-65    Micromonas commoda
ref|XP_004672300.1|  PREDICTED: 60S ribosomal protein L13a isofor...    213   2e-65    Jaculus jaculus
ref|XP_003453268.1|  PREDICTED: 60S ribosomal protein L13a-like         213   2e-65    Oreochromis niloticus
gb|EFB23940.1|  hypothetical protein PANDA_006273                       212   2e-65    Ailuropoda melanoleuca
ref|NP_036555.1|  60S ribosomal protein L13a isoform 1                  212   3e-65    Homo sapiens [man]
gb|AAH04900.2|  RPL13A protein                                          212   3e-65    Homo sapiens [man]
ref|XP_004767370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    212   3e-65    Mustela putorius furo [black ferret]
gb|AAQ13495.1|AF109186_1  FWP004                                        212   3e-65    Homo sapiens [man]
ref|XP_007531370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    212   3e-65    Erinaceus europaeus [common hedgehog]
ref|XP_004409938.1|  PREDICTED: 60S ribosomal protein L13a              212   3e-65    Odobenus rosmarus divergens
ref|XP_003226237.1|  PREDICTED: 60S ribosomal protein L13a              212   3e-65    Anolis carolinensis [Carolina anole]
gb|EPQ15989.1|  60S ribosomal protein L13a                              213   3e-65    Myotis brandtii
ref|NP_001291802.1|  ribosomal protein L13a                             212   4e-65    Ailuropoda melanoleuca
ref|XP_005088148.1|  PREDICTED: 60S ribosomal protein L13a isofor...    212   4e-65    Mesocricetus auratus [Syrian golden hamster]
ref|XP_010584802.1|  PREDICTED: 60S ribosomal protein L13a              212   4e-65    Loxodonta africana [African bush elephant]
ref|XP_005412929.1|  PREDICTED: 60S ribosomal protein L13a isofor...    212   4e-65    Chinchilla lanigera
ref|XP_008152577.1|  PREDICTED: 60S ribosomal protein L13a isofor...    212   4e-65    Eptesicus fuscus
ref|XP_008152578.1|  PREDICTED: 60S ribosomal protein L13a isofor...    212   4e-65    Eptesicus fuscus
ref|XP_004381707.1|  PREDICTED: 60S ribosomal protein L13a              212   4e-65    Trichechus manatus latirostris
gb|EWM30220.1|  60s ribosomal protein l13a                              212   4e-65    Nannochloropsis gaditana
ref|XP_004440337.1|  PREDICTED: 60S ribosomal protein L13a isoform 1    212   4e-65    Ceratotherium simum simum [southern square-lipped rhinoceros]
sp|Q4R8Z2.3|RL13A_MACFA  RecName: Full=60S ribosomal protein L13a       212   4e-65    Macaca fascicularis [crab eating macaque]
ref|XP_005001821.1|  PREDICTED: 60S ribosomal protein L13a isofor...    212   4e-65    
ref|NP_001182348.1|  ribosomal protein L13a                             212   5e-65    Macaca mulatta [rhesus macaque]
ref|XP_011287982.1|  PREDICTED: 60S ribosomal protein L13a              212   5e-65    Felis catus [cat]
gb|EHH59787.1|  hypothetical protein EGM_09978                          211   5e-65    Macaca fascicularis [crab eating macaque]
ref|XP_007941028.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   5e-65    Orycteropus afer afer
ref|XP_004472670.1|  PREDICTED: 60S ribosomal protein L13a isoform 1    212   5e-65    
ref|XP_005884578.1|  PREDICTED: 60S ribosomal protein L13a-like         211   5e-65    Myotis brandtii
ref|XP_004646507.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   5e-65    Octodon degus
ref|NP_001230997.1|  ribosomal protein L13a isoform 1                   211   5e-65    Sus scrofa [pigs]
ref|XP_005589974.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   6e-65    Macaca fascicularis [crab eating macaque]
ref|XP_004710493.1|  PREDICTED: 60S ribosomal protein L13a              211   6e-65    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_001507007.1|  PREDICTED: 60S ribosomal protein L13a              211   6e-65    Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001016486.1|  ribosomal protein L13a                             212   6e-65    Xenopus tropicalis [western clawed frog]
ref|XP_006868260.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   6e-65    Chrysochloris asiatica
ref|XP_006173859.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   6e-65    Camelus ferus
ref|XP_005336734.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   6e-65    Ictidomys tridecemlineatus
gb|EHB05652.1|  60S ribosomal protein L13a                              211   6e-65    Heterocephalus glaber [naked mole rat]
ref|XP_006173860.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   6e-65    
ref|NP_001230998.1|  ribosomal protein L13a isoform 2                   211   6e-65    Sus scrofa [pigs]
ref|XP_004540518.1|  PREDICTED: 60S ribosomal protein L13a-like         211   8e-65    Maylandia zebra
ref|XP_005336733.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   8e-65    Ictidomys tridecemlineatus
ref|XP_004579204.1|  PREDICTED: 60S ribosomal protein L13a-like         211   9e-65    Ochotona princeps [southern American pika]
ref|XP_004271087.1|  PREDICTED: 60S ribosomal protein L13a              211   9e-65    Orcinus orca [Orca]
ref|XP_003801534.1|  PREDICTED: 60S ribosomal protein L13a              211   9e-65    Otolemur garnettii
ref|XP_007172851.1|  PREDICTED: 60S ribosomal protein L13a-like         211   1e-64    
ref|XP_008573628.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   2e-64    Galeopterus variegatus [Malayan flying lemur]
ref|NP_001080130.1|  ribosomal protein L13a                             211   2e-64    Xenopus laevis [clawed frog]
ref|XP_006986315.1|  PREDICTED: 60S ribosomal protein L13a              210   2e-64    Peromyscus maniculatus bairdii
ref|XP_006898790.1|  PREDICTED: 60S ribosomal protein L13a              212   2e-64    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EHH30267.1|  hypothetical protein EGK_10889                          210   2e-64    Macaca mulatta [rhesus macaque]
dbj|BAD96467.1|  ribosomal protein L13a variant                         210   2e-64    Homo sapiens [man]
ref|XP_003940403.1|  PREDICTED: 60S ribosomal protein L13a isofor...    210   2e-64    Saimiri boliviensis boliviensis
ref|XP_004625632.1|  PREDICTED: 60S ribosomal protein L13a-like         210   3e-64    
ref|XP_010639023.1|  PREDICTED: 60S ribosomal protein L13a              209   3e-64    
ref|XP_007463424.1|  PREDICTED: 60S ribosomal protein L13a isofor...    209   4e-64    
ref|XP_003962761.1|  PREDICTED: 60S ribosomal protein L13a-like         210   4e-64    
ref|XP_002112893.1|  expressed hypothetical protein                     209   4e-64    
gb|ABY28364.1|  ribosomal protein L13A                                  209   5e-64    
ref|XP_005589973.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   6e-64    
ref|XP_004640903.1|  PREDICTED: 60S ribosomal protein L13a-like         209   6e-64    
ref|XP_003508699.2|  PREDICTED: 60S ribosomal protein L13a isofor...    210   6e-64    
ref|XP_005366879.1|  PREDICTED: 60S ribosomal protein L13a              209   6e-64    
sp|P35427.2|RL13A_RAT  RecName: Full=60S ribosomal protein L13a         209   7e-64    
ref|XP_007531368.1|  PREDICTED: 60S ribosomal protein L13a isofor...    209   7e-64    
ref|NP_775462.2|  60S ribosomal protein L13a                            209   8e-64    
ref|XP_007531369.1|  PREDICTED: 60S ribosomal protein L13a isofor...    209   8e-64    
ref|XP_010733236.1|  PREDICTED: 60S ribosomal protein L13a              209   8e-64    
ref|XP_003384047.1|  PREDICTED: 60S ribosomal protein L13a-like         208   8e-64    
ref|XP_007574193.1|  PREDICTED: 60S ribosomal protein L13a              208   9e-64    
emb|CDQ71669.1|  unnamed protein product                                208   1e-63    
emb|CAK04157.1|  ribosomal protein L13a                                 208   1e-63    
ref|XP_004624823.1|  PREDICTED: 60S ribosomal protein L13a-like         208   1e-63    
ref|XP_005801332.1|  PREDICTED: 60S ribosomal protein L13a-like         208   1e-63    
sp|Q91487.1|RL13A_SALTR  RecName: Full=60S ribosomal protein L13a...    207   1e-63    
emb|CAA35908.1|  tum- transplantation antigen P198                      208   1e-63    
ref|NP_033464.2|  60S ribosomal protein L13a                            208   1e-63    
gb|ESA01198.1|  hypothetical protein GLOINDRAFT_334214                  207   2e-63    
gb|ACH85355.1|  ribosomal protein L13a                                  207   2e-63    
ref|XP_005412928.1|  PREDICTED: 60S ribosomal protein L13a isofor...    208   2e-63    
gb|ACN10380.1|  60S ribosomal protein L13a                              207   2e-63    
pdb|2ZKR|JJ  Chain j, Structure Of A Mammalian Ribosomal 60s Subu...    207   2e-63    
sp|Q9XSU0.2|RL13A_CANFA  RecName: Full=60S ribosomal protein L13a       207   2e-63    
gb|KFM61542.1|  60S ribosomal protein L13a                              207   2e-63    
ref|XP_008398128.1|  PREDICTED: 60S ribosomal protein L13a              207   3e-63    
ref|XP_002741044.1|  PREDICTED: 60S ribosomal protein L13a-like i...    207   3e-63    
gb|EPZ33870.1|  60S ribosomal protein L13a                              207   3e-63    
ref|XP_007623352.1|  PREDICTED: 60S ribosomal protein L13a isofor...    211   3e-63    
ref|XP_004082291.2|  PREDICTED: 60S ribosomal protein L13a              207   5e-63    
ref|XP_010107772.1|  60S ribosomal protein L13a-4                       209   5e-63    
gb|KFH71578.1|  60S ribosomal protein L16-B                             206   5e-63    
ref|XP_004054617.1|  PREDICTED: 60S ribosomal protein L13a-like         206   7e-63    
gb|ACN09948.1|  60S ribosomal protein L13a                              207   8e-63    
ref|XP_003054822.1|  predicted protein                                  206   8e-63    
ref|XP_004881622.1|  PREDICTED: 60S ribosomal protein L13a-like         206   8e-63    
ref|XP_002436282.1|  ribosomal protein L13A, putative                   206   8e-63    
gb|AHA44488.1|  60S ribosomal-like protein                              205   1e-62    
emb|CCQ18645.1|  60S ribosomal protein L13a                             205   1e-62    
ref|NP_997949.1|  60S ribosomal protein L13a                            205   2e-62    
gb|ACI67868.1|  60S ribosomal protein L13a                              205   2e-62    
gb|EUB62915.1|  60S ribosomal protein L13a                              204   3e-62    
gb|ACH85339.1|  ribosomal protein L13a                                  204   3e-62    
ref|XP_006096329.1|  PREDICTED: 60S ribosomal protein L13a-like         204   4e-62    
gb|AAW27674.1|  SJCHGC04249 protein                                     204   4e-62    
gb|ACH48187.1|  60S ribosomal protein L13a                              204   5e-62    
gb|ABX75375.1|  60S ribosomal protein L13A                              203   8e-62    
gb|ABW23219.1|  ribosomal protein rpl13a                                203   8e-62    
gb|AGH70161.1|  60S ribosomal protein L13a                              203   1e-61    
emb|CCD82603.1|  putative 60s ribosomal protein L13a                    203   1e-61    
ref|XP_001555732.1|  60S ribosomal protein L16                          203   1e-61    
ref|XP_005986102.1|  PREDICTED: 60S ribosomal protein L13a-like         203   1e-61    
ref|XP_011112396.1|  hypothetical protein H072_6613                     202   1e-61    
gb|ESZ92305.1|  60S ribosomal protein L16                               202   2e-61    
ref|XP_002480444.1|  60S ribosomal protein L16                          202   2e-61    
gb|AGL33439.1|  60S ribosomal protein L13a                              202   2e-61    
emb|CDS32619.1|  ribosomal protein rpl13a                               202   2e-61    
ref|XP_002558631.1|  Pc13g01870                                         202   2e-61    
ref|XP_007244661.1|  PREDICTED: 60S ribosomal protein L13a-like         202   3e-61    
ref|XP_003257882.1|  PREDICTED: 60S ribosomal protein L13a-like         202   3e-61    
ref|XP_003038672.1|  60S ribosomal protein L16                          202   3e-61    
dbj|BAF98661.1|  ribosomal protein L13a                                 202   3e-61    
ref|XP_004226142.1|  PREDICTED: 60S ribosomal protein L13a-like         202   3e-61    
ref|XP_002144062.1|  60S ribosomal protein L16                          202   3e-61    
ref|XP_006391770.1|  hypothetical protein EUTSA_v10023853mg             199   3e-61    
gb|ADC97464.1|  putative 60S ribosomal protein L13a                     202   3e-61    
gb|ERE70103.1|  fms-related tyrosine kinase 3 ligand-like isoform 1     208   3e-61    
gb|EIE78513.1|  60S ribosomal protein L16                               202   4e-61    
ref|XP_001749344.1|  hypothetical protein                               202   4e-61    
gb|KFH65594.1|  large subunit ribosomal protein L13Ae                   205   4e-61    
emb|CDM33337.1|  60S ribosomal protein L16                              201   5e-61    
ref|XP_005586136.1|  PREDICTED: 60S ribosomal protein L13a-like         201   5e-61    
ref|XP_011125712.1|  hypothetical protein AOL_s00169g53                 201   5e-61    
gb|ERE70104.1|  fms-related tyrosine kinase 3 ligand-like isoform 1     209   5e-61    
ref|XP_001093017.1|  PREDICTED: 60S ribosomal protein L13a-like         201   5e-61    
ref|XP_002590758.1|  hypothetical protein BRAFLDRAFT_280074             201   5e-61    
gb|KEZ46607.1|  hypothetical protein SAPIO_CDS0424                      201   6e-61    
emb|CEG78600.1|  Putative 60S ribosomal protein L16                     201   6e-61    
gb|AFJ24771.1|  60S ribosomal protein L13a                              201   6e-61    
gb|EKV08153.1|  Ribosomal protein L16a                                  201   6e-61    
emb|CEG67074.1|  Putative 60S ribosomal protein L16                     201   7e-61    
ref|XP_006766010.1|  PREDICTED: 60S ribosomal protein L13a              202   8e-61    
ref|XP_002472416.1|  60S ribosomal protein L13a                         201   8e-61    
gb|EPS69081.1|  hypothetical protein M569_05689                         197   8e-61    
gb|AFM88003.1|  60S ribosomal protein L13a                              201   9e-61    
ref|XP_003784550.1|  PREDICTED: 60S ribosomal protein L13a-like i...    201   1e-60    
ref|XP_011394487.1|  60S ribosomal protein L16, variant                 201   1e-60    
gb|EDP55936.1|  ribosomal protein L16a                                  200   1e-60    
emb|CEJ03799.1|  Putative 60S ribosomal protein L16                     200   1e-60    
ref|XP_008000486.1|  PREDICTED: 60S ribosomal protein L13a-like i...    201   1e-60    
ref|XP_006631346.1|  PREDICTED: 60S ribosomal protein L13a-like         200   1e-60    
ref|XP_007379121.1|  ribosomal protein L16a                             200   1e-60    
ref|XP_750349.2|  ribosomal protein L16a                                200   1e-60    
gb|ELR10067.1|  60S ribosomal protein L16                               200   1e-60    
ref|XP_010877924.1|  PREDICTED: 60S ribosomal protein L13a              200   1e-60    
gb|EIE90993.1|  60S ribosomal protein L16                               200   1e-60    
ref|XP_003348078.1|  60S ribosomal protein L16                          200   1e-60    
gb|EQL04215.1|  Ribosomal protein L13, eukaryotic/archaeal              200   2e-60    
emb|CBN08625.1|  small nucleolar RNA, C/D box 32A                       200   2e-60    
ref|XP_009848042.1|  hypothetical protein NEUTE1DRAFT_115903            200   2e-60    
ref|XP_011394488.1|  60S ribosomal protein L16                          201   2e-60    
ref|XP_005955448.1|  PREDICTED: 60S ribosomal protein L13a isofor...    200   2e-60    
ref|XP_007289379.1|  60S ribosomal protein L13                          200   2e-60    
gb|ADC97465.1|  putative 60S ribosomal protein L13a                     200   2e-60    
ref|XP_006014996.1|  PREDICTED: 60S ribosomal protein L13a-like         200   2e-60    
ref|XP_006824379.1|  PREDICTED: 60S ribosomal protein L13a-like i...    200   2e-60    
ref|XP_008861430.1|  ribosomal protein L13                              199   2e-60    
ref|XP_004092948.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    200   2e-60    
ref|XP_007892973.1|  PREDICTED: 60S ribosomal protein L13a              199   3e-60    
gb|EPT03925.1|  hypothetical protein FOMPIDRAFT_1022092                 199   3e-60    
ref|XP_007298090.1|  60S ribosomal protein L13a                         199   3e-60    
gb|AFM87541.1|  60S ribosomal protein L13a                              199   3e-60    
gb|AFM86006.1|  60S ribosomal protein L13a                              199   3e-60    
ref|XP_008000485.1|  PREDICTED: 60S ribosomal protein L13a-like i...    200   3e-60    
ref|XP_001269562.1|  60S ribosomal protein L16                          199   3e-60    
gb|KIO08197.1|  hypothetical protein M404DRAFT_133675                   199   3e-60    
emb|CCM05160.1|  predicted protein                                      199   3e-60    
ref|XP_008031827.1|  60S ribosomal protein L13a                         199   4e-60    
gb|KDO65930.1|  hypothetical protein CISIN_1g028649mg                   196   4e-60    
gb|EMD42236.1|  hypothetical protein CERSUDRAFT_79830                   199   4e-60    
ref|XP_001609803.1|  ribosomal protein L13                              199   4e-60    
emb|CEJ00501.1|  Putative 60S ribosomal protein L16                     199   5e-60    
gb|EIE79164.1|  60S ribosomal protein L16                               199   5e-60    
ref|XP_007053692.1|  PREDICTED: 60S ribosomal protein L13a-like         200   5e-60    
ref|XP_001265069.1|  60S ribosomal protein L16                          199   5e-60    
ref|XP_011397206.1|  60S ribosomal protein L13a-1                       198   5e-60    
gb|ERT00595.1|  60S ribosomal protein L16                               199   5e-60    
ref|XP_005833834.1|  large subunit ribosomal protein L13Ae_2, cyt...    198   5e-60    
ref|XP_007359836.1|  60S ribosomal protein L13a                         198   6e-60    
gb|KFY13303.1|  hypothetical protein V492_03363                         199   6e-60    
gb|KFY17505.1|  hypothetical protein V491_04976                         198   6e-60    
gb|KIW01173.1|  60S ribosomal protein L16                               198   6e-60    
gb|ACQ57984.1|  60S ribosomal protein L13a                              199   6e-60    
ref|XP_006454409.1|  ribosomal protein L13                              198   6e-60    
emb|CCX05052.1|  Similar to 60S ribosomal protein L16; acc. no. Q...    198   7e-60    
emb|CAH57701.1|  60S ribosomal protein L13A                             198   7e-60    
gb|ABZ04228.1|  ribosomal protein rpl13a                                198   7e-60    
ref|XP_003649454.1|  60S ribosomal protein L16                          198   7e-60    
ref|XP_003280356.1|  PREDICTED: 60S ribosomal protein L13a-like i...    198   7e-60    
ref|XP_009822374.1|  ribosomal protein L13                              198   8e-60    
gb|EPE08609.1|  60s ribosomal protein l16                               199   8e-60    
gb|ERG86236.1|  60s ribosomal protein l13a                              198   9e-60    
ref|XP_007763383.1|  ribosomal protein L16a                             198   9e-60    
ref|XP_001911222.1|  hypothetical protein                               198   1e-59    
ref|XP_001591799.1|  60S ribosomal protein L16                          198   1e-59    
gb|KGB33955.1|  60S ribosomal protein L13a                              198   1e-59    
ref|XP_007279305.1|  60s ribosomal protein l16                          198   1e-59    
gb|EHK19473.1|  hypothetical protein TRIVIDRAFT_111666                  198   1e-59    
ref|NP_001232687.1|  putative ribosomal protein L13A                    198   1e-59    
ref|XP_001816941.1|  60S ribosomal protein L16                          198   1e-59    
ref|XP_008602497.1|  60S ribosomal protein L16                          198   1e-59    
ref|XP_007820698.1|  hypothetical protein MAA_04996                     198   1e-59    
gb|EHK49489.1|  hypothetical protein TRIATDRAFT_297491                  198   1e-59    
dbj|GAA83388.1|  serine palmitoyltransferase 2                          198   1e-59    
gb|AFM86379.1|  60S ribosomal protein L13a                              198   1e-59    
dbj|GAN10069.1|  60S ribosomal protein L16                              197   1e-59    
ref|XP_003788690.1|  PREDICTED: 60S ribosomal protein L13a-like         198   1e-59    
gb|EPS27763.1|  hypothetical protein PDE_02707                          197   1e-59    
ref|XP_007372042.1|  60S large subunit ribosomal protein                197   1e-59    
gb|EYE99359.1|  ribosomal protein L13                                   197   1e-59    
ref|XP_007265503.1|  ribosomal protein L16a                             197   1e-59    
ref|XP_568413.1|  structural constituent of ribosome                    197   1e-59    
gb|KIM85315.1|  hypothetical protein PILCRDRAFT_817318                  197   1e-59    
gb|KFX88286.1|  hypothetical protein V490_07740                         197   2e-59    
gb|KIK91012.1|  hypothetical protein PAXRUDRAFT_831191                  197   2e-59    
ref|XP_001828792.1|  60S ribosomal protein L16                          197   2e-59    
gb|EKG17306.1|  Ribosomal protein L13 eukaryotic/archaeal               197   2e-59    
ref|XP_007390595.1|  hypothetical protein PHACADRAFT_247592             197   2e-59    
ref|XP_001398840.1|  60S ribosomal protein L16                          197   2e-59    
ref|XP_007778809.1|  60S ribosomal protein L16                          197   2e-59    
ref|XP_007336962.1|  60S ribosomal protein L13a                         197   2e-59    
gb|ABW90393.1|  putative ribosomal protein L13a                         197   2e-59    
gb|AFR98459.1|  large subunit ribosomal protein L13                     197   2e-59    
gb|EPB90589.1|  60S ribosomal protein L16                               197   2e-59    
gb|KGB79094.1|  60S ribosomal protein L13/L16                           197   2e-59    
gb|KIR59162.1|  ribosomal protein L13                                   197   2e-59    
emb|CCE29838.1|  probable ribosomal protein l13a                        197   2e-59    
ref|XP_007836334.1|  60S ribosomal protein L16                          197   2e-59    
ref|XP_001225089.1|  60S ribosomal protein L16                          197   2e-59    
gb|AFM90670.1|  60S ribosomal protein L13a                              197   2e-59    
gb|EER45034.1|  60S ribosomal protein L13a                              197   2e-59    
gb|KFO26211.1|  60S ribosomal protein L13a                              207   2e-59    
ref|XP_007842224.1|  ribosomal protein l13a                             197   2e-59    
gb|KIY47036.1|  60S ribosomal protein L13a                              197   3e-59    
ref|XP_002396666.1|  hypothetical protein MPER_03052                    197   3e-59    
ref|XP_005534139.1|  PREDICTED: 60S ribosomal protein L13a-like         197   3e-59    
gb|KIP12424.1|  hypothetical protein PHLGIDRAFT_17577                   197   3e-59    
gb|KIM67235.1|  hypothetical protein SCLCIDRAFT_1210745                 196   3e-59    
ref|XP_003661900.1|  hypothetical protein MYCTH_2314728                 197   3e-59    
ref|XP_005538418.1|  60S ribosomal protein L13A                         197   3e-59    
gb|EPB90135.1|  60S ribosomal protein L16                               197   3e-59    
ref|NP_001279799.1|  ribosomal protein L13a                             197   3e-59    
gb|KDQ12852.1|  hypothetical protein BOTBODRAFT_34000                   196   3e-59    
ref|XP_009079538.1|  PREDICTED: 60S ribosomal protein L13a              195   4e-59    
gb|KDQ30707.1|  hypothetical protein PLEOSDRAFT_1053876                 196   4e-59    
gb|KIJ21668.1|  hypothetical protein PAXINDRAFT_64692                   196   4e-59    
gb|ACO14619.1|  60S ribosomal protein L13A                              196   4e-59    
ref|XP_002836976.1|  60S ribosomal protein L16                          196   4e-59    
gb|ACG26447.1|  60S ribosomal protein L13a-2                            196   4e-59    
gb|KIY62452.1|  60S ribosomal protein L13a                              196   4e-59    
gb|ELW47139.1|  Aldehyde dehydrogenase family 16 member A1              212   4e-59    
ref|XP_007861056.1|  60S ribosomal protein L13a                         196   4e-59    
emb|CCF47368.1|  60S ribosomal protein L16                              196   5e-59    
ref|XP_009541219.1|  hypothetical protein HETIRDRAFT_308123             196   5e-59    
ref|XP_002542528.1|  60S ribosomal protein L16                          196   5e-59    
ref|XP_001873232.1|  60S ribosomal protein L16                          196   5e-59    
emb|CEP16619.1|  hypothetical protein                                   196   5e-59    
gb|KIK06911.1|  hypothetical protein K443DRAFT_673805                   196   5e-59    
gb|KIK28465.1|  hypothetical protein PISMIDRAFT_673469                  196   6e-59    
ref|XP_008213727.1|  PREDICTED: 60S ribosomal protein L13a              196   6e-59    
ref|XP_003197368.1|  structural constituent of ribosome                 196   6e-59    
emb|CEG62724.1|  Putative 60S ribosomal protein L16                     196   6e-59    
gb|KJA29151.1|  hypothetical protein HYPSUDRAFT_175798                  196   6e-59    
ref|NP_001187674.1|  60S ribosomal protein l13a                         196   6e-59    
ref|XP_006969355.1|  ribosomal protein L16, L13 family                  196   6e-59    



>emb|CDP03876.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   339 bits (869),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKTKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNH DTI+ LE KRKERAQA YERRKQLT+LR+KAEKAAEE+LG+QLDILSSVKY
Sbjct  150  VGWNHADTIRELEAKRKERAQATYERRKQLTRLRIKAEKAAEEKLGSQLDILSSVKY  206



>ref|XP_006349931.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   339 bits (869),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  150  VGWNHYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAVIAPIKY  206



>ref|XP_009596414.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana tomentosiformis]
Length=206

 Score =   338 bits (867),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL I++ +KY
Sbjct  150  VGWNHYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAIIAPIKY  206



>ref|XP_009795999.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana sylvestris]
Length=206

 Score =   338 bits (867),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL ++  +KY
Sbjct  150  VGWNHYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAVIEPIKY  206



>ref|NP_001275476.1| 60S ribosomal protein L13a-4-like [Solanum tuberosum]
 gb|ABA46790.1| 60S ribosomal protein L13a-like protein [Solanum tuberosum]
Length=206

 Score =   338 bits (867),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL ++  +KY
Sbjct  150  VGWNHYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAVIEPIKY  206



>ref|XP_009622553.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   338 bits (867),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL ++  +KY
Sbjct  150  VGWNHYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAVIEPIKY  206



>gb|AHE13806.1| ribosomal protein L13a [Solanum torvum]
Length=206

 Score =   338 bits (866),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVIVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL I++ +KY
Sbjct  150  VGWNHYDTIKDLENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAIIAPIKY  206



>ref|XP_004252998.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
Length=206

 Score =   338 bits (866),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQ+GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQSGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  150  VGWNHYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAVIAPIKY  206



>ref|XP_009789164.1| PREDICTED: 60S ribosomal protein L13a-1 [Nicotiana sylvestris]
Length=206

 Score =   337 bits (865),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LENKRKERAQA YERRKQL KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  150  VGWNHYDTIRDLENKRKERAQATYERRKQLAKLRVKAEKAAEEKLGPQLAVIAPIKY  206



>ref|XP_004239861.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum lycopersicum]
Length=206

 Score =   337 bits (865),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQ+GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQSGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL ++  +KY
Sbjct  150  VGWNHYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAVIEPIKY  206



>ref|XP_010488596.1| PREDICTED: 60S ribosomal protein L13a-2 [Camelina sativa]
Length=206

 Score =   336 bits (862),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQLTKLR KAEK AEE+LG+QLD+L+S+KY
Sbjct  150  VGWNHYDTIKELETKRKERSQAVYERKKQLTKLRAKAEKVAEEKLGSQLDVLTSIKY  206



>ref|XP_011073788.1| PREDICTED: 60S ribosomal protein L13a-4 [Sesamum indicum]
Length=206

 Score =   336 bits (862),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQA YER+KQLTKLRVKAEK AEE+LG QLDI++ +KY
Sbjct  150  VGWNHYDTIRELEKKRKERAQATYERKKQLTKLRVKAEKVAEEKLGAQLDIIAPIKY  206



>ref|XP_009765513.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana sylvestris]
Length=206

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTIK LENKRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL I++ +KY
Sbjct  150  VGWNYYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQLAIIAPIKY  206



>ref|XP_006298559.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
 gb|EOA31457.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
Length=206

 Score =   336 bits (861),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQLTKLR KAEK AEE+LG+QLD+L+S+KY
Sbjct  150  VGWNHYDTIKELETKRKERSQAVYERKKQLTKLRAKAEKVAEEKLGSQLDVLASIKY  206



>ref|XP_010466918.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   335 bits (859),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQLTKLR KAEK AEE+LG+Q D+L+S+KY
Sbjct  150  VGWNHYDTIKELETKRKERSQAVYERKKQLTKLRAKAEKVAEEKLGSQFDVLTSIKY  206



>ref|XP_002267491.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
Length=206

 Score =   334 bits (857),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQ AYER+KQLTKLRVKAEK AEE+L TQLDIL++VKY
Sbjct  150  VGWNHYDTIRELEKKRKERAQLAYERKKQLTKLRVKAEKVAEEKLSTQLDILAAVKY  206



>ref|XP_009625303.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   334 bits (857),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LENKRKERAQ  YERRKQL KLRV+AEKAAEE+LG QL +++ +KY
Sbjct  150  VGWNHYDTIRDLENKRKERAQVTYERRKQLAKLRVRAEKAAEEKLGPQLAVIAPIKY  206



>gb|EYU32659.1| hypothetical protein MIMGU_mgv1a013922mg [Erythranthe guttata]
Length=206

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPP+DK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPFDKIKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ  Y RRKQLTKLR+KAEK AEE+LG+QLDI++ +KY
Sbjct  150  VGWNHYDTIKELENKRKERAQTTYLRRKQLTKLRLKAEKIAEEKLGSQLDIIAPIKY  206



>ref|XP_004247847.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
 ref|XP_006360354.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   334 bits (856),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRL+AGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLRAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LENKRKERAQ  YERRKQL KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  150  VGWNHYDTIRDLENKRKERAQVTYERRKQLAKLRVKAEKAAEEKLGPQLAVIAPIKY  206



>ref|NP_189127.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 sp|Q9LRX8.1|R13A2_ARATH RecName: Full=60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 dbj|BAB02893.1| 60S ribosomal protein L13A-like [Arabidopsis thaliana]
 gb|AAN12937.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AEE76951.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
Length=206

 Score =   334 bits (856),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQLTKLR KAEK AEE+LG+QLD+L+S+KY
Sbjct  150  VGWNHYDTIKELEVKRKERSQALYERKKQLTKLRAKAEKVAEEKLGSQLDVLASIKY  206



>gb|EYU31410.1| hypothetical protein MIMGU_mgv1a013934mg [Erythranthe guttata]
Length=206

 Score =   333 bits (855),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRK+RAQA YER+KQL KLRVKAEK AEE+LG QLDI++ +KY
Sbjct  150  VGWNHYDTIKELEQKRKDRAQATYERKKQLIKLRVKAEKIAEEKLGAQLDIIAPIKY  206



>gb|AAL87341.1| putative 60S ribosomal protein [Arabidopsis thaliana]
Length=206

 Score =   333 bits (854),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMV+PDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVVPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQLTKLR KAEK AEE+LG+QLD+L+S+KY
Sbjct  150  VGWNHYDTIKELEVKRKERSQALYERKKQLTKLRAKAEKVAEEKLGSQLDVLASIKY  206



>ref|XP_010277234.1| PREDICTED: 60S ribosomal protein L13a-4 [Nelumbo nucifera]
Length=206

 Score =   333 bits (853),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFR+P+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRSPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIPDALKVLRLQPGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIKVLE KRKERAQ AYERRKQL KLRVKAEKAAEE+LG QLDIL+ +KY
Sbjct  150  VGWNHYDTIKVLEKKRKERAQVAYERRKQLNKLRVKAEKAAEEQLGPQLDILAPIKY  206



>ref|XP_010279449.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   333 bits (853),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLK YEG+PPPYDK+KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALGRLKAYEGIPPPYDKMKRMVIPDALKVLRLQPGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRKERAQ AYERRKQLTKLRVKAEKAAEE+LG+QLDILS VKY
Sbjct  150  VGWSHYDTIKELEKKRKERAQVAYERRKQLTKLRVKAEKAAEEQLGSQLDILSPVKY  206



>ref|XP_002883564.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59823.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   332 bits (851),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLR KAEK AEE+LGTQLD+LS +KY
Sbjct  150  VGWNHYDTIKELEVKRKERSQAVYERKKQLNKLRAKAEKVAEEKLGTQLDVLSPIKY  206



>ref|XP_009136093.1| PREDICTED: 60S ribosomal protein L13a-2 [Brassica rapa]
 emb|CDY15113.1| BnaC03g44740D [Brassica napus]
 emb|CDX93039.1| BnaA03g37610D [Brassica napus]
Length=206

 Score =   332 bits (851),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RF+RKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYMRFMRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL+KLR KAEK AEE+LG+QLD+L+ +KY
Sbjct  150  VGWNHYDTIKELEVKRKERSQAVYERKKQLSKLRTKAEKVAEEKLGSQLDVLAPIKY  206



>ref|XP_011091425.1| PREDICTED: 60S ribosomal protein L13a-4-like [Sesamum indicum]
Length=206

 Score =   332 bits (850),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEG+PPPYDK KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGIPPPYDKTKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRK+RAQA YER+KQLTKLR+KAEK AEE+LG QLDI++ +KY
Sbjct  150  VGWNHYDTIRELEKKRKDRAQATYERKKQLTKLRLKAEKVAEEKLGAQLDIIAPIKY  206



>ref|XP_010920859.1| PREDICTED: 60S ribosomal protein L13a-4-like [Elaeis guineensis]
Length=206

 Score =   332 bits (850),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRK+RAQ AYERRKQL KLR+KAEKAAEE+LG+QLDIL+ +KY
Sbjct  150  VGWSHYDTIKELEAKRKQRAQVAYERRKQLAKLRLKAEKAAEEKLGSQLDILAPLKY  206



>gb|ADR71263.1| 60S ribosomal protein L13aA [Hevea brasiliensis]
Length=206

 Score =   331 bits (849),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LE KRKERAQ AYER+KQLTKLRVKAEK AEE+LG+QLDI+S +KY
Sbjct  150  VGWNHYETIKELERKRKERAQVAYERKKQLTKLRVKAEKVAEEKLGSQLDIISPIKY  206



>ref|XP_010440660.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L13a-3-like 
[Camelina sativa]
Length=206

 Score =   331 bits (848),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EG+PPPYDKVKRMVIPDALKVLRLQ+GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGIPPPYDKVKRMVIPDALKVLRLQSGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KL+ KAEK AEE+LG+QLDIL+ VKY
Sbjct  150  VGWNHYDTIKELETKRKERSQATYERKKQLNKLKTKAEKVAEEKLGSQLDILAPVKY  206



>ref|XP_007223449.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 ref|XP_008224495.1| PREDICTED: 60S ribosomal protein L13a-4 [Prunus mume]
 gb|EMJ24648.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=206

 Score =   331 bits (848),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LENKRKERAQ AYER+KQL KLRVKAEK AEE+LG QL+I++ +KY
Sbjct  150  VGWNHYETIKELENKRKERAQLAYERKKQLNKLRVKAEKVAEEKLGPQLEIIAPIKY  206



>gb|KHG07795.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   330 bits (847),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAA+LARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAASLARLKAYEGIPAPYDKIKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ AYERRKQLTKLRVKAEK AEE+LGTQL+++S +KY
Sbjct  150  VGWNHYDTIKELERKRKERAQVAYERRKQLTKLRVKAEKVAEEKLGTQLEVISPIKY  206



>ref|XP_010439646.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
 ref|XP_010442327.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
Length=206

 Score =   330 bits (846),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVP PYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPTPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLRVKAEK AEE+LG QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELETKRKERSQAVYERKKQLNKLRVKAEKVAEEKLGAQLDVLAPVKY  206



>ref|XP_010524687.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   330 bits (846),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGHLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLR KAEK AEE+LG QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELEKKRKERSQAVYERKKQLNKLRAKAEKTAEEKLGAQLDVLAPVKY  206



>ref|XP_010069656.1| PREDICTED: 60S ribosomal protein L13a-2 [Eucalyptus grandis]
 gb|KCW58065.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=206

 Score =   330 bits (845),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQRVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLK YEGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAGALARLKAYEGVPPPYDKTKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQA YER+KQLTKLRVKAEK AEE+LG+Q+DIL++VKY
Sbjct  150  VGWNHYDTIRELEKKRKERAQAVYERKKQLTKLRVKAEKVAEEKLGSQVDILATVKY  206



>gb|ACJ02350.1| 60S ribosomal protein L13A [Vernicia fordii]
Length=206

 Score =   330 bits (845),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ++VVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKIVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LE KRKER+Q  YER+KQLTKLRVKAEK AEE+LG+QLD++S +KY
Sbjct  150  VGWNHYETIKALEKKRKERSQLNYERKKQLTKLRVKAEKTAEEKLGSQLDVISPIKY  206



>ref|XP_010937848.1| PREDICTED: 60S ribosomal protein L13a-4 [Elaeis guineensis]
Length=206

 Score =   330 bits (845),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRK+RAQ AYERRKQL KLR+KAEK AEE+LG+QLDIL+ +KY
Sbjct  150  VGWSHYDTIKELEAKRKQRAQVAYERRKQLAKLRLKAEKVAEEKLGSQLDILAPLKY  206



>ref|XP_010552053.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   330 bits (845),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDK KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKTKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKER+QA YER+KQL KLR KA+K AEE+LG+QLD+LS VKY
Sbjct  150  VGWNHYDTIRELEKKRKERSQAVYERKKQLNKLRAKAQKTAEEKLGSQLDVLSPVKY  206



>ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41928.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   330 bits (845),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVP PYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPTPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ  YER+KQL KLRVKAEK AEE+LG QLDIL+ VKY
Sbjct  150  VGWNHYDTIKELETKRKERAQVVYERKKQLNKLRVKAEKVAEEKLGAQLDILAPVKY  206



>ref|XP_002518107.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF44240.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   329 bits (844),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGVPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LE KRKERAQ AYER+KQLTKLRVKAEK AEE+LG QLD+++ +KY
Sbjct  150  VGWNHYETIKELERKRKERAQVAYERKKQLTKLRVKAEKIAEEKLGPQLDVIAPIKY  206



>ref|XP_009112682.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
 emb|CDY39786.1| BnaA09g10380D [Brassica napus]
 emb|CDY03292.1| BnaC09g10560D [Brassica napus]
Length=206

 Score =   329 bits (844),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKE++QA YER+KQL KLR KAEK AEE+LG+QLD+L+ +KY
Sbjct  150  VGWNHYDTIKELEVKRKEKSQAVYERKKQLIKLRTKAEKVAEEKLGSQLDVLAPIKY  206



>gb|KFK38165.1| hypothetical protein AALP_AA3G077500 [Arabis alpina]
Length=206

 Score =   329 bits (843),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKV+EGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGANALARLKVFEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKER+Q  YER+KQL KLR KAEK AEE+LG QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELENKRKERSQVVYERKKQLNKLRAKAEKVAEEKLGAQLDVLAPVKY  206



>gb|KDP39375.1| hypothetical protein JCGZ_01132 [Jatropha curcas]
Length=206

 Score =   329 bits (843),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LE KRKERAQ  YER+KQLTKLRVKAEK AEE+LG+QLD+++ +KY
Sbjct  150  VGWNHYETIKELERKRKERAQLTYERKKQLTKLRVKAEKIAEEKLGSQLDVITPIKY  206



>ref|NP_193053.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 sp|Q9SVR0.1|R13A3_ARATH RecName: Full=60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 emb|CAB41927.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 emb|CAB78359.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 gb|AAK97733.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AAL31131.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AEE83240.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
Length=206

 Score =   329 bits (843),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQEVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EG+PPPYDK+KRMVIPDALKVLRLQ+GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGIPPPYDKIKRMVIPDALKVLRLQSGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+Q  YER+KQL KLR KAEK AEERLG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELETKRKERSQVMYERKKQLNKLRTKAEKVAEERLGSQLDVLAPVKY  206



>emb|CDY52083.1| BnaCnng21840D [Brassica napus]
 emb|CDX77383.1| BnaA07g05210D [Brassica napus]
Length=206

 Score =   328 bits (842),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALDRLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLR KAEK AEE+LG QLD+L+ +KY
Sbjct  150  VGWNHYDTIKELEVKRKERSQAVYERKKQLIKLRTKAEKVAEEKLGAQLDVLAPIKY  206



>ref|XP_010245584.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   328 bits (842),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFR+P+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRSPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIPDALKVLRLQPGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRKERAQ AYERRKQLTKLRVKAEKAAE +LG QLDILS VKY
Sbjct  150  VGWSHYDTIKELERKRKERAQVAYERRKQLTKLRVKAEKAAEVQLGPQLDILSPVKY  206



>ref|XP_006281111.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
 gb|EOA14009.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
Length=206

 Score =   328 bits (842),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVP PYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPTPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ  YER+KQ+ KLRVKAEK AEE+LG QLDIL+ VKY
Sbjct  150  VGWNHYDTIKELEAKRKERAQVVYERKKQINKLRVKAEKVAEEKLGAQLDILAPVKY  206



>ref|XP_008789105.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   328 bits (842),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK Y+GVPPPYD++KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYDGVPPPYDRMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRK+R+Q AYERRKQL KLR+KAEKA EE+LG+QLDIL+ +KY
Sbjct  150  VGWNHYDTIKELEAKRKQRSQVAYERRKQLAKLRLKAEKAVEEKLGSQLDILAPLKY  206



>ref|XP_009392721.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   328 bits (842),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQ GH+YCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDALKVLRLQPGHRYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDT+KVLE KRKERA+ AYERRKQLTKL++KAEKA EE+LG+QLDIL+ +KY
Sbjct  150  VGWNYYDTVKVLEEKRKERAKVAYERRKQLTKLKLKAEKAVEEKLGSQLDILAPLKY  206



>ref|XP_010482144.1| PREDICTED: 60S ribosomal protein L13a-4-like [Camelina sativa]
Length=206

 Score =   328 bits (842),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVP PYDKVKRMVIPDALKVLRLQAGH YCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPTPYDKVKRMVIPDALKVLRLQAGHNYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLRVKAEK AEE+LG QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELETKRKERSQAVYERKKQLNKLRVKAEKVAEEKLGAQLDVLAPVKY  206



>ref|XP_007049776.1| Ribosomal protein L13 family protein [Theobroma cacao]
 gb|EOX93933.1| Ribosomal protein L13 family protein [Theobroma cacao]
Length=206

 Score =   328 bits (842),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPSPYDKIKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQ AYER+KQL KLRVKAEKAAEE+LG+QLDIL+ VKY
Sbjct  150  VGWNHYDTIRELEKKRKERAQVAYERKKQLNKLRVKAEKAAEEKLGSQLDILAPVKY  206



>ref|NP_187367.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 sp|Q9SFU1.1|R13A1_ARATH RecName: Full=60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AAF20235.1|AC012395_22 putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAG40393.1|AF325041_1 AT3g07110 [Arabidopsis thaliana]
 gb|AAL09790.1| AT3g07110/T1B9_24 [Arabidopsis thaliana]
 gb|AAL32871.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAM47908.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AEE74499.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=206

 Score =   328 bits (841),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LLNGQ +VVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KDLLNGQNIVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKV+EGVP PYDK+KRMV+PDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGANALARLKVFEGVPTPYDKIKRMVVPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQA YER+KQL+KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELENKRKERAQAVYERKKQLSKLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 ref|NP_001078737.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 sp|Q9FKC0.1|R13A4_ARATH RecName: Full=60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 dbj|BAB09429.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAL91263.1| AT5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AAM65734.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAM67435.1| At5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AED95720.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 gb|AED95721.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
Length=206

 Score =   328 bits (841),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVP PYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPTPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERA   YER+KQL KLRVKAEK AEE+LG QLDIL+ VKY
Sbjct  150  VGWNHYDTIKELETKRKERAHVVYERKKQLNKLRVKAEKVAEEKLGAQLDILAPVKY  206



>ref|XP_006407868.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
 gb|ESQ49321.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
Length=206

 Score =   328 bits (841),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLKV+EGVPPPY+K+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALDRLKVFEGVPPPYNKIKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKER+Q  YER+KQL KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELENKRKERSQVVYERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY  206



>gb|KJB30129.1| hypothetical protein B456_005G130900 [Gossypium raimondii]
Length=206

 Score =   328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEI +SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEISMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPAPYDKIKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ AYERRKQLTKLRVKAEK AEE+LGTQL+++S +KY
Sbjct  150  VGWNHYDTIKELERKRKERAQVAYERRKQLTKLRVKAEKVAEEKLGTQLEVISPIKY  206



>ref|XP_010069043.1| PREDICTED: 60S ribosomal protein L13a-3 [Eucalyptus grandis]
 gb|KCW57252.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=206

 Score =   328 bits (841),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK +EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKTFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LE KRKER+Q  YER+KQLTKLRVKAEKAAEE+LG Q++I++ +KY
Sbjct  150  VGWNHYETIKELERKRKERSQLLYERKKQLTKLRVKAEKAAEEKLGAQMEIIAPIKY  206



>ref|XP_010464292.1| PREDICTED: 60S ribosomal protein L13a-1-like [Camelina sativa]
Length=206

 Score =   328 bits (840),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKV+EGVP PYDKVK+MVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGANALARLKVFEGVPTPYDKVKKMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ  YER+KQL KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELENKRKERAQVVYERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_004154637.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 2 [Cucumis 
sativus]
 ref|XP_004154638.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 3 [Cucumis 
sativus]
Length=208

 Score =   328 bits (840),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QAAYER+KQL KLR+KAEK AEE+LG QL++++ +KY
Sbjct  150  VGWNHYDTIKELERKRKERSQAAYERKKQLNKLRIKAEKVAEEKLGPQLEVIAPIKY  206



>ref|XP_009404653.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   328 bits (840),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK KRMVIPDALKVLRLQ GH+YCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKTKRMVIPDALKVLRLQPGHRYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDT+KVLE KRKERA+ AYERRKQLTKLR+KAEK AEE+LG QLDIL+ +KY
Sbjct  150  VGWNYYDTVKVLEAKRKERAKVAYERRKQLTKLRLKAEKTAEEKLGPQLDILAPLKY  206



>ref|XP_009374600.1| PREDICTED: 60S ribosomal protein L13a-4 [Pyrus x bretschneideri]
Length=206

 Score =   328 bits (840),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVR EEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRAEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LENKRKERAQ AYER+KQL KLRVKAEK AEE+LG QL+I++ +KY
Sbjct  150  VGWNHYETIKELENKRKERAQVAYERKKQLNKLRVKAEKVAEEKLGPQLEIIAPIKY  206



>ref|XP_004138959.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_004139040.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_008450411.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008457247.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008458460.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 gb|KGN61467.1| hypothetical protein Csa_2G138710 [Cucumis sativus]
Length=206

 Score =   328 bits (840),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QAAYER+KQL KLR+KAEK AEE+LG QL++++ +KY
Sbjct  150  VGWNHYDTIKELERKRKERSQAAYERKKQLNKLRIKAEKVAEEKLGPQLEVIAPIKY  206



>ref|XP_009111853.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
 emb|CDY00046.1| BnaC09g02550D [Brassica napus]
 emb|CDX86281.1| BnaA06g29980D [Brassica napus]
Length=206

 Score =   328 bits (840),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALAR+KV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARMKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+Q  YER+KQL KLR KAEK AEE+LG QL+IL+ VKY
Sbjct  150  VGWNHYDTIKELETKRKERSQVVYERKKQLNKLRAKAEKVAEEKLGAQLEILAPVKY  206



>ref|XP_006298567.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
 gb|EOA31465.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
Length=206

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKV+EGVP PYDK+K+MVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGANALARLKVFEGVPTPYDKIKKMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ  YER+KQL KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELENKRKERAQVVYERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_002863167.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39426.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EG+PPPYDK+KRMVIPDALKVLRLQ+GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGIPPPYDKIKRMVIPDALKVLRLQSGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKE++Q  YER+KQL KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELETKRKEKSQVVYERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_010448678.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
 ref|XP_010486252.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
Length=206

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKV+EGVP PYDKVK+MVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGANALARLKVFEGVPTPYDKVKKMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ  YER+KQL KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELENKRKERAQVVYERKKQLNKLRAKAEKVAEEKLGSQLDVLAPVKY  206



>ref|XP_004154636.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 1 [Cucumis 
sativus]
Length=241

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  63   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  122

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  123  RGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  182

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QAAYER+KQL KLR+KAEK AEE+LG QL++++ +KY
Sbjct  183  VGWNHYDTIKELERKRKERSQAAYERKKQLNKLRIKAEKVAEEKLGPQLEVIAPIKY  239



>ref|XP_009102457.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
Length=206

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALDRLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLR KAEK AE++LG QLD+L+ +KY
Sbjct  150  VGWNHYDTIKELEVKRKERSQAVYERKKQLIKLRTKAEKVAEQKLGAQLDVLAPIKY  206



>ref|XP_004133995.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_004169511.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_008438365.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis melo]
 gb|KGN56740.1| hypothetical protein Csa_3G131930 [Cucumis sativus]
Length=206

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QAAYE++KQLTKLRVKAEK A+E+LG QL +++ +KY
Sbjct  150  VGWNHYDTIKELERKRKERSQAAYEKKKQLTKLRVKAEKVADEKLGPQLQVIAPIKY  206



>ref|XP_008356990.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
 ref|XP_009348407.1| PREDICTED: 60S ribosomal protein L13a-4-like [Pyrus x bretschneideri]
Length=206

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVR EEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRAEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDK KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKTKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LENKRKERAQ AYER+KQL KLRVKAEK+AEE+LG QL+I++ +KY
Sbjct  150  VGWNHYETIKELENKRKERAQVAYERKKQLNKLRVKAEKSAEEKLGPQLEIIAPIKY  206



>ref|XP_008793237.1| PREDICTED: 60S ribosomal protein L13a-4 [Phoenix dactylifera]
Length=206

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYD++KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDRMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTIK LE KRK+R+Q AYERRKQL KLR+KAEK AEE+LG+QLDIL+ +KY
Sbjct  150  VGWNYYDTIKELEAKRKQRSQVAYERRKQLAKLRLKAEKTAEEKLGSQLDILAPLKY  206



>gb|KHG08426.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB37827.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
 gb|KJB37828.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
Length=206

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPAPYDKTKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ AYERRKQLTKLRVKAEK AEE+LG QL++++ +KY
Sbjct  150  VGWNHYDTIKELERKRKERAQVAYERRKQLTKLRVKAEKVAEEKLGAQLEVIAPIKY  206



>ref|XP_009403869.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   327 bits (838),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVIVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQ GH+YCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKIKRMVIPDALKVLRLQPGHRYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDT+KVLE KRKERA  AYERRKQLTKLR+KAEKAA ++LG+QLDIL+ +KY
Sbjct  150  VGWNYYDTVKVLEAKRKERAAVAYERRKQLTKLRLKAEKAAGDKLGSQLDILAPLKY  206



>ref|XP_006418685.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
 gb|ESQ37121.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
Length=206

 Score =   327 bits (838),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALDRLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLR KAEK A+E+LG+QLD+L+ +KY
Sbjct  150  VGWNHYDTIKELEVKRKERSQAVYERKKQLIKLRTKAEKVADEKLGSQLDVLAPIKY  206



>emb|CDY33947.1| BnaA02g30400D [Brassica napus]
 emb|CDY05663.1| BnaC02g38740D [Brassica napus]
 emb|CDX85362.1| BnaC07g26730D [Brassica napus]
Length=206

 Score =   327 bits (838),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALAR+KV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARMKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+Q  YER+KQL KLR KAEK AEE+LG QL+IL+ VKY
Sbjct  150  VGWNHYDTIKELEAKRKERSQVVYERKKQLNKLRAKAEKVAEEKLGAQLEILAPVKY  206



>ref|XP_006284504.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
 gb|EOA17402.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
Length=217

 Score =   327 bits (839),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  41   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  100

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EG+PPPYDK+KRMVIPDALKVLRLQ+GHKYCLLG+LSSE
Sbjct  101  RGMIPHKTKRGAAALARLKVFEGIPPPYDKIKRMVIPDALKVLRLQSGHKYCLLGQLSSE  160

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+Q  YER+KQL KLR KAEK AEE LG+QLDIL+ VKY
Sbjct  161  VGWNHYDTIKELETKRKERSQVMYERKKQLNKLRNKAEKVAEENLGSQLDILAPVKY  217



>ref|XP_009421391.1| PREDICTED: 60S ribosomal protein L13a-4 [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   327 bits (837),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQ GH+YCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKIKRMVIPDALKVLRLQPGHRYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDT+K LE KRKERA+ AYERRKQLTKLR+KAEK AEE+LG+QLDI++ +KY
Sbjct  150  VGWNYYDTVKELEAKRKERAKVAYERRKQLTKLRLKAEKTAEEKLGSQLDIIAPLKY  206



>ref|XP_006395114.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
 gb|ESQ32400.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
Length=206

 Score =   327 bits (837),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLKV+EGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALDRLKVFEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+Q  YER+KQL KLRVKAEK AEE+LG QL+IL+ VKY
Sbjct  150  VGWNHYDTIKELEAKRKERSQVVYERKKQLNKLRVKAEKVAEEKLGAQLEILAPVKY  206



>ref|XP_009129745.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brassica rapa]
Length=206

 Score =   326 bits (836),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALAR+KV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARMKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+Q  YER+KQL KLR KAEK AEE+LG Q++IL+ VKY
Sbjct  150  VGWNHYDTIKELEAKRKERSQVVYERKKQLNKLRAKAEKVAEEKLGAQIEILAPVKY  206



>ref|XP_007034382.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 ref|XP_007034383.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05308.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05309.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
Length=206

 Score =   326 bits (836),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPAPYDKMKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ AYERRKQL KLRVKAEKAAEE+LG QL +++ +KY
Sbjct  150  VGWNHYDTIKELERKRKERAQVAYERRKQLNKLRVKAEKAAEEKLGAQLAVIAPIKY  206



>gb|KHG26825.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   326 bits (836),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKTYEGIPAPYDKIKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ AYERRKQL KLRVKAEK AEE+LG QL++++ +KY
Sbjct  150  VGWNHYDTIKELERKRKERAQVAYERRKQLVKLRVKAEKVAEEKLGAQLEVIAPIKY  206



>gb|KHG16481.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB22644.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=206

 Score =   326 bits (836),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPSPYDKIKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQ AYER+KQL KLRVKAEK AEE+LG+QLDIL+ VKY
Sbjct  150  VGWNHYDTIRELEKKRKERAQVAYERKKQLNKLRVKAEKTAEEKLGSQLDILAPVKY  206



>gb|KFK39801.1| hypothetical protein AALP_AA3G289800 [Arabis alpina]
Length=206

 Score =   326 bits (835),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQ+GHKYCLL +LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQSGHKYCLLNRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+Q  YER+KQL KLR KAEK AEE+LG QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELEAKRKERSQVMYERKKQLNKLRTKAEKVAEEKLGPQLDVLAPVKY  206



>gb|KFK39804.1| hypothetical protein AALP_AA3G290300 [Arabis alpina]
Length=206

 Score =   326 bits (835),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK++EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKMFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKE++Q  YER+KQL KLR KAEK AEE+LG+QLD+L+ +KY
Sbjct  150  VGWNHYDTIKELEVKRKEKSQVVYERKKQLIKLRAKAEKVAEEKLGSQLDVLAPIKY  206



>ref|XP_008348430.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
Length=206

 Score =   326 bits (835),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVR EEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRAEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LENKRKERAQ AYER+KQL KLRVKAEK AEE+LG  L+I++ +KY
Sbjct  150  VGWNHYETIKELENKRKERAQVAYERKKQLNKLRVKAEKVAEEKLGPHLEIIAPIKY  206



>ref|XP_009405822.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   325 bits (834),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQ GH+YCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKIKRMVIPDALKVLRLQPGHRYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDT+K LE KRKERA+ AYERRKQLTKLR+KAEKAAEE+LG+QLDIL  + Y
Sbjct  150  VGWNYYDTVKELEAKRKERAKVAYERRKQLTKLRLKAEKAAEEKLGSQLDILLPLNY  206



>ref|XP_002268901.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
 emb|CAN63603.1| hypothetical protein VITISV_006449 [Vitis vinifera]
Length=206

 Score =   325 bits (834),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHY+TIK LE KRKERA+ AYER+KQL KLRVKAEKAA ++LG+QLD+++ +KY
Sbjct  150  VGWNHYETIKELEKKRKERAELAYERKKQLNKLRVKAEKAAVDKLGSQLDVIAPIKY  206



>ref|XP_006840139.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
 gb|ERN01814.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
Length=206

 Score =   325 bits (834),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKTKRMVIPDALKVLRLQPGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRK RAQ AYERRK+L KLRVKAEK+AE++LG +L+IL+ +KY
Sbjct  150  VGWNHYDTIKELEEKRKARAQVAYERRKELAKLRVKAEKSAEQQLGPKLEILAPLKY  206



>ref|XP_009151676.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
Length=206

 Score =   325 bits (833),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP KI WRT+
Sbjct  30   KELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPPKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALAR+KV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARMKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+Q  YER+KQL KLR KAEK AEE+LG QL+IL+ VKY
Sbjct  150  VGWNHYDTIKELETKRKERSQVVYERKKQLNKLRAKAEKVAEEKLGAQLEILAPVKY  206



>gb|KJB72096.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=206

 Score =   325 bits (833),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKTYEGIPAPYDKMKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ AYERRKQL KLRVKAEK AEE+LG QL++++ +KY
Sbjct  150  VGWNHYDTIKELERKRKERAQVAYERRKQLIKLRVKAEKVAEEKLGAQLEVIAPIKY  206



>ref|XP_006420899.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 ref|XP_006493807.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|ESR34139.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 gb|KDO61167.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=206

 Score =   325 bits (833),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVP PYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPAPYDKTKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTIK LE KRKERAQ AYERRKQL KLRVKAEKAAEERLG QL+I++ +KY
Sbjct  150  VGWNYYDTIKELEKKRKERAQVAYERRKQLAKLRVKAEKAAEERLGPQLEIIAPIKY  206



>ref|XP_004288082.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
 ref|XP_004288083.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
Length=206

 Score =   325 bits (833),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKER+Q AYER+KQL KLRVKAEK AEE+LG  L+I++ +KY
Sbjct  150  VGWNHYDTIRELEKKRKERSQIAYERKKQLNKLRVKAEKVAEEKLGPHLEIIAPIKY  206



>ref|XP_010532891.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   324 bits (831),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLR KAEK AEE+LG QL++L+ V+Y
Sbjct  150  VGWNHYDTIKELEKKRKERSQALYERKKQLNKLRAKAEKVAEEKLGPQLNVLAPVRY  206



>ref|XP_010110069.1| 60S ribosomal protein L13a-3 [Morus notabilis]
 gb|EXC25125.1| 60S ribosomal protein L13a-3 [Morus notabilis]
Length=206

 Score =   324 bits (831),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEE+C+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEELCISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMV+PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKIKRMVVPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQ AYER+KQL KLR KAEKAAEE+LG+Q+DIL+ VKY
Sbjct  150  VGWNHYDTIRELEKKRKERAQLAYERKKQLNKLRTKAEKAAEEKLGSQVDILAPVKY  206



>ref|XP_002521095.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF41246.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   324 bits (830),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMVIPDALKVLRLQ+GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKIKRMVIPDALKVLRLQSGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE K+KERAQ  YER+KQL KLRVKA+K+AEE+LG+QLDIL+ V Y
Sbjct  150  VGWNHYDTIRELEKKKKERAQVMYERKKQLNKLRVKAQKSAEEKLGSQLDILAPVTY  206



>ref|XP_004297119.1| PREDICTED: 60S ribosomal protein L13a-4-like [Fragaria vesca 
subsp. vesca]
Length=206

 Score =   324 bits (830),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKER+Q AYER+KQL KLRVKAEK AEE+LG  L I++ +KY
Sbjct  150  VGWNHYDTIRELEKKRKERSQIAYERKKQLNKLRVKAEKVAEEKLGPHLKIIAPIKY  206



>ref|NP_001030654.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AEE74500.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=207

 Score =   323 bits (829),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 1/178 (1%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LLNGQ +VVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KDLLNGQNIVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKV+EGVP PYDK+KRMV+PDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGANALARLKVFEGVPTPYDKIKRMVVPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKV-LENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK  LENKRKERAQA YER+KQL+KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKQELENKRKERAQAVYERKKQLSKLRAKAEKVAEEKLGSQLDVLAPVKY  207



>gb|KJB42469.1| hypothetical protein B456_007G154600 [Gossypium raimondii]
Length=206

 Score =   323 bits (829),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ++VVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKLVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDKVKRMVIPDALKVLRL  GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPSPYDKVKRMVIPDALKVLRLLKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ AYER+K+L KLRVKAEKAAEE+LG+QLDIL+ VKY
Sbjct  150  VGWNHYDTIKELEKKRKERAQVAYERKKELNKLRVKAEKAAEEKLGSQLDILAPVKY  206



>ref|XP_011045655.1| PREDICTED: 60S ribosomal protein L13a-2 [Populus euphratica]
Length=206

 Score =   323 bits (827),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKV+EGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVFEGVPPPYDKTKRMVIPDALKVLRLQPGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ  YER+KQL KLRVKAEK AEE+LG QLDI++ +KY
Sbjct  150  VGWNHYDTIKELEMKRKERAQLIYERKKQLAKLRVKAEKTAEEKLGPQLDIIAPLKY  206



>ref|XP_010937601.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=206

 Score =   323 bits (827),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMK+ RFLRKRMNTKPSHGPIHFR+P+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKFLRFLRKRMNTKPSHGPIHFRSPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTI+ LE KRK+R+Q AYERRKQL +LR KAEK AEE+LG+QLDIL+ +KY
Sbjct  150  VGWSHYDTIRELEEKRKQRSQVAYERRKQLARLRQKAEKTAEEKLGSQLDILAPLKY  206



>ref|XP_006369799.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
 gb|ABK93590.1| unknown [Populus trichocarpa]
 gb|ERP66368.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
Length=206

 Score =   323 bits (827),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKV+EGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVFEGVPPPYDKTKRMVIPDALKVLRLQPGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ  YER+KQL KLRVKAEK AEE+LG QLDI++ +KY
Sbjct  150  VGWNHYDTIKELEMKRKERAQLIYERKKQLAKLRVKAEKTAEEKLGPQLDIIAPLKY  206



>ref|XP_002882511.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58770.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score =   322 bits (826),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 166/178 (93%), Gaps = 1/178 (1%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKV+EGVP PYDK+KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGANALARLKVFEGVPTPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKV-LENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK  LENKRKERAQ  YER+KQL KLR KAEK AEE+LG+QL++L+ VKY
Sbjct  150  VGWNHYDTIKQELENKRKERAQVVYERKKQLNKLRAKAEKVAEEKLGSQLEVLAPVKY  207



>gb|EPS58218.1| hypothetical protein M569_16597 [Genlisea aurea]
Length=206

 Score =   322 bits (826),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKV+EGVPPPYD+ KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVFEGVPPPYDRTKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRK+R+Q+ YE++KQL KLR +AEK AE +LG QLDIL+ +KY
Sbjct  150  VGWNHYDTIRDLEKKRKDRSQSVYEKKKQLKKLRARAEKTAEAKLGAQLDILTPIKY  206



>gb|KJB10146.1| hypothetical protein B456_001G186700 [Gossypium raimondii]
Length=206

 Score =   322 bits (826),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P P+DK+KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPAPFDKIKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQ +YER+KQL KLRVKAEK AEE+LG+QLD+L  VKY
Sbjct  150  VGWNHYDTIRELEKKRKERAQVSYERKKQLNKLRVKAEKTAEEKLGSQLDLLDPVKY  206



>ref|XP_010023711.1| PREDICTED: 60S ribosomal protein L13a-4-like [Eucalyptus grandis]
 gb|KCW60057.1| hypothetical protein EUGRSUZ_H02787 [Eucalyptus grandis]
Length=206

 Score =   322 bits (826),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK KRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKTKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ  YER+KQL KLRVKAEKA EE+LG  ++I++ + Y
Sbjct  150  VGWNHYDTIKELERKRKERAQLVYERKKQLNKLRVKAEKAVEEKLGPHMEIIAPITY  206



>gb|AFK44939.1| unknown [Lotus japonicus]
Length=206

 Score =   322 bits (826),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTL  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLKVYEG+PPPYDKVKRMV+PDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALERLKVYEGIPPPYDKVKRMVVPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRK++AQ  YER+KQL KLRVKAEK A+E+LG+QLDIL+ VKY
Sbjct  150  VGWNYYDTIRELEKKRKDKAQVVYERKKQLNKLRVKAEKVADEKLGSQLDILAPVKY  206



>ref|XP_008786013.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   322 bits (825),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFR+P+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRSPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK KRMVIPDALKVLRLQAGHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKTKRMVIPDALKVLRLQAGHKYCLLGRLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW++YDTI+ LE KRK+R+Q AYERRKQL +LRVKAEKAAEE+LG+QL IL+ +KY
Sbjct  150  VGWSYYDTIRELEEKRKQRSQVAYERRKQLARLRVKAEKAAEEKLGSQLSILAPLKY  206



>ref|XP_010435310.1| PREDICTED: 60S ribosomal protein L13a-3-like [Camelina sativa]
Length=206

 Score =   322 bits (825),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVR +MKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRLRMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            R MIPHKTKRGAAALARLKV+EG+PPPYDKVKRMVIPDA KVLRLQ+GHKYCLLG+LSSE
Sbjct  90   RSMIPHKTKRGAAALARLKVFEGIPPPYDKVKRMVIPDAFKVLRLQSGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQL KLR KAEK AEE+LG+QLDI + V Y
Sbjct  150  VGWNHYDTIKELETKRKERSQATYERKKQLNKLRTKAEKVAEEKLGSQLDIFAPVMY  206



>gb|KHF97469.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   322 bits (824),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P P+DK+KRMVIPDALKVLRLQ GHK+CLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPAPFDKIKRMVIPDALKVLRLQKGHKHCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQ AYER+KQL KLRVKAEK AEE+LG+QLD+L  VKY
Sbjct  150  VGWNHYDTIRELEKKRKERAQVAYERKKQLNKLRVKAEKTAEEKLGSQLDVLDPVKY  206



>ref|XP_010923627.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=246

 Score =   323 bits (827),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMK+ RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  70   KELLNGQRVVVVRCEEICLSGGLVRQKMKFLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  129

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK KRMVIPDALKVLRLQAGHKYCLLG+LS E
Sbjct  130  RGMIPHKTKRGAAALARLKAYEGVPPPYDKTKRMVIPDALKVLRLQAGHKYCLLGRLSKE  189

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYD I+ LE+KRK+R+Q AYERRKQL +LR+KAEKAAEE+LG+QL+IL+ +KY
Sbjct  190  VGWSHYDIIRELEDKRKQRSQVAYERRKQLARLRMKAEKAAEEKLGSQLNILAPLKY  246



>ref|XP_006650608.1| PREDICTED: 60S ribosomal protein L13a-4-like [Oryza brachyantha]
Length=206

 Score =   320 bits (821),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRT+
Sbjct  30   KELLNGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGQLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRKE+A+ AYERRKQLTKLRVKAEKAAEE+LG QL+IL+ +KY
Sbjct  150  VGWNYYDTIRELEEKRKEKAKLAYERRKQLTKLRVKAEKAAEEKLGPQLEILAPIKY  206



>gb|KDO61166.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=205

 Score =   320 bits (819),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVP PYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPAPYDKTKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTIKV   KRKERAQ AYERRKQL KLRVKAEKAAEERLG QL+I++ +KY
Sbjct  150  VGWNYYDTIKV-SKKRKERAQVAYERRKQLAKLRVKAEKAAEERLGPQLEIIAPIKY  205



>ref|XP_010527234.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   320 bits (819),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKER+QA YER+KQL KLR KAEK AE+ LG+Q+ +L+ VKY
Sbjct  150  VGWNHYDTIRELEIKRKERSQALYERKKQLNKLRAKAEKVAEDILGSQIAVLAPVKY  206



>ref|XP_002323772.1| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK95932.1| unknown [Populus trichocarpa]
 gb|EEF03905.1| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   320 bits (819),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKV+EGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVFEGVPPPYDKTKRMVIPDALKVLRLQPGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ  YER+KQL KLR+KAEK AEE+LG Q +I++ +KY
Sbjct  150  VGWNHYDTIKELETKRKERAQLVYERKKQLAKLRLKAEKTAEEKLGPQQEIIAPLKY  206



>ref|XP_010513787.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   320 bits (819),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QA YER+KQLTKLR KAEKAAEE+LG+QLD+L+S+KY
Sbjct  150  VGWNHYDTIKELETKRKERSQAVYERKKQLTKLRAKAEKAAEEKLGSQLDVLTSIKY  206



>ref|XP_006479280.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|KDO65928.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=206

 Score =   319 bits (818),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV VRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVP PYDKVKRMVIPDALKVLRLQ GHKYCLLG+L+SE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPAPYDKVKRMVIPDALKVLRLQKGHKYCLLGRLASE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRKER+Q AYER+KQL KLR KAEK AEE+LG+QLDIL+ VKY
Sbjct  150  VGWNYYDTIRELEKKRKERSQVAYERKKQLNKLRAKAEKVAEEKLGSQLDILAPVKY  206



>ref|NP_001130808.1| uncharacterized protein LOC100191912 [Zea mays]
 gb|ACG24933.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   319 bits (817),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRMVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYER+KQLTKLRVKAEKAAEE+LG+QL+IL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERKKQLTKLRVKAEKAAEEKLGSQLEILAPIKY  206



>ref|XP_003559332.1| PREDICTED: 60S ribosomal protein L13a-4 [Brachypodium distachyon]
Length=206

 Score =   318 bits (815),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYD+ KRMVIPDALKVLRLQAGHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQAGHKYCLLGQLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+ DTI+ LE KRKE+A+ AY+RRKQL KLRVKAEK AEE+LGTQL+IL+ +KY
Sbjct  150  VGWNYADTIRELEEKRKEKAKVAYDRRKQLAKLRVKAEKTAEEKLGTQLEILAPIKY  206



>gb|KHG00254.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   317 bits (813),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ++VVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKLVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVP PYDKVKRMVIPDALKVLRL  GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKSYEGVPSPYDKVKRMVIPDALKVLRLLKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKERAQ  YER+K+L KLRVKAEKA+E +LG+QLDIL+ VKY
Sbjct  150  VGWNHYDTIRELEKKRKERAQVTYERKKELNKLRVKAEKASEAKLGSQLDILAPVKY  206



>gb|ACF79169.1| unknown [Zea mays]
 tpg|DAA51453.1| TPA: ribosomal protein L13A-like protein [Zea mays]
Length=206

 Score =   317 bits (812),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRMVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYER+KQL KLRVKAEKAAEE+LG+QL+IL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERKKQLAKLRVKAEKAAEEKLGSQLEILAPIKY  206



>gb|KHN31417.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=204

 Score =   316 bits (809),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+V VVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  28   KELLNGQKVAVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  87

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMV+PDALKVLRLQ GHKYC+LG+LSSE
Sbjct  88   RGMIPHKTKRGEAALARLKVYEGIPPPYDKIKRMVVPDALKVLRLQKGHKYCILGRLSSE  147

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW++YDTI+ LE KRKE+AQ  YER+KQL KLRVKAEK AE++LG+QLDIL+ VKY
Sbjct  148  VGWSYYDTIRELEKKRKEKAQLVYERKKQLNKLRVKAEKVAEDKLGSQLDILAPVKY  204



>ref|XP_002439183.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
 gb|EES17613.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
Length=206

 Score =   316 bits (809),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KR+VIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRVVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYERRKQL KLRVKAEK AEE+LG+QL+IL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRVKAEKTAEEKLGSQLEILAPIKY  206



>ref|XP_008805147.1| PREDICTED: 60S ribosomal protein L13a-2-like [Phoenix dactylifera]
Length=206

 Score =   316 bits (809),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFR P+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRNPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKTKRMVIPDALKVLRLQTGHKYCLLGRLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRK+R+Q AYE RKQL +LR KAEK  EE+LG+QLDIL  +KY
Sbjct  150  VGWSHYDTIKELEEKRKQRSQVAYEGRKQLARLRQKAEKTTEEKLGSQLDILGPLKY  206



>ref|XP_007200528.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
 gb|EMJ01727.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
Length=206

 Score =   316 bits (809),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LLNGQR+ VVRC+EI +SGGLVRQKMKY RF RKRMNT+PSHGPIHFR+P+KI WRT+
Sbjct  30   KDLLNGQRIAVVRCDEIAISGGLVRQKMKYMRFRRKRMNTQPSHGPIHFRSPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLK YEG+PPPYDK KRMV+PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAEALARLKAYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNH+DTIK LE KRKERAQ AYER+KQLTKLR+KAEK+AEE+LG+QLDIL+SV Y
Sbjct  150  VGWNHFDTIKALEEKRKERAQLAYERKKQLTKLRLKAEKSAEEKLGSQLDILASVTY  206



>ref|XP_002466431.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
 gb|AAM47582.1| putative 60S ribosomal protein [Sorghum bicolor]
 gb|EER93429.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
Length=206

 Score =   316 bits (809),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KR+VIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRVVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYERRKQL KLRVKAEK AEE+LG+QL+IL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRVKAEKTAEEKLGSQLEILAPIKY  206



>ref|XP_011041875.1| PREDICTED: 60S ribosomal protein L13a-1-like [Populus euphratica]
Length=206

 Score =   316 bits (809),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKR NTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICISGGLVRQKMKYLRFLRKRTNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKV+EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVFEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKERAQ  YER+KQL KLR+KAEK AEE+LG Q +I++ +KY
Sbjct  150  VGWNHYDTIKELEKKRKERAQLVYERKKQLAKLRLKAEKTAEEKLGPQQEIIAPLKY  206



>ref|NP_001051314.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|AAR01683.1| putative ribosomal protein L13a [Oryza sativa Japonica Group]
 gb|ABF98951.1| 60S ribosomal protein L13a-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13228.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|EAY91906.1| hypothetical protein OsI_13588 [Oryza sativa Indica Group]
 gb|EAZ28629.1| hypothetical protein OsJ_12636 [Oryza sativa Japonica Group]
 dbj|BAG96308.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97551.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01442.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   315 bits (808),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFR+P+KILWRT+
Sbjct  30   KELLNGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRSPAKILWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGQLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRKE+A+ AY+RRKQL KLRVKAEKAAEE+LG QL+IL+ +KY
Sbjct  150  VGWNYYDTIRELEEKRKEKAKVAYDRRKQLAKLRVKAEKAAEEKLGPQLEILAPIKY  206



>ref|NP_001235102.1| uncharacterized protein LOC100499978 [Glycine max]
 gb|ACU14471.1| unknown [Glycine max]
Length=206

 Score =   315 bits (808),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK KRMV+PDALKVLRLQ GHKYC+LG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCVLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW++YDTI+ LE KRKE+A   YER+KQL KLRVKAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWSYYDTIRELEKKRKEKAAVVYERKKQLNKLRVKAEKVAEEKLGSQLDVLAPVKY  206



>ref|NP_001281205.1| 60S ribosomal protein L13a [Zea mays]
 gb|ACN25827.1| unknown [Zea mays]
 gb|AFW67581.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   315 bits (807),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KR+VIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRLVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYERRKQL KLR+KAE  AEE+LG+QLDIL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRLKAEATAEEKLGSQLDILTPIKY  206



>ref|XP_004981725.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X2 [Setaria 
italica]
Length=206

 Score =   315 bits (807),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFR+P+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRSPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYERRKQL KLRVKAEK AEE+LG+QL+IL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRVKAEKTAEEKLGSQLEILAPIKY  206



>gb|KDP26388.1| hypothetical protein JCGZ_17546 [Jatropha curcas]
Length=206

 Score =   315 bits (806),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFR P+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRNPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKAYEGVPPPYDKTKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKER+Q  YER+KQL KLR+KAE+ AEE+LG+QL++L+ VKY
Sbjct  150  VGWNHYDTIRELEKKRKERSQILYERKKQLNKLRLKAERVAEEKLGSQLEVLAPVKY  206



>ref|NP_001276138.1| 60S ribosomal protein L13a-4-like [Glycine max]
 gb|ACU20583.1| unknown [Glycine max]
Length=206

 Score =   315 bits (806),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPY K+KRMV+PDALKVLRLQ GHKYC+LG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYGKIKRMVVPDALKVLRLQKGHKYCILGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW++YDTI+ LE KRKE+AQ  YER+KQL KLRVKAEK AE++LG+QLDIL+ VKY
Sbjct  150  VGWSYYDTIRELEKKRKEKAQLVYERKKQLNKLRVKAEKVAEDKLGSQLDILAPVKY  206



>ref|XP_004499225.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
 ref|XP_004499231.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
Length=206

 Score =   314 bits (804),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVLVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMV+PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKIKRMVVPDALKVLRLQKGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTIK LE KRKER+Q AYER+KQL+KLR KAEK  +E+L  QL++L+ VKY
Sbjct  150  VGWNYYDTIKELEKKRKERSQLAYERKKQLSKLRAKAEKIVDEKLAPQLEVLAPVKY  206



>ref|XP_006586250.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
 gb|KHN07181.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=206

 Score =   314 bits (804),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPGKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK KRMV+PDALKVLRLQ GHKYC LG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCHLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRKERAQ  YER+KQL KLRVKAEK AEE+LG+Q++IL+ VKY
Sbjct  150  VGWNYYDTIRELEKKRKERAQLCYERKKQLAKLRVKAEKVAEEKLGSQIEILAPVKY  206



>ref|XP_010547080.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   313 bits (803),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKV+EGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVFEGVPPPYDKLKRMVIPDALKVLRLQAGHKYCLLGHLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKE++QA YER+KQL KLR KAEK AEE+LG+QLD+L+ VKY
Sbjct  150  VGWNHYDTIKELEKKRKEKSQAVYERKKQLNKLRAKAEKTAEEKLGSQLDVLAPVKY  206



>ref|XP_010685006.1| PREDICTED: 60S ribosomal protein L13a-2 [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   313 bits (803),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELL GQRVVV RCE I LSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLTGQRVVVTRCEAIALSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KR+V+PDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRVVVPDALKVLRLQKGHKYCLLGRLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKER++A YER+KQL +LRVKAEK AEE+LG+QL+IL+ VKY
Sbjct  150  VGWNHYDTIRELEEKRKERSKAVYERKKQLNRLRVKAEKTAEEKLGSQLEILAPVKY  206



>ref|XP_003616742.1| 60S ribosomal protein L13A [Medicago truncatula]
 gb|AES99700.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   313 bits (803),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTL  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMV+PDALKVLRLQ GHK+CLLG+LS+E
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKIKRMVVPDALKVLRLQKGHKFCLLGQLSAE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YD IK LENKRKER+Q AYE++KQ+ KLRVKAEK  +E+LG++L +L+ VKY
Sbjct  150  VGWNYYDIIKELENKRKERSQLAYEKKKQINKLRVKAEKIVDEKLGSELQVLAPVKY  206



>pdb|3J61|O Chain O, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50984.1| ribosomal protein L13a [Triticum aestivum]
 dbj|BAJ92402.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50837.1| 60S ribosomal protein L13a-4 [Triticum urartu]
 gb|EMT20078.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=206

 Score =   313 bits (802),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RG AALARLK YEGVPPPYD+ KRMVIPDALKVLRLQ GH+YCLLG+LS E
Sbjct  90   RGMIPHKTARGEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHRYCLLGQLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+ DTI+ LE KRKE+A+ +Y+RRKQL KLRVKAEKAAEE+LGTQL+IL+ +KY
Sbjct  150  VGWNYADTIRELEEKRKEKAKVSYDRRKQLAKLRVKAEKAAEEKLGTQLEILAPIKY  206



>gb|ACG36118.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   313 bits (802),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KR+VIPDALKVLRLQ GHKYCLLG+L  E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRLVIPDALKVLRLQPGHKYCLLGELXKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYERRKQL KLR+KAE  AEE+LG+QLDIL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRLKAEATAEEKLGSQLDILTPIKY  206



>ref|XP_011024678.1| PREDICTED: 60S ribosomal protein L13a-4-like [Populus euphratica]
Length=206

 Score =   313 bits (801),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTK+G AALARL+ YEG+PPPYDK KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKKGEAALARLRAYEGIPPPYDKKKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTI+ LE KRKER+Q  YER+KQL KLR KAE  AEE+LG Q+DIL+ VKY
Sbjct  150  VGWNHYDTIRELEEKRKERSQVRYERKKQLNKLRAKAEATAEEKLGPQVDILAPVKY  206



>ref|XP_007140600.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
 gb|AGV54439.1| 60S ribosomal protein L13a [Phaseolus vulgaris]
 gb|ESW12594.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
Length=206

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPGKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AAL RLKVYEG+PPPYDK KRMV+PDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGEAALDRLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRK+RA   YER+KQL KLRVKAEK AEE+LG+Q++IL+ VKY
Sbjct  150  VGWNYYDTIRELEKKRKDRALLCYERKKQLAKLRVKAEKVAEEKLGSQIEILAPVKY  206



>ref|XP_008235481.1| PREDICTED: 60S ribosomal protein L13a-1-like [Prunus mume]
Length=206

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LLNGQR+ VVR +EI +SGGLVRQKMKY RF RKRMNT+PSHGPIHFR+P+KI WRT+
Sbjct  30   KDLLNGQRIAVVRSDEIAISGGLVRQKMKYMRFRRKRMNTQPSHGPIHFRSPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLK YEG+PPPYDK KRMV+PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAEALARLKAYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNH+DTIK LE KRKERAQ AYER+KQLTKLR+KAEK+AEERLG+QL+IL+SV Y
Sbjct  150  VGWNHFDTIKALEEKRKERAQLAYERKKQLTKLRLKAEKSAEERLGSQLEILASVTY  206



>gb|AFK34830.1| unknown [Medicago truncatula]
Length=206

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKP+HGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPNHGPIHFRAPSKIFWRTL  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMV+PDALKVLRLQ GHK+CLLG+LS+E
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKIKRMVVPDALKVLRLQKGHKFCLLGQLSAE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YD IK LENKRKER+Q AYE++KQ+ KLRVKAEK  +E+LG++L +L+ VKY
Sbjct  150  VGWNYYDIIKELENKRKERSQLAYEKKKQINKLRVKAEKIVDEKLGSELQVLAPVKY  206



>gb|ACG33474.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   311 bits (798),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSH PIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHRPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KR+VIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRLVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYERRKQL KLR+KAE  AEE+LG+QLDIL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRLKAEATAEEKLGSQLDILTPIKY  206



>gb|AAR89618.1| 60S ribosomal protein L13a [Capsicum annuum]
Length=220

 Score =   312 bits (799),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEK  187
            VGWNHYDTIK LE+KRKERAQ  YERRKQL KLRVKAE+
Sbjct  150  VGWNHYDTIKELEDKRKERAQVTYERRKQLAKLRVKAER  188



>ref|XP_002301785.2| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK92693.1| unknown [Populus trichocarpa]
 gb|ABK94779.1| unknown [Populus trichocarpa]
 gb|EEE81058.2| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   311 bits (796),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTK+G AALARLK YEG+PPPYDK KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKKGEAALARLKAYEGIPPPYDKKKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYD I+ LE KRKER+Q  YER+KQL KLR KAE  AEE+LG Q+DIL+ VKY
Sbjct  150  VGWNHYDIIRELEEKRKERSQVRYERKKQLNKLRAKAEVTAEEKLGPQVDILAPVKY  206



>ref|XP_006443602.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
 gb|ESR56842.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
Length=382

 Score =   317 bits (812),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV VRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  206  KELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  265

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVP PYDKVKRMVIPDALKVLRLQ GHKYCLLG+L+SE
Sbjct  266  RGMIPHKTKRGAAALARLKAYEGVPAPYDKVKRMVIPDALKVLRLQKGHKYCLLGRLASE  325

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRKER+Q AYER+KQL KLR KAEK AEE+LG+QLDIL+ VKY
Sbjct  326  VGWNYYDTIRELEKKRKERSQVAYERKKQLNKLRAKAEKVAEEKLGSQLDILAPVKY  382



>gb|KCW58066.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=240

 Score =   312 bits (799),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 167/211 (79%), Gaps = 34/211 (16%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQRVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK-------------------  361
            RGMIPHKTKRGA ALARLK YEGVPPPYDK KRMVIPDALK                   
Sbjct  90   RGMIPHKTKRGAGALARLKAYEGVPPPYDKTKRMVIPDALKYVSCFHLCCVHFGTVFSVV  149

Query  360  ---------------VLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYER  226
                           VLRLQ GHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQA YER
Sbjct  150  AYVNLMCNLHCDLYRVLRLQKGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQAVYER  209

Query  225  RKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            +KQLTKLRVKAEK AEE+LG+Q+DIL++VKY
Sbjct  210  KKQLTKLRVKAEKVAEEKLGSQVDILATVKY  240



>ref|XP_007147486.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
 gb|ESW19480.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
Length=206

 Score =   310 bits (793),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AAL RLKVYEG+PPPYDK KRMV+PDALKVLRLQ GHKYC+LG+LSSE
Sbjct  90   RGMIPHKTKRGEAALDRLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCVLGRLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW++YDTI+ LE KRK++A   YER+KQL KLRVKAEK A+E+LG+QLDIL+ VKY
Sbjct  150  VGWSYYDTIRELEKKRKDKAGLVYERKKQLNKLRVKAEKVADEKLGSQLDILAPVKY  206



>ref|NP_001058724.1| Os07g0109500 [Oryza sativa Japonica Group]
 dbj|BAC79560.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAD30642.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAF20638.1| Os07g0109500 [Oryza sativa Japonica Group]
 gb|EAZ02520.1| hypothetical protein OsI_24624 [Oryza sativa Indica Group]
 dbj|BAG88872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95855.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   310 bits (793),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEE+C+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+I WRT+
Sbjct  30   KELLNGQRVVVVRCEEMCISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RG AALA LK ++GVPPPYD+ KRMV+PDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTPRGEAALANLKAFDGVPPPYDRTKRMVVPDALKVLRLQPGHKYCLLGQLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYERRKQLT+LRVKAEKAAEE+LG+Q+DIL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLTRLRVKAEKAAEEKLGSQIDILAPIKY  206



>ref|XP_003546257.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
Length=206

 Score =   310 bits (793),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+V VVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVAVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK KRMV+PDALKVLRLQ GHKYC+LG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCVLGRLSPE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW++YDTI+ LE KRKE+A+  Y R+KQL KLRVKAEK AEE+LG+QLD+L++VKY
Sbjct  150  VGWSYYDTIRELEKKRKEKAELVYARKKQLNKLRVKAEKVAEEKLGSQLDVLAAVKY  206



>gb|KHN07182.1| 60S ribosomal protein L13a-1 [Glycine soja]
Length=206

 Score =   309 bits (792),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPGKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK KRMV+PDALKVLRLQ GHKYC LG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCHLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRKERAQ  YER+KQL KLR KAEK AE++LG+Q++IL+ VKY
Sbjct  150  VGWNYYDTIRELEKKRKERAQLCYERKKQLAKLREKAEKVAEKKLGSQIEILAPVKY  206



>gb|ABQ57364.1| ribosomal protein L13A [Lupinus luteus]
Length=206

 Score =   308 bits (790),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VR EEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVIVRSEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG  ALARLKVYEG+PPP+DK KR+V+PDALK LRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEHALARLKVYEGIPPPFDKQKRLVVPDALKGLRLQKGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTIK LE KRKER+Q  YER+KQL KLRVKAE+ A+E+LG+QLDIL+ VKY
Sbjct  150  VGWNYYDTIKELEKKRKERSQVVYERKKQLNKLRVKAEQVAQEKLGSQLDILAPVKY  206



>ref|NP_001236202.1| uncharacterized protein LOC100527190 [Glycine max]
 gb|ACU16241.1| unknown [Glycine max]
Length=206

 Score =   308 bits (789),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPGKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK KRMV+PDALKVLRLQ GHKYC LG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCHLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTI+ LE KRK+RAQ  YER+KQL KLR KAEK AE++LG+Q++IL+ VKY
Sbjct  150  VGWNYYDTIRELEKKRKDRAQLCYERKKQLAKLREKAEKVAEKKLGSQIEILAPVKY  206



>ref|XP_010228462.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brachypodium distachyon]
Length=206

 Score =   308 bits (789),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEI +SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+I WRT+
Sbjct  30   KELLNGQRVVVVRCEEISVSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RG AALARLK YEGVPPP+D+ KRMVIPDALKVLRLQAGHKYC LG+LS E
Sbjct  90   RGMIPHKTPRGEAALARLKAYEGVPPPFDRTKRMVIPDALKVLRLQAGHKYCQLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+ DTI+ LE KRKE+A+ +Y+RRKQL KLRVKAEKAAEE+LG+QLDIL+ +KY
Sbjct  150  VGWNYQDTIRELEEKRKEKAKVSYDRRKQLAKLRVKAEKAAEEKLGSQLDILAPIKY  206



>ref|XP_009334926.1| PREDICTED: 60S ribosomal protein L13a-1-like [Pyrus x bretschneideri]
Length=206

 Score =   307 bits (787),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LLNGQ + VVR E+I +SGGLVRQKMKY RFLRKRMNT+PSHGPIH+R+P+KI WRT+
Sbjct  30   KDLLNGQPIAVVRAEQIAISGGLVRQKMKYMRFLRKRMNTQPSHGPIHYRSPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKVYEG+PPPYDK KRM +PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAEALARLKVYEGIPPPYDKTKRMAVPDALKVLRLQKGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ AYER+K+LTKLR+K+EK+AEE++G+QL++LSSV Y
Sbjct  150  VGWNHYDTIKELENKRKERAQLAYERKKRLTKLRLKSEKSAEEKIGSQLELLSSVTY  206



>ref|XP_008365936.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=206

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LLNGQ + VVR E+I +SGGLVRQKMKY RFLRKRMNT+PSHGPIH+R+P+KI WRT+
Sbjct  30   KDLLNGQPIAVVRAEQIAISGGLVRQKMKYMRFLRKRMNTQPSHGPIHYRSPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKVYEG+P PYDK KRMV+PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAEALARLKVYEGIPXPYDKTKRMVVPDALKVLRLQKGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LENKRKERAQ  YER+KQLTKLR+KAEK+AEE++G+QL++LSSV Y
Sbjct  150  VGWNHYDTIKELENKRKERAQLXYERKKQLTKLRLKAEKSAEEKIGSQLELLSSVTY  206



>gb|EAZ38446.1| hypothetical protein OsJ_22825 [Oryza sativa Japonica Group]
Length=206

 Score =   306 bits (784),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEE+C+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+I WRT+
Sbjct  30   KELLNGQRVVVVRCEEMCISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RG AALA LK ++GVP PYD+ KRMV+PDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTPRGEAALANLKAFDGVPLPYDRTKRMVVPDALKVLRLQPGHKYCLLGQLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+A+ AYERRKQLT+LRVKAEKAAEE+LG+Q+DIL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLTRLRVKAEKAAEEKLGSQIDILAPIKY  206



>gb|ACG48503.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   306 bits (784),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK K MVIPDALKVLRLQ GHKYCLLG+L  E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKXMVIPDALKVLRLQPGHKYCLLGELXKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN +D I+ LE KRKE+A+ AYER+KQL KLRVKAEKAAEE+LG QL+I + +KY
Sbjct  150  VGWNXHDXIRELEEKRKEKAKVAYERKKQLAKLRVKAEKAAEEKLGXQLEIXAPIKY  206



>gb|ACG37566.1| 60S ribosomal protein L13a [Zea mays]
Length=222

 Score =   304 bits (779),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KR+VIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRLVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILS  145
            VGWN++DTI+ LE KRKE+A+ AYERRKQL KLR+KAE  AEE+LG+QL I S
Sbjct  150  VGWNYHDTIRELEEKRKEKAKVAYERRKQLAKLRLKAEATAEEKLGSQLAISS  202



>ref|XP_006657401.1| PREDICTED: 60S ribosomal protein L13a-3-like [Oryza brachyantha]
Length=206

 Score =   301 bits (772),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEE+C+SGG VRQKMKY RFLRKRMNTKPSHGPIHFRAPS+I WRT+
Sbjct  30   KELLNGQRVVVVRCEEMCVSGGPVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RG AALA LK + GVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG LS E
Sbjct  90   RGMIPHKTPRGEAALAALKAFGGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGHLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN++DTI+ LE KRKE+ + AYERRKQL KLR KAEKAAEE+LG+QLDIL+ +KY
Sbjct  150  VGWNYHDTIRELEEKRKEKGKVAYERRKQLAKLRFKAEKAAEEKLGSQLDILAPIKY  206



>gb|ACJ83838.1| unknown [Medicago truncatula]
 gb|AFK37771.1| unknown [Medicago truncatula]
 gb|KEH22805.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   301 bits (770),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEIC SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVLVRCEEICASGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALAR+KVYEG+PPPYDK+KRMV+PDALKVLRLQ GHKYC LG+LS+E
Sbjct  90   RGMIPHKTKRGEAALARMKVYEGIPPPYDKIKRMVVPDALKVLRLQKGHKYCSLGQLSAE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+  TIK LE KRKERA AAYE++KQ+ KLR KAEK  +E+L  QL+IL+ VKY
Sbjct  150  VGWNYAGTIKELETKRKERAFAAYEKKKQINKLRAKAEKIVDEKLAPQLEILAPVKY  206



>sp|O49885.1|RL13A_LUPLU RecName: Full=60S ribosomal protein L13a [Lupinus luteus]
 emb|CAA11283.1| ribosomal protein L13a [Lupinus luteus]
Length=205

 Score =   300 bits (769),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VR EEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIH  APSKI WRT+
Sbjct  30   KELLNGQKVVIVRSEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHC-APSKIFWRTV  88

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG  ALARLKVYEG+PPP+DK KR+V+PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  89   RGMIPHKTKRGEHALARLKVYEGIPPPFDKQKRLVVPDALKVLRLQKGHKYCLLGQLSSE  148

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+YDTIK LE KRKER+Q  YER+KQL KLRVKAE+ A+E+LG+QLDIL+ VKY
Sbjct  149  VGWNYYDTIKELEKKRKERSQVVYERKKQLNKLRVKAEQVAQEKLGSQLDILAPVKY  205



>ref|XP_003589380.1| 60S ribosomal protein L13a [Medicago truncatula]
 gb|ACJ85949.1| unknown [Medicago truncatula]
 gb|AES59631.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
 gb|AFK44083.1| unknown [Medicago truncatula]
Length=206

 Score =   298 bits (762),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV+VRCEEIC SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  30   KELLNGQKVVLVRCEEICASGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLKVYEG+PPPYDK+KRMV+PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGEAALARLKVYEGIPPPYDKIKRMVVPDALKVLRLQKGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+   IK LE+KRKERA  AYE++K L KLR KAEK  +E+L  QL++L+ VKY
Sbjct  150  VGWNYGGIIKELEDKRKERAGLAYEKKKLLNKLRAKAEKIVDEKLAPQLEVLAPVKY  206



>sp|O65055.1|RL13A_PICMA RecName: Full=60S ribosomal protein L13a [Picea mariana]
 gb|AAC32117.1| probable 60s ribosomal protein L13a [Picea mariana]
Length=206

 Score =   295 bits (756),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELL+GQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+ILWRTI
Sbjct  30   KELLHGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALA L+ +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALATLRAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+H+DTI  LE KRK +AQ +YERRKQL KLR KA + AE++L  ++++L+S+KY
Sbjct  150  VGWHHFDTITELEEKRKAKAQVSYERRKQLAKLRSKAVELAEKQLAPEMELLASLKY  206



>ref|XP_004981724.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X1 [Setaria 
italica]
Length=241

 Score =   296 bits (757),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 165/212 (78%), Gaps = 35/212 (17%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFR+P+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRSPAKILWRTI  89

Query  483  RG-----------------------------------MIPHKTKRGAAALARLKVYEGVP  409
            RG                                   MIPHKTKRG AALARLK YEGVP
Sbjct  90   RGYVSSFLDPSPVRRRCFDVPIFQFVGEIFCLLWFCRMIPHKTKRGEAALARLKTYEGVP  149

Query  408  PPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYE  229
            PPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI+ LE KRKE+A+ AYE
Sbjct  150  PPYDRTKRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTIRELEEKRKEKAKVAYE  209

Query  228  RRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            RRKQL KLRVKAEK AEE+LG+QL+IL+ +KY
Sbjct  210  RRKQLAKLRVKAEKTAEEKLGSQLEILAPIKY  241



>dbj|BAK07924.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   295 bits (756),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEE+C+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+
Sbjct  74   KELLNGQRVVVVRCEEMCISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTV  133

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RG AALARLK +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  134  RGMIPHKTPRGEAALARLKAFEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGELSKE  193

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+++TIK LE KRKE+A+ +Y+RRKQL KLRVKAEKAAEE+LG+QLDIL+ +KY
Sbjct  194  VGWNYHETIKELEEKRKEKAKVSYDRRKQLAKLRVKAEKAAEEKLGSQLDILAPIKY  250



>gb|EMS52180.1| 60S ribosomal protein L13a-4 [Triticum urartu]
Length=206

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEE+C+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+I WRT+
Sbjct  30   KELLNGQRVVVVRCEEMCISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RG AALARLK +EGVPPPYD+ KRMVIPDALKVLRLQ GH++CLLG+LS E
Sbjct  90   RGMIPHKTPRGEAALARLKAFEGVPPPYDRTKRMVIPDALKVLRLQPGHRFCLLGELSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+++TIK LE KRKE+A+ +Y+RRKQL KLR KAEKAAEE+LG+QLDIL+ +KY
Sbjct  150  VGWNYHETIKELEEKRKEKAKVSYDRRKQLAKLRFKAEKAAEEKLGSQLDILAPIKY  206



>gb|EMT05694.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=238

 Score =   288 bits (738),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 164/209 (78%), Gaps = 32/209 (15%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEE+C+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+I WRT+
Sbjct  30   KELLNGQRVVVVRCEEMCISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RG AALARLK +EGVPPPYD+ KRMVIPDALKVLRLQ GH++CLLG+LS E
Sbjct  90   RGMIPHKTPRGEAALARLKAFEGVPPPYDRTKRMVIPDALKVLRLQPGHRFCLLGELSKE  149

Query  303  VGWNHYDTIKV--------------------------------LENKRKERAQAAYERRK  220
            VGWN+++TIK+                                LE KRKE+A+ +Y+R+K
Sbjct  150  VGWNYHETIKLMAIDHQDLQRDVRFLIGGLFLILDLSACLENELEEKRKEKAKLSYDRKK  209

Query  219  QLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            QL KLR+KAE AAEE+LG+QLDIL+ +KY
Sbjct  210  QLAKLRIKAENAAEEKLGSQLDILAPIKY  238



>ref|XP_001765352.1| predicted protein [Physcomitrella patens]
 gb|EDQ69815.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   285 bits (729),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPS GPIHFR+P++ILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSKGPIHFRSPARILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLK +EGVP PYDK+KRMVIPDALKVLRL+ GHK+CLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALERLKAFEGVPAPYDKMKRMVIPDALKVLRLKPGHKFCLLGRLSEE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRK +++  YER+KQL +LR+KA K  EE+LG+  + L+ + Y
Sbjct  150  VGWHHYDTIKELEEKRKAKSKVFYERKKQLIQLRLKAAKRVEEQLGSLQETLAPITY  206



>ref|XP_001774253.1| predicted protein [Physcomitrella patens]
 gb|EDQ60889.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPS GPIHFR+P++ILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSKGPIHFRSPARILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLK +EGVP PYDK+KRMVIPDALKVLRLQ GHK+CLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALERLKAFEGVPAPYDKMKRMVIPDALKVLRLQPGHKFCLLGRLSEE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRK ++   YER+KQL +LR+KA K  EE+L +  + L+ + Y
Sbjct  150  VGWHHYDTIKELEEKRKAKSNVFYERKKQLIQLRLKATKRVEEQLSSLQETLAPITY  206



>ref|XP_001763759.1| predicted protein [Physcomitrella patens]
 gb|EDQ71401.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   284 bits (727),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ++VVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPS GPIHFR+P++ILWRTI
Sbjct  30   KELLNGQKIVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSKGPIHFRSPARILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLK +EGVP PYDK+KRMVIPDALKVLRLQ GHK+CLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALERLKAFEGVPAPYDKMKRMVIPDALKVLRLQPGHKFCLLGRLSEE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRK +++  YER+KQL +LR+KA K+ EE+L    + L+ + Y
Sbjct  150  VGWHHYDTIKELEEKRKAKSKVFYERKKQLIQLRLKAAKSVEEQLAPLQETLAPITY  206



>ref|XP_004955326.1| PREDICTED: 60S ribosomal protein L13a-3-like [Setaria italica]
Length=200

 Score =   283 bits (724),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELL GQRV V+RCEE+ LSGGLVRQK ++ RFLRKRMNTKPSHGP+H R+P++I WR +
Sbjct  24   KELLKGQRVAVLRCEEMTLSGGLVRQKSRFLRFLRKRMNTKPSHGPVHHRSPARIFWRAV  83

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKT RG AALARL+ ++GVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG LS E
Sbjct  84   RGMVPHKTARGEAALARLQAFDGVPPPYDRTKRMVIPDALKVLRLQKGHKYCLLGDLSKE  143

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWN+ DTI+ LE KRKE+A+ AY+R+KQL KLRVKAEK AEE+LG+QLD+L+ V Y
Sbjct  144  VGWNYQDTIRELEEKRKEKAKVAYDRKKQLAKLRVKAEKVAEEKLGSQLDVLAPVTY  200



>gb|KGN66498.1| hypothetical protein Csa_1G615170 [Cucumis sativus]
Length=202

 Score =   283 bits (723),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 158/177 (89%), Gaps = 4/177 (2%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+   Y+ V   ++    +VLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGL-CIYELV---MLVWKFRVLRLQAGHKYCLLGRLSSE  145

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGWNHYDTIK LE KRKER+QAAYER+KQL KLR+KAEK AEE+LG QL++++ +KY
Sbjct  146  VGWNHYDTIKELERKRKERSQAAYERKKQLNKLRIKAEKVAEEKLGPQLEVIAPIKY  202



>gb|ABK22228.1| unknown [Picea sitchensis]
 gb|ABK22389.1| unknown [Picea sitchensis]
 gb|ABK22608.1| unknown [Picea sitchensis]
 gb|ABK23686.1| unknown [Picea sitchensis]
 gb|ABK23694.1| unknown [Picea sitchensis]
 gb|ABK26243.1| unknown [Picea sitchensis]
 gb|ABK26404.1| unknown [Picea sitchensis]
 gb|ABR17228.1| unknown [Picea sitchensis]
 gb|ACN40291.1| unknown [Picea sitchensis]
 gb|ACN40454.1| unknown [Picea sitchensis]
 gb|ACN40588.1| unknown [Picea sitchensis]
 gb|ACN40688.1| unknown [Picea sitchensis]
 gb|ADE77397.1| unknown [Picea sitchensis]
Length=206

 Score =   282 bits (722),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELL+GQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+ILWRTI
Sbjct  30   KELLHGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARL+ +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALARLRAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+H+DTI  LE KRK +AQ +YERRKQL KLR KA + AE++L  ++++L+S+KY
Sbjct  150  VGWHHFDTITELEEKRKAKAQVSYERRKQLAKLRSKAVELAEKQLAPEMELLASLKY  206



>ref|XP_001765905.1| predicted protein [Physcomitrella patens]
 gb|EDQ69226.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   281 bits (720),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVR EEICLSGGLVRQKMKY RFLRKRMNTKPS GPIHFR+P++ILWRTI
Sbjct  30   KELLNGQKVVVVRSEEICLSGGLVRQKMKYLRFLRKRMNTKPSKGPIHFRSPARILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLK +EGVP PYDK+KRMVIPDALKVLRLQ GHK+CLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALERLKAFEGVPAPYDKMKRMVIPDALKVLRLQPGHKFCLLGRLSEE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRK +++  Y+R+KQL +LR+KA K  EE+LG+  + L+ + Y
Sbjct  150  VGWHHYDTIKELEEKRKAKSKVFYQRKKQLLQLRLKAAKRVEEQLGSLQETLAPITY  206



>ref|XP_001773626.1| predicted protein [Physcomitrella patens]
 gb|EDQ61514.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   281 bits (719),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVR EEICLSGGLVRQKMKY RFLRKRMNTKPS GPIHFR+P++ILWRTI
Sbjct  30   KELLNGQKVVVVRSEEICLSGGLVRQKMKYLRFLRKRMNTKPSKGPIHFRSPARILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLK +EGVP PYDK+KRMVIPDALKVLRLQ GHK+CLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALERLKAFEGVPAPYDKMKRMVIPDALKVLRLQPGHKFCLLGRLSEE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+HYDTIK LE KRK +++  YER+KQL +LR+KA K  EE+L +  + L+ + Y
Sbjct  150  VGWHHYDTIKELEEKRKAKSKVFYERKKQLIQLRLKATKRVEEQLSSLQETLAPITY  206



>gb|AAX92709.1| 60S ribosomal protein L13a [Picea abies]
Length=170

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  642  RVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHK  463
            RVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHK
Sbjct  1    RVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHK  60

Query  462  TKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYD  283
            TKRGAAALARL+ +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+D
Sbjct  61   TKRGAAALARLRAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFD  120

Query  282  TIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            TI  LE KRK +AQ +YERRKQL KLR KA + AE++L  ++++L+S+K+
Sbjct  121  TITELEEKRKAKAQVSYERRKQLAKLRSKAVELAEKQLAPEMELLASLKH  170



>ref|XP_002964465.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
 ref|XP_002975331.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ23532.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ34798.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
Length=206

 Score =   268 bits (686),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQR+V+ RCEEI LSGGLVRQKMKY RFLRKRMNTKPS GPIHFRAP++ILWRTI
Sbjct  30   KELLNGQRLVITRCEEIALSGGLVRQKMKYLRFLRKRMNTKPSKGPIHFRAPARILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL RLKV+EG PPPYDK K+MV+PDALKVLRL+ GHK+CLLG+LS E
Sbjct  90   RGMIPHKTKRGAAALERLKVFEGCPPPYDKTKKMVVPDALKVLRLKPGHKFCLLGQLSKE  149

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW+H++TIK LE KRK +A   Y+++K+L KLR KA  AAEE+L     +L  + Y
Sbjct  150  VGWHHHETIKELEEKRKAKALVFYQKKKELLKLRQKALTAAEEKLPEVKAVLDPLSY  206



>emb|CBI37325.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   265 bits (677),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  552  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  373
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIP  60

Query  372  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  193
            DALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI+ LE KRKERAQ AYER+KQLTKLRVKA
Sbjct  61   DALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIRELEKKRKERAQLAYERKKQLTKLRVKA  120

Query  192  EKAAEERLGTQLDILSSVKY  133
            EK AEE+L TQLDIL++VKY
Sbjct  121  EKVAEEKLSTQLDILAAVKY  140



>gb|KHN23001.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=150

 Score =   263 bits (673),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  582  MKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPP  403
            MKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPP
Sbjct  1    MKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPP  60

Query  402  YDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERR  223
            YDK KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI+ LE KRKE+A   YER+
Sbjct  61   YDKTKRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIRELEKKRKEKAAVVYERK  120

Query  222  KQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            KQL KLRVKAEK AEE+LG+QLD+L+ VKY
Sbjct  121  KQLNKLRVKAEKVAEEKLGSQLDVLAPVKY  150



>emb|CDO99456.1| unnamed protein product [Coffea canephora]
Length=140

 Score =   262 bits (670),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  552  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  373
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGIPPPYDKIKRMVIP  60

Query  372  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  193
            DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI+ LE KRKERAQ AY+R+KQLT+LR+KA
Sbjct  61   DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIRELEKKRKERAQVAYQRKKQLTQLRIKA  120

Query  192  EKAAEERLGTQLDILSSVKY  133
            EKAAEE+LG QL++++ +KY
Sbjct  121  EKAAEEKLGPQLEVIAPIKY  140



>gb|KCW57253.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=181

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQRVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK +EGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKTFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKV  271
            VGWNHY+TIKV
Sbjct  150  VGWNHYETIKV  160



>ref|XP_006855707.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
 gb|ERN17174.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
Length=171

 Score =   262 bits (669),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAAL+RLKVYEGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALSRLKVYEGVPPPYDKKKRMVIPDALKVLRLQPGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKVL  268
            VGWNHYDTIKV+
Sbjct  150  VGWNHYDTIKVI  161



>ref|XP_007223448.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 gb|EMJ24647.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=187

 Score =   262 bits (669),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKV  271
            VGWNHY+TIKV
Sbjct  150  VGWNHYETIKV  160



>gb|KJB72097.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=169

 Score =   259 bits (661),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICISGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLGKLSSE
Sbjct  90   RGMIPHKTKRGAAALARLKTYEGIPAPYDKMKRMVIPDALKVLRLQKGHKYCLLGKLSSE  149

Query  303  VGWNHYDTIKV  271
            VGWNHYDTIKV
Sbjct  150  VGWNHYDTIKV  160



>gb|AIC33046.1| 60S ribosomal protein L13a, partial [Panax ginseng]
Length=157

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 127/128 (99%), Gaps = 0/128 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLKVYEGVPPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LS+E
Sbjct  90   RGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSAE  149

Query  303  VGWNHYDT  280
            VGWN+YDT
Sbjct  150  VGWNYYDT  157



>gb|KCW58067.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=174

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQRVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLK YEGVPPPYDK KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAGALARLKAYEGVPPPYDKTKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKV  271
            VGWNHYDTI+V
Sbjct  150  VGWNHYDTIRV  160



>emb|CBI17324.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   256 bits (654),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  552  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  373
            MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+KRMVIP
Sbjct  1    MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKMKRMVIP  60

Query  372  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  193
            DALKVLRLQAGHKYCLLG+LSSEVGWNHY+TIK LE KRKERA+ AYER+KQL KLRVKA
Sbjct  61   DALKVLRLQAGHKYCLLGRLSSEVGWNHYETIKELEKKRKERAELAYERKKQLNKLRVKA  120

Query  192  EKAAEERLGTQLDILSSVKY  133
            EKAA ++LG+QLD+++ +KY
Sbjct  121  EKAAVDKLGSQLDVIAPIKY  140



>gb|KJB22645.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=173

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEG+P PYDK+KRMVIPDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGIPSPYDKIKRMVIPDALKVLRLQKGHKYCLLGRLSSE  149

Query  303  VGWNHYDTIKV  271
            VGWNHYDTI+V
Sbjct  150  VGWNHYDTIRV  160



>gb|AFK39539.1| unknown [Lotus japonicus]
Length=140

 Score =   253 bits (645),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  552  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  373
            MNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKVYEG+PPPYDKVKRMV+P
Sbjct  1    MNTKPSHGPIHFRAPSKIFWRTLRGMIPHKTKRGAAALERLKVYEGIPPPYDKVKRMVVP  60

Query  372  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  193
            DALKVLRLQ GHKYCLLGKLSSEVGWN+YDTI+ LE KRK++AQ  YER+KQL KLRVKA
Sbjct  61   DALKVLRLQKGHKYCLLGKLSSEVGWNYYDTIRELEKKRKDKAQVVYERKKQLNKLRVKA  120

Query  192  EKAAEERLGTQLDILSSVKY  133
            EK A+E+LG+QLDIL+ VKY
Sbjct  121  EKVADEKLGSQLDILAPVKY  140



>ref|XP_004168353.1| PREDICTED: 60S ribosomal protein L13a-3-like, partial [Cucumis 
sativus]
Length=137

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  543  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  364
            KPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+KRMVIPDAL
Sbjct  1    KPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKMKRMVIPDAL  60

Query  363  KVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKA  184
            KVLRLQAGHKYCLLG+LSSEVGWNHYDTIK LE KRKER+QAAYER+KQL KLR+KAEK 
Sbjct  61   KVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELERKRKERSQAAYERKKQLNKLRIKAEKV  120

Query  183  AEERLGTQLDILSSVKY  133
            AEE+LG QL++++ +KY
Sbjct  121  AEEKLGPQLEVIAPIKY  137



>gb|KDO65929.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=179

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VV VRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAP+KI WRT+
Sbjct  30   KELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGAAALARLK YEGVP PYDKVKRMVIPDALKVLRLQ GHKYCLLG+L+SE
Sbjct  90   RGMIPHKTKRGAAALARLKAYEGVPAPYDKVKRMVIPDALKVLRLQKGHKYCLLGRLASE  149

Query  303  VGWNHYDTIKV  271
            VGWN+YDTI+V
Sbjct  150  VGWNYYDTIRV  160



>gb|ACN36734.1| unknown [Zea mays]
 gb|AFW67580.1| hypothetical protein ZEAMMB73_211853 [Zea mays]
Length=179

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQ+VVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTI
Sbjct  30   KELLNGQKVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTI  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRG AALARLK YEGVPPPYDK KR+VIPDALKVLRLQ GHKYCLLG+LS E
Sbjct  90   RGMIPHKTKRGEAALARLKTYEGVPPPYDKTKRLVIPDALKVLRLQPGHKYCLLGELSKE  149

Query  303  VGWNHYDTIKV  271
            VGWN++DTI+V
Sbjct  150  VGWNYHDTIRV  160



>ref|XP_010661466.1| PREDICTED: 60S ribosomal protein L13a-2-like [Vitis vinifera]
Length=249

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  624  CEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA  445
            CEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA
Sbjct  121  CEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA  180

Query  444  ALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKVLE  265
             LARLK YEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LS EVGWNHYDTI+ LE
Sbjct  181  TLARLKAYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSLEVGWNHYDTIRELE  240

Query  264  NKRKERAQA  238
             KRKER  A
Sbjct  241  KKRKERRLA  249



>ref|XP_008382629.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=161

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LLNGQ + VVR E+I +SGGLVRQKMKY RFLRKRMNT+PSHGPIH+R+P+KI WRT+
Sbjct  30   KDLLNGQPIAVVRAEQIAISGGLVRQKMKYMRFLRKRMNTQPSHGPIHYRSPAKIFWRTV  89

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTKRGA ALARLKVYEG+P PYDK KRMV+PDALKVLRLQ GHKYCLLG+LSSE
Sbjct  90   RGMIPHKTKRGAEALARLKVYEGIPXPYDKTKRMVVPDALKVLRLQKGHKYCLLGQLSSE  149

Query  303  VGWNHYDTIKV  271
            VGWNHYDTIKV
Sbjct  150  VGWNHYDTIKV  160



>ref|XP_002953387.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45697.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=185

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L+GQ++VVVR E+I +SGGLVRQKMKY RFLRKRMNT P+ GP HFRAPS+I WRT+
Sbjct  23   KQILSGQQIVVVRAEDITISGGLVRQKMKYDRFLRKRMNTNPTRGPFHFRAPSRIFWRTV  82

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RGAAAL RLK +EGVP PYDKVKRMV+PDALKVLRLQ GH+ C LG LS+ 
Sbjct  83   RGMIPHKTARGAAALERLKAFEGVPHPYDKVKRMVVPDALKVLRLQHGHRCCKLGDLSAA  142

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  193
            VGW H   +  LE KRK +A+A Y  +K+L  LRVKA
Sbjct  143  VGWKHQAAVAELEEKRKAKAKAFYVAKKKLIALRVKA  179



>ref|XP_001692909.1| ribosomal protein L13a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP03478.1| ribosomal protein L13a [Chlamydomonas reinhardtii]
Length=185

 Score =   228 bits (581),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L GQ++VVVR EEI +SGGLVRQKMKY RFLRKRMNT P+ GP HFRAPS+I WRT+
Sbjct  23   KQILAGQQIVVVRAEEITISGGLVRQKMKYDRFLRKRMNTNPTRGPFHFRAPSRIFWRTV  82

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RGAAAL RLK +EG+P PYDKVKR+V+PDALKVLRLQ GH+ C LG LS+ 
Sbjct  83   RGMIPHKTARGAAALERLKAFEGIPHPYDKVKRLVVPDALKVLRLQHGHRNCKLGDLSAS  142

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKA  193
            VGW H   +  LE KRK +A+A Y  +K+L  LR KA
Sbjct  143  VGWKHQAAVAELEEKRKAKAKAFYVAKKKLVALRSKA  179



>ref|XP_005849945.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
 gb|EFN57843.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
Length=180

 Score =   224 bits (570),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LL+GQ VV VRCEEI +SGG+VRQK KY RFLRKR  T P  G + FRAPS+ILWRT+
Sbjct  23   KQLLSGQHVVCVRCEEINISGGMVRQKAKYERFLRKRSVTNPRRGAVKFRAPSRILWRTV  82

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM PHKT RGAAAL RLK +EG+P PYDKVKRMVIPDALKVLRLQ GH+YC LG L+S 
Sbjct  83   RGMTPHKTARGAAALERLKAFEGIPAPYDKVKRMVIPDALKVLRLQHGHRYCQLGNLASS  142

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAE  190
            VGW H + +K LE KRK ++ A YE +K+L  LR KAE
Sbjct  143  VGWKHEEAVKELEAKRKVKSAAYYEAKKKLRSLRAKAE  180



>sp|P93099.1|RL13A_CYAPA RecName: Full=60S ribosomal protein L13a [Cyanophora paradoxa]
 emb|CAA71090.1| ribosomal protein L13a [Cyanophora paradoxa]
Length=200

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELLNGQRVV VR EEI +SG L R K+K+H FL+KRMNT P  GP HFR+P++ILWRTI
Sbjct  24   KELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNTNPRRGPFHFRSPARILWRTI  83

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKT RGAAAL RLK +EGVPPPYDK+KRMVIP AL+VLRL+ G K+C+LG+L++E
Sbjct  84   RGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIPQALRVLRLKPGRKFCVLGRLATE  143

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLR  202
            VGW H D +  LE KRK ++ A Y R+K L  LR
Sbjct  144  VGWRHSDLVTRLEEKRKTKSAAFYARKKTLVNLR  177



>ref|XP_001630812.1| predicted protein [Nematostella vectensis]
 gb|EDO38749.1| predicted protein [Nematostella vectensis]
Length=201

 Score =   224 bits (570),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K +L+GQRVVVVRCE+IC+SG   R K+KY  FLRKR NTKPSHGP HFRAPS+I WRT+
Sbjct  25   KSILSGQRVVVVRCEKICISGNFYRNKLKYLDFLRKRTNTKPSHGPFHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGMIPHKTK+G  A+ R+KV++GVPPPYDK KRMV+P ALKV+RL+ G K+C+LG+LS E
Sbjct  85   RGMIPHKTKKGTEAMNRMKVFDGVPPPYDKEKRMVVPSALKVIRLKPGRKFCVLGRLSHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW + D ++ LE KRK +++  +E +K++ KL+  AE    + L +    L+   Y
Sbjct  145  VGWKYQDILETLEEKRKAKSKLYFEHKKKVQKLKQTAELNKADELKSVNKTLAGYGY  201



>ref|XP_005643971.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19427.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=185

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+ LNGQ +VV R EEI +SGGLVRQKMKY RFLRKRMN+ P  GPIHFRAPS+I WRT+
Sbjct  23   KQALNGQHIVVTRAEEINVSGGLVRQKMKYERFLRKRMNSNPKKGPIHFRAPSRIFWRTV  82

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRGAAAL RLK +EGVPPPYDKVKRMV+PDALKVLRLQ GHK+C LG L++ 
Sbjct  83   RGMVPHKTKRGAAALERLKTFEGVPPPYDKVKRMVVPDALKVLRLQHGHKFCKLGDLAAS  142

Query  303  VGWNHYDTIKVLENKRKERAQAAY  232
            VGW H  ++  LE +R E+A+  Y
Sbjct  143  VGWKHKASVAELEARRLEKAKGFY  166



>ref|XP_004349662.1| ribosomal protein L13, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22573.1| ribosomal protein L13, putative [Acanthamoeba castellanii str. 
Neff]
Length=204

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++LNGQR+VVVRCEEI +SG   R K+KY  FL+K  N +P+HGP H+RAPSKI WRT+
Sbjct  28   KQILNGQRLVVVRCEEINVSGSFFRNKLKYLSFLKKCSNVRPTHGPYHYRAPSKIFWRTV  87

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+ HKT RGA AL RLKV+EGVPPPYDK+KRMV P AL+VLRL+ G  Y ++G+LS E
Sbjct  88   RGMVAHKTARGAEALGRLKVFEGVPPPYDKMKRMVCPAALRVLRLKPGRAYTVIGRLSEE  147

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW H  T+K LE KRK R+ A YER+K L +L+ KA     E+L   L+ L++  Y
Sbjct  148  VGWKHAATVKKLEEKRKVRSAAYYERKKALARLQTKALANRTEQLKPVLETLTAYGY  204



>ref|XP_008067417.1| PREDICTED: 60S ribosomal protein L13a [Tarsius syrichta]
Length=203

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQLT+LR +AEK  E+++G   ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAEKNVEKKIGKYTEVLKT  198



>gb|AAZ38985.1| 60S ribosomal protein L13a, partial [Oxyuranus scutellatus]
Length=186

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  8    KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  67

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  68   RGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKVVRLKPTRKFAFLGRLAHE  127

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDIL  148
            VGW +      LE KRKE+A+  Y ++KQL KLR +AEK  E ++    D+L
Sbjct  128  VGWKYQAITATLEEKRKEKAKVHYTKKKQLMKLRKQAEKNVESKISKYTDVL  179



>gb|ETE70282.1| 60S ribosomal protein L13a [Ophiophagus hannah]
Length=203

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKVVRLKPTRKFAFLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDIL  148
            VGW +      LE KRKE+A+  Y ++KQL KLR +AEK  E ++    D+L
Sbjct  145  VGWKYQAITATLEEKRKEKAKVHYTKKKQLMKLRKQAEKNVESKISKYTDVL  196



>ref|XP_004011713.1| PREDICTED: 60S ribosomal protein L13a-like [Ovis aries]
Length=203

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L GQ+VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGQKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPACKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++G   ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIEKKIGKFTEVLKT  198



>ref|XP_006160205.1| PREDICTED: 60S ribosomal protein L13a [Tupaia chinensis]
Length=203

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++G   ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEKKIGKYTEVLKT  198



>ref|XP_006905093.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Pteropus alecto]
Length=203

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++G   ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIGRYTEVLKT  198



>ref|XP_006905092.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Pteropus alecto]
Length=204

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  26   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  85

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  86   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  145

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++G   ++L +
Sbjct  146  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIGRYTEVLKT  199



>ref|XP_007431701.1| PREDICTED: 60S ribosomal protein L13a-like [Python bivittatus]
Length=203

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDIL  148
            VGW +      LE KRKE+A+  Y ++KQL KLR +AEK  E ++    D+L
Sbjct  145  VGWKYQAITATLEEKRKEKAKLHYTKKKQLMKLRKQAEKNVESKIAKYTDVL  196



>ref|XP_004472671.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Dasypus novemcinctus]
Length=203

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E ++G   ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVERKIGKYTEVLKT  198



>ref|XP_002723961.2| PREDICTED: 60S ribosomal protein L13a [Oryctolagus cuniculus]
Length=203

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    D+L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKISKFTDVLKT  198



>ref|NP_001070466.1| 60S ribosomal protein L13a [Bos taurus]
 ref|XP_005692777.1| PREDICTED: 60S ribosomal protein L13a [Capra hircus]
 ref|XP_005905051.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Bos mutus]
 ref|XP_006080162.1| PREDICTED: 60S ribosomal protein L13a [Bubalus bubalis]
 ref|XP_010847921.1| PREDICTED: 60S ribosomal protein L13a [Bison bison bison]
 sp|Q3SZ90.3|RL13A_BOVIN RecName: Full=60S ribosomal protein L13a [Bos taurus]
 gb|AAI03040.1| Ribosomal protein L13a [Bos taurus]
 tpg|DAA19656.1| TPA: 60S ribosomal protein L13a [Bos taurus]
Length=203

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++G   ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIEKKIGKFTEVLKT  198



>gb|ELR49590.1| 60S ribosomal protein L13a, partial [Bos mutus]
Length=199

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  21   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  80

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  81   RGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  140

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++G   ++L +
Sbjct  141  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNIEKKIGKFTEVLKT  194



>ref|XP_001491926.1| PREDICTED: 60S ribosomal protein L13a [Equus caballus]
 ref|XP_008522004.1| PREDICTED: 60S ribosomal protein L13a [Equus przewalskii]
Length=203

 Score =   214 bits (545),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQLT+LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLTRLRKQAEKNVEKKIDRYTEVLKT  198



>gb|AAX48846.1| L13a [Suberites domuncula]
Length=199

 Score =   213 bits (543),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K +L GQR+V+VRCE+I +SG   R K+KY +FL  R N  P  GP HFRAPS+I WRT+
Sbjct  22   KCILQGQRIVIVRCEDINISGSFYRNKLKYLKFLNLRCNVNPKRGPFHFRAPSRIFWRTV  81

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG  AL RLKV+EG+PPPYDK KRMV+P+AL+VLRL+ G KYC +G++S E
Sbjct  82   RGMVPHKTKRGMEALNRLKVFEGIPPPYDKQKRMVVPNALRVLRLKPGRKYCDIGRISHE  141

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERL  169
            +GW + D +K LE KRK RA   Y+R+KQ+ + + KAE   + RL
Sbjct  142  IGWKYKDVVKTLEEKRKARATEFYQRKKQVLRFKAKAEDVCKPRL  186



>ref|XP_004694340.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Condylura cristata]
Length=203

 Score =   213 bits (543),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAFLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEKKINKFTEVLKT  198



>ref|XP_003465562.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Cavia porcellus]
Length=203

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G +VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQ+ +LR +AEK  E+++G   ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVEKKIGKFTEVLKT  198



>ref|XP_011372842.1| PREDICTED: 60S ribosomal protein L13a [Pteropus vampyrus]
Length=181

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = -2

Query  648  GQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIP  469
            G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+RGM+P
Sbjct  8    GRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLP  67

Query  468  HKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNH  289
            HKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ EVGW +
Sbjct  68   HKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKY  127

Query  288  YDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
                  LE KRKE+A+  Y ++KQL +LR +AEK  E+++G   ++L +
Sbjct  128  QAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIGRYTEVLKT  176



>ref|XP_002762391.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Callithrix 
jacchus]
Length=203

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKINKYTEVLKT  198



>ref|XP_004619892.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Sorex araneus]
Length=203

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS++ WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRMFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    D+L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEKKITKFTDVLKA  198



>ref|XP_004597042.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Ochotona princeps]
Length=203

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEKKINKFTEVLKT  198



>ref|XP_005879589.1| PREDICTED: 60S ribosomal protein L13a [Myotis brandtii]
Length=203

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEKKINKFTEVLKT  198



>ref|XP_008843288.1| PREDICTED: 60S ribosomal protein L13a [Nannospalax galili]
Length=203

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKISKFTEVLKT  198



>ref|NP_001125810.1| 60S ribosomal protein L13a [Pongo abelii]
 sp|Q5RA38.3|RL13A_PONAB RecName: Full=60S ribosomal protein L13a [Pongo abelii]
 emb|CAH91372.1| hypothetical protein [Pongo abelii]
Length=203

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTSPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEKNVEKKIDKYTEVLKT  198



>ref|XP_002507247.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68505.1| predicted protein [Micromonas sp. RCC299]
Length=199

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K+LL GQ VVVVR E I +SGG+VR + +Y  F R RMNTKPSHGP H+ AP+++LWRT+
Sbjct  23   KQLLQGQHVVVVRAEGIVISGGIVRARQRYDYFKRLRMNTKPSHGPFHYAAPARMLWRTV  82

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+P+KT RGA A  R K YEG+PPPYDKVKR V+P+ALKVLRL AGHKYC+LG LS +
Sbjct  83   RGMLPYKTTRGACAFERFKAYEGIPPPYDKVKRAVVPEALKVLRLAAGHKYCVLGDLSHQ  142

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW H  T++ LE KR   A   + ++K+       A++AA  +LG    ++++  Y
Sbjct  143  VGWKHKTTVEALEEKRAAAASEYWTKKKEANSKFAAAKEAANSQLGDLAPLITATGY  199



>ref|XP_004672300.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Jaculus jaculus]
Length=203

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKINKFTEVLKT  198



>ref|XP_003453268.1| PREDICTED: 60S ribosomal protein L13a-like [Oreochromis niloticus]
Length=205

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 126/172 (73%), Gaps = 0/172 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G +VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPSKI WRT+
Sbjct  27   KQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSKIFWRTV  86

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+ LLG+L+ E
Sbjct  87   RGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKVVRLKPSRKFALLGRLAHE  146

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDIL  148
            VGW +      LE KRKE+++  Y ++K L  L  KAEK  E ++    D+L
Sbjct  147  VGWKYQAITATLEEKRKEKSKLRYTKKKTLINLTKKAEKNVESKIAKYTDVL  198



>gb|EFB23940.1| hypothetical protein PANDA_006273 [Ailuropoda melanoleuca]
Length=199

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  21   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  80

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  81   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  140

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  141  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKT  194



>ref|NP_036555.1| 60S ribosomal protein L13a isoform 1 [Homo sapiens]
 ref|XP_512821.2| PREDICTED: 60S ribosomal protein L13a [Pan troglodytes]
 ref|XP_002825903.1| PREDICTED: 60S ribosomal protein L13a [Pongo abelii]
 ref|XP_003814375.1| PREDICTED: 60S ribosomal protein L13a [Pan paniscus]
 ref|XP_004061207.1| PREDICTED: 60S ribosomal protein L13a isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004061208.1| PREDICTED: 60S ribosomal protein L13a isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004061209.1| PREDICTED: 60S ribosomal protein L13a isoform 3 [Gorilla gorilla 
gorilla]
 sp|P40429.2|RL13A_HUMAN RecName: Full=60S ribosomal protein L13a; AltName: Full=23 kDa 
highly basic protein [Homo sapiens]
 pdb|3J3B|O Chain O, Structure Of The Human 60s Ribosomal Proteins
 pdb|4CXD|O Chain O, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UPX|O Chain O, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4UQ1|O Chain O, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 emb|CAA40254.1| 23 kD highly basic protein [Homo sapiens]
 dbj|BAA88214.1| ribosomal protein L13a [Homo sapiens]
 gb|AAH00514.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH01675.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH01836.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH62537.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH65236.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH70223.1| Ribosomal protein L13a [Homo sapiens]
 gb|AAH71929.1| Ribosomal protein L13a [Homo sapiens]
 gb|EAW52495.1| ribosomal protein L13a, isoform CRA_a [Homo sapiens]
 dbj|BAF83809.1| unnamed protein product [Homo sapiens]
 gb|ACE86461.1| ribosomal protein L13a protein [synthetic construct]
 gb|ACE87142.1| ribosomal protein L13a protein [synthetic construct]
 dbj|BAI47189.1| ribosomal protein L13a [synthetic construct]
 gb|ADQ32192.1| ribosomal protein L13a [synthetic construct]
 gb|AIC50976.1| RPL13A, partial [synthetic construct]
 gb|AIC56063.1| RPL13A, partial [synthetic construct]
 gb|AIC63344.1| RPL13A, partial [synthetic construct]
Length=203

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKT  198



>gb|AAH04900.2| RPL13A protein, partial [Homo sapiens]
Length=201

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  23   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  82

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  83   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  142

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  143  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKT  196



>ref|XP_004767370.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Mustela putorius 
furo]
 ref|XP_004811758.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Mustela putorius 
furo]
Length=203

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKT  198



>gb|AAQ13495.1|AF109186_1 FWP004 [Homo sapiens]
Length=203

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKT  198



>ref|XP_007531370.1| PREDICTED: 60S ribosomal protein L13a isoform X3 [Erinaceus europaeus]
Length=203

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+ Y  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLNYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y R+KQL +LR +AEK AE+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKMHYRRKKQLMRLRKQAEKNAEKKICKFTEVLKT  198



>ref|XP_004409938.1| PREDICTED: 60S ribosomal protein L13a [Odobenus rosmarus divergens]
Length=203

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKT  198



>ref|XP_003226237.1| PREDICTED: 60S ribosomal protein L13a [Anolis carolinensis]
Length=203

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVFDGIPPPYDKRKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDIL  148
            VGW +      LE KRK++++  Y ++KQL KLR +AEK  E ++    DIL
Sbjct  145  VGWKYQAITATLEEKRKQKSKLHYAKKKQLMKLRKQAEKNVEPKIAKYTDIL  196



>gb|EPQ15989.1| 60S ribosomal protein L13a [Myotis brandtii]
Length=217

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  39   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  98

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  99   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  158

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  159  VGWKYQAVTATLEEKRKEKAKMHYRKKKQLMRLRKQAEKNVEKKINKFTEVLKT  212



>ref|NP_001291802.1| ribosomal protein L13a [Ailuropoda melanoleuca]
 ref|XP_003432774.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Canis lupus 
familiaris]
 ref|XP_006749338.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Leptonychotes 
weddellii]
 ref|XP_008573629.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Galeopterus 
variegatus]
 ref|XP_008682769.1| PREDICTED: 60S ribosomal protein L13a [Ursus maritimus]
 gb|AEA39509.1| ribosomal protein L13A [Ailuropoda melanoleuca]
 gb|AEA39561.1| ribosomal protein L13A [Ailuropoda melanoleuca]
Length=203

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKT  198



>ref|XP_005088148.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Mesocricetus 
auratus]
Length=203

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV +G+PPPYDK KRMV+P ALKVLRL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVLRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEKNVEKKISKFTEVLKT  198



>ref|XP_010584802.1| PREDICTED: 60S ribosomal protein L13a [Loxodonta africana]
Length=203

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKLHYRKKKQLMRLRKQAEKNVEKKINRYTEVLKT  198



>ref|XP_005412929.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Chinchilla 
lanigera]
Length=203

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++GVPPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGVPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQ+ +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVEKKISKFTEVLKT  198



>ref|XP_008152577.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Eptesicus fuscus]
Length=204

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  26   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  85

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  86   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  145

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  146  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKFTEVLKT  199



>ref|XP_008152578.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Eptesicus fuscus]
Length=203

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKFTEVLKT  198



>ref|XP_004381707.1| PREDICTED: 60S ribosomal protein L13a [Trichechus manatus latirostris]
Length=203

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKLHYRKKKQLMRLRKQAEKNVEKKINRFTEVLKT  198



>gb|EWM30220.1| 60s ribosomal protein l13a [Nannochloropsis gaditana]
Length=213

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            KELL+GQ+VVVVRCEE+ +SGGLVR   +Y +FLRKR NT P  GP H+RAPS+ILWRTI
Sbjct  26   KELLSGQKVVVVRCEELMISGGLVRNHTRYMQFLRKRTNTNPKRGPFHYRAPSRILWRTI  85

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKT RGA ALARL  +EG+P PYD  KR+V+P ALK+LRL+ G ++C L +L+ E
Sbjct  86   RGMLPHKTFRGAQALARLTTFEGIPAPYDTKKRVVVPQALKILRLKPGRRFCTLSRLAHE  145

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSSVKY  133
            VGW H D +  LE KRK +A+A Y+++K  T  +  AE+ A   L    ++L+   Y
Sbjct  146  VGWGHRDLVARLEAKRKIKAEAYYQQKKAGTAAKALAERKAASELSAVNNVLAGFGY  202



>ref|XP_004440337.1| PREDICTED: 60S ribosomal protein L13a isoform 1 [Ceratotherium 
simum simum]
Length=203

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDRYTEVLKT  198



>sp|Q4R8Z2.3|RL13A_MACFA RecName: Full=60S ribosomal protein L13a [Macaca fascicularis]
 dbj|BAE00429.1| unnamed protein product [Macaca fascicularis]
Length=203

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++     +L +
Sbjct  145  VGWKYQAVTTTLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTQVLKT  198



>ref|XP_005001821.1| PREDICTED: 60S ribosomal protein L13a isoform X2 [Cavia porcellus]
Length=219

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G +VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  41   KQVLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  100

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  101  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  160

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQ+ +LR +AEK  E+++G   ++L +
Sbjct  161  VGWKYQAVTATLEEKRKEKAKIHYRKKKQIMRLRKQAEKNVEKKIGKFTEVLKT  214



>ref|NP_001182348.1| ribosomal protein L13a [Macaca mulatta]
 ref|XP_009193226.1| PREDICTED: 60S ribosomal protein L13a isoform X1 [Papio anubis]
 ref|XP_010367773.1| PREDICTED: 60S ribosomal protein L13a isoform X3 [Rhinopithecus 
roxellana]
 dbj|BAE87320.1| unnamed protein product [Macaca fascicularis]
Length=203

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E+++     +L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTQVLKT  198



>ref|XP_011287982.1| PREDICTED: 60S ribosomal protein L13a [Felis catus]
Length=203

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = -2

Query  663  KELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTI  484
            K++L G++VVVVRCE I +SG   R K+KY  FLRKRMNT PS GP HFRAPS+I WRT+
Sbjct  25   KQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTV  84

Query  483  RGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSE  304
            RGM+PHKTKRG AAL RLKV++G+PPPYDK KRMV+P ALKV+RL+   K+  LG+L+ E
Sbjct  85   RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHE  144

Query  303  VGWNHYDTIKVLENKRKERAQAAYERRKQLTKLRVKAEKAAEERLGTQLDILSS  142
            VGW +      LE KRKE+A+  Y ++KQL +LR +AEK  E ++    ++L +
Sbjct  145  VGWKYQAVTATLEEKRKEKAKIHYRKKKQLVRLRKQAEKNVEGKINKYTEVLKT  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140